Query         psy12936
Match_columns 187
No_of_seqs    181 out of 369
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 23:31:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12936.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12936hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1763|consensus              100.0   4E-61 8.7E-66  424.1   8.8  156    1-170   158-314 (343)
  2 COG5252 Uncharacterized conser 100.0 6.1E-44 1.3E-48  308.7   5.0  134    1-141   143-278 (299)
  3 KOG4018|consensus               98.9 4.9E-10 1.1E-14   96.1   3.0   71   49-128   125-195 (215)
  4 PF01396 zf-C4_Topoisom:  Topoi  95.7  0.0065 1.4E-07   39.1   1.8   26    9-34     13-38  (39)
  5 smart00356 ZnF_C3H1 zinc finge  94.8   0.014 2.9E-07   33.4   1.0   14   19-32     14-27  (27)
  6 PF00642 zf-CCCH:  Zinc finger   94.8    0.01 2.3E-07   35.1   0.5   22    1-31      5-26  (27)
  7 PF14608 zf-CCCH_2:  Zinc finge  93.2   0.052 1.1E-06   30.1   1.3   13   19-31      7-19  (19)
  8 KOG1763|consensus               72.8     1.4 3.1E-05   40.5   0.6   53    1-66     94-153 (343)
  9 COG0551 TopA Zn-finger domain   69.6     2.6 5.6E-05   33.1   1.4   18   11-28     31-48  (140)
 10 KOG1039|consensus               63.6     4.1 8.9E-05   37.6   1.6   27    2-36    252-278 (344)
 11 KOG2185|consensus               60.7     4.2 9.1E-05   39.0   1.1   22    1-32    142-163 (486)
 12 COG5175 MOT2 Transcriptional r  55.0      10 0.00022   35.9   2.6   16   18-34    212-227 (480)
 13 KOG1039|consensus               53.8     4.3 9.3E-05   37.5  -0.0   24    1-34     10-33  (344)
 14 KOG1040|consensus               53.1       6 0.00013   36.3   0.8   15   19-33    116-130 (325)
 15 PF13295 DUF4077:  Domain of un  52.7     4.6  0.0001   33.2   0.0   22    1-22     27-56  (175)
 16 PF08432 Vfa1:  AAA-ATPase Vps4  49.9      15 0.00032   30.6   2.6   11   12-22     31-41  (182)
 17 KOG2494|consensus               49.7     6.7 0.00015   36.3   0.6   21    1-31     39-60  (331)
 18 PF15086 UPF0542:  Uncharacteri  45.9      40 0.00087   25.1   4.0   33   70-102    30-63  (74)
 19 smart00661 RPOL9 RNA polymeras  45.5     9.5 0.00021   24.7   0.7   25   16-43     19-43  (52)
 20 KOG0878|consensus               43.8      11 0.00024   30.4   0.9   14   23-36     60-73  (124)
 21 PRK07561 DNA topoisomerase I s  42.9      12 0.00025   38.2   1.1   26    9-34    599-627 (859)
 22 KOG2295|consensus               40.4     9.2  0.0002   37.9  -0.0   47    4-52    496-543 (648)
 23 PF06839 zf-GRF:  GRF zinc fing  40.3      19 0.00041   23.3   1.5   20   11-30     19-40  (45)
 24 KOG1040|consensus               40.1      12 0.00027   34.3   0.8   17   19-35    144-160 (325)
 25 PF00706 Toxin_4:  Anenome neur  39.8     9.7 0.00021   25.6   0.0   14   16-29     21-35  (43)
 26 PRK06319 DNA topoisomerase I/S  39.6      17 0.00037   37.1   1.7   24   10-33    658-681 (860)
 27 KOG4791|consensus               39.4      15 0.00032   36.2   1.2   18   17-34     66-86  (667)
 28 PRK07220 DNA topoisomerase I;   37.1      28 0.00061   34.9   2.7   68   11-84    651-738 (740)
 29 COG5222 Uncharacterized conser  37.1      41 0.00088   31.5   3.6   58    7-74    300-358 (427)
 30 PRK07219 DNA topoisomerase I;   35.9      17 0.00038   36.7   1.1   24   11-34    616-640 (822)
 31 PF02662 FlpD:  Methyl-viologen  34.4      31 0.00067   27.0   2.1   28    3-31     43-71  (124)
 32 PF05416 Peptidase_C37:  Southa  34.0      13 0.00028   36.1  -0.1   20   15-35    381-401 (535)
 33 COG5084 YTH1 Cleavage and poly  33.7      17 0.00038   32.9   0.6   18   20-37    146-163 (285)
 34 PF03194 LUC7:  LUC7 N_terminus  32.0      15 0.00031   32.4  -0.1   22    1-32     32-62  (254)
 35 cd01121 Sms Sms (bacterial rad  31.1      19 0.00042   33.1   0.5    9   14-22     11-19  (372)
 36 KOG4312|consensus               30.6      26 0.00057   33.2   1.3   17   19-35    368-384 (449)
 37 PF07141 Phage_term_sma:  Putat  30.4      57  0.0012   27.2   3.1   47   71-121    41-91  (174)
 38 KOG0378|consensus               30.2      24 0.00052   31.7   0.9   34   11-44     21-54  (263)
 39 PRK06319 DNA topoisomerase I/S  29.8      29 0.00064   35.4   1.6   26    9-34    605-630 (860)
 40 TIGR00416 sms DNA repair prote  29.7      20 0.00043   33.8   0.4    9   14-22     18-26  (454)
 41 COG1781 PyrI Aspartate carbamo  28.9      30 0.00064   28.9   1.2   26   17-43    106-133 (153)
 42 KOG1677|consensus               28.1      29 0.00062   30.5   1.1   15   19-33    188-202 (332)
 43 PF14753 DUF4475:  Domain of un  27.9      24 0.00052   30.5   0.5   22    6-28     28-49  (196)
 44 PRK11823 DNA repair protein Ra  27.8      23  0.0005   33.2   0.4    9   14-22     18-26  (446)
 45 KOG4791|consensus               27.2      22 0.00047   35.1   0.1    8   24-31     46-53  (667)
 46 PF07936 Defensin_4:  Potassium  27.1      16 0.00035   23.4  -0.5   13   16-28     13-31  (34)
 47 PRK06599 DNA topoisomerase I;   26.5      40 0.00086   33.4   1.8   25   10-34    599-623 (675)
 48 PF10587 EF-1_beta_acid:  Eukar  25.5      30 0.00065   21.3   0.5    7  124-130     1-7   (28)
 49 PF02748 PyrI_C:  Aspartate car  25.4      33 0.00072   23.4   0.8   21   18-39      7-29  (52)
 50 PRK11548 outer membrane biogen  23.8      64  0.0014   24.7   2.2   49   20-78     20-68  (113)
 51 PRK14973 DNA topoisomerase I;   23.4      32  0.0007   35.7   0.6   71    8-84    648-723 (936)
 52 PF10050 DUF2284:  Predicted me  22.9      23 0.00049   28.8  -0.5   11   12-22     25-35  (166)
 53 PF00111 Fer2:  2Fe-2S iron-sul  22.5      74  0.0016   21.7   2.1   32    5-37     19-52  (78)
 54 PRK07561 DNA topoisomerase I s  20.7      47   0.001   34.0   1.0   24   10-33    716-740 (859)
 55 PRK14973 DNA topoisomerase I;   20.1      52  0.0011   34.3   1.2   24   10-33    601-624 (936)

No 1  
>KOG1763|consensus
Probab=100.00  E-value=4e-61  Score=424.09  Aligned_cols=156  Identities=50%  Similarity=0.950  Sum_probs=138.3

Q ss_pred             CchhHHHHHHcCCCCccccCCC-CCCccccccCCCccccccchhhHhhhcccChHHHHHHHHHHhccCCCcccccHHHHH
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPN-GPTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASSKFTKVTLDSFL   79 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPn-G~~C~YrH~LPpG~Vlk~~~k~ee~~~eisLEE~iE~ER~kL~~~~~gTpVT~EsFl   79 (187)
                      ||||||+|||+|+|||||+||| |+.|+||||||+|||||+++|+++++++||||++||.||++|++|  +||||+|||+
T Consensus       158 VCKfFLeAvE~~kYGWfW~CPnGg~~C~YrHaLP~GyVLk~dkkk~ek~~eISlEe~IE~ER~~L~~n--lT~~T~e~F~  235 (343)
T KOG1763|consen  158 VCKFFLEAVENGKYGWFWECPNGGDKCIYRHALPEGYVLKRDKKKLEKQDEISLEELIEKERAALGPN--LTPLTEETFK  235 (343)
T ss_pred             HHHHHHHHHhcCCccceeECCCCCCeeeeeecCCcchhhhhhhhhhcccccccHHHHHHHHHHhcCCC--CccccHHHHH
Confidence            8999999999999999999999 589999999999999999999999999999999999999999999  9999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhhhccccCcccccccccCCCCccCCCCcCcccccccccCCCCCCccccccchhhhh
Q psy12936         80 AWKKRKLKEKSEAMTKAEEKKRSDFKAGRQVGLSGRDMFSFNPDLAKDDMDEGDEAFDSYTRDEEEDPESNYRELDLDML  159 (187)
Q Consensus        80 ~WKkkk~~Ek~~~~~~~~e~kk~~~kaGk~~~LSGRELFe~dp~L~~DD~d~~dea~d~~~~~~~~~~~~~~~~idl~~~  159 (187)
                      +||+++++++++++++.+++++   +.|++. |||||||+++++||+||+++ .++++...+.+++|+.+.+++||+..|
T Consensus       236 ~WKk~k~~er~~k~~~~~~~~k---~~gk~~-~sGRElF~~~~dl~~dd~~e-~~d~e~~~~~ee~d~~~k~~e~d~~~~  310 (343)
T KOG1763|consen  236 AWKKRKIRERKEKLAAEKAERK---KVGKSN-MSGRELFESNADLVNDDDEE-AGDLEYTEYSEETDEEAKVKEADAPIF  310 (343)
T ss_pred             HHHHhhHHHHHHHHHHHHHHhh---hhccCC-CchHHHHhhchhhccCchhh-ccchhhhhhccchhhhhhhhhcccccc
Confidence            9999999999999888776665   678866 99999999999999996322 222333334678889999999999888


Q ss_pred             hhhccccccCC
Q psy12936        160 LNEAAELDETN  170 (187)
Q Consensus       160 ~~~~~~vd~tg  170 (187)
                             |++|
T Consensus       311 -------d~~~  314 (343)
T KOG1763|consen  311 -------DGSG  314 (343)
T ss_pred             -------cccC
Confidence                   6777


No 2  
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only]
Probab=100.00  E-value=6.1e-44  Score=308.74  Aligned_cols=134  Identities=40%  Similarity=0.757  Sum_probs=110.0

Q ss_pred             CchhHHHHHHcCCCCccccCCCC-CCccccccCCCccccccchhhHhhhcccChHHHHHHHHHHhccCCCcccccHHHHH
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNG-PTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASSKFTKVTLDSFL   79 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG-~~C~YrH~LPpG~Vlk~~~k~ee~~~eisLEE~iE~ER~kL~~~~~gTpVT~EsFl   79 (187)
                      ||||||+|+|+|+|||||.|||| +.|+|+|+||.||||++++++.+.+.+||||++||.||+.|+++  +||||.|+|.
T Consensus       143 VCkffieA~e~GkYgw~W~CPng~~~C~y~H~Lp~GyVLsrdk~Kd~tq~eislEefIE~eR~~L~~~--LTP~TeenFk  220 (299)
T COG5252         143 VCKFFIEAMESGKYGWGWTCPNGNMRCSYIHKLPDGYVLSRDKIKDSTQVEISLEEFIELERQSLPEK--LTPLTEENFK  220 (299)
T ss_pred             HHHHHHHHHhcCCccceeeCCCCCceeeeeeccCccceeccccccccccccccHHHHHHHHhccCCCc--CCcccHHHHH
Confidence            79999999999999999999995 89999999999999999999999999999999999999999999  9999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhhhccccCcccc-cccccCCCCccCCCCcCccccccccc
Q psy12936         80 AWKKRKLKEKSEAMTKAEEKKRSDFKAGRQVGLSGR-DMFSFNPDLAKDDMDEGDEAFDSYTR  141 (187)
Q Consensus        80 ~WKkkk~~Ek~~~~~~~~e~kk~~~kaGk~~~LSGR-ELFe~dp~L~~DD~d~~dea~d~~~~  141 (187)
                      +||.-++-.....+++....|+   -.|+.+ +||+ ++|+.+..++-||.. +.++||..++
T Consensus       221 ~Wkd~~~~r~lkq~ee~~s~Rk---~~gr~~-~~k~~e~FEt~~d~~~ddv~-~ge~wD~te~  278 (299)
T COG5252         221 EWKDGRRLRILKQKEEKESARK---VKGRAT-GTKGVELFETRRDLFKDDVE-AGEEWDYTER  278 (299)
T ss_pred             HhccchHHHHHHHHHHHHhccc---chhhhh-hccchhhhhccccccccccc-ccccccHHHH
Confidence            9998777554333332222222   235644 4555 999999999999754 3345665544


No 3  
>KOG4018|consensus
Probab=98.93  E-value=4.9e-10  Score=96.08  Aligned_cols=71  Identities=28%  Similarity=0.400  Sum_probs=52.5

Q ss_pred             cccChHHHHHHHHHHhccCCCcccccHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhccccCcccccccccCCCCccCC
Q psy12936         49 DQISLEDLIERERAALAASSKFTKVTLDSFLAWKKRKLKEKSEAMTKAEEKKRSDFKAGRQVGLSGRDMFSFNPDLAKDD  128 (187)
Q Consensus        49 ~eisLEE~iE~ER~kL~~~~~gTpVT~EsFl~WKkkk~~Ek~~~~~~~~e~kk~~~kaGk~~~LSGRELFe~dp~L~~DD  128 (187)
                      -++..++..|.||++++    |||||++||++||.+|.++......+.+. +   .++ ..+++|||++|+.++.+-.+|
T Consensus       125 ~e~~~~~~ee~e~~kfh----gt~VT~esfl~Wk~~fe~el~~~~~k~~~-~---~~~-~~~k~tgRQ~f~~d~~~~~~~  195 (215)
T KOG4018|consen  125 REQEAREAEEEERKKFH----GTPVTLESFLEWKLKFEEELLQIKAKVKK-R---LQA-LAKKLTGRQLFETDHKGDRSD  195 (215)
T ss_pred             HHHHHHHHHHHhhcccc----CCceehhhhHHHHHhhhhhhhhhhhhhhh-H---HHH-HhhhHHHHHHHHhcccCChhh
Confidence            34566777778888877    99999999999999999998433333222 2   122 235699999999998887764


No 4  
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=95.72  E-value=0.0065  Score=39.13  Aligned_cols=26  Identities=38%  Similarity=0.795  Sum_probs=23.3

Q ss_pred             HHcCCCCccccCCCCCCccccccCCC
Q psy12936          9 VENSKYGWFWSCPNGPTCIYKHALPP   34 (187)
Q Consensus         9 ve~~kYGwfW~CPnG~~C~YrH~LPp   34 (187)
                      +..+++|.||.|.|-..|.|...||+
T Consensus        13 ~r~~k~g~F~~Cs~yP~C~~~~~~~~   38 (39)
T PF01396_consen   13 LRRGKKGKFLGCSNYPECKYTEPLPK   38 (39)
T ss_pred             EEECCCCCEEECCCCCCcCCeEeCCC
Confidence            35789999999999999999999985


No 5  
>smart00356 ZnF_C3H1 zinc finger.
Probab=94.83  E-value=0.014  Score=33.41  Aligned_cols=14  Identities=43%  Similarity=1.092  Sum_probs=12.6

Q ss_pred             cCCCCCCccccccC
Q psy12936         19 SCPNGPTCIYKHAL   32 (187)
Q Consensus        19 ~CPnG~~C~YrH~L   32 (187)
                      .|+.|+.|.|.|.+
T Consensus        14 ~C~~g~~C~~~H~~   27 (27)
T smart00356       14 YCPYGDRCKFAHPL   27 (27)
T ss_pred             CCCCCCCcCCCCcC
Confidence            79999999999964


No 6  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=94.78  E-value=0.01  Score=35.14  Aligned_cols=22  Identities=36%  Similarity=1.256  Sum_probs=16.0

Q ss_pred             CchhHHHHHHcCCCCccccCCCCCCcccccc
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNGPTCIYKHA   31 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG~~C~YrH~   31 (187)
                      +|++|+..      |   .||.|+.|.|.|.
T Consensus         5 ~C~~f~~~------g---~C~~G~~C~f~H~   26 (27)
T PF00642_consen    5 LCRFFMRT------G---TCPFGDKCRFAHG   26 (27)
T ss_dssp             B-HHHHHT------S-----TTGGGSSSBSS
T ss_pred             cChhhccC------C---ccCCCCCcCccCC
Confidence            58999874      2   5999999999994


No 7  
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=93.24  E-value=0.052  Score=30.06  Aligned_cols=13  Identities=38%  Similarity=1.104  Sum_probs=11.5

Q ss_pred             cCCCCCCcccccc
Q psy12936         19 SCPNGPTCIYKHA   31 (187)
Q Consensus        19 ~CPnG~~C~YrH~   31 (187)
                      .|+||++|.|+|.
T Consensus         7 ~C~~~~~C~f~HP   19 (19)
T PF14608_consen    7 NCTNGDNCPFSHP   19 (19)
T ss_pred             CCCCCCcCccCCc
Confidence            3999999999994


No 8  
>KOG1763|consensus
Probab=72.80  E-value=1.4  Score=40.45  Aligned_cols=53  Identities=25%  Similarity=0.600  Sum_probs=36.0

Q ss_pred             CchhHHHHHHcCCCCccccCCCCCCccccccCCCccccccchhh-------HhhhcccChHHHHHHHHHHhcc
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKK-------EEKKDQISLEDLIERERAALAA   66 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG~~C~YrH~LPpG~Vlk~~~k~-------ee~~~eisLEE~iE~ER~kL~~   66 (187)
                      ||=||.+++          |--|+.|++.|-|-.+   ++..|.       .+-.++-.|+++++.-+.+..+
T Consensus        94 vCafFk~g~----------C~KG~kCKFsHdl~~~---~k~eK~dly~d~rdemWD~~kl~~vv~~K~~k~k~  153 (343)
T KOG1763|consen   94 VCAFFKQGT----------CTKGDKCKFSHDLAVE---RKKEKIDLYPDTRDEMWDEEKLEEVVLKKHGKPKP  153 (343)
T ss_pred             HHHHHhccC----------CCCCCcccccchHHHh---hhccchhccccchhhhhhHHHHHHHHHhhccCCCC
Confidence            688888874          8889999999999842   221221       1125667888888877654444


No 9  
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=69.63  E-value=2.6  Score=33.09  Aligned_cols=18  Identities=50%  Similarity=1.012  Sum_probs=16.7

Q ss_pred             cCCCCccccCCCCCCccc
Q psy12936         11 NSKYGWFWSCPNGPTCIY   28 (187)
Q Consensus        11 ~~kYGwfW~CPnG~~C~Y   28 (187)
                      .++||||+.|-|..+|.|
T Consensus        31 ~~~~g~f~gCs~yP~C~~   48 (140)
T COG0551          31 FGKYGIFLGCSNYPKCDY   48 (140)
T ss_pred             EccCCeEEEeCCCCCCCC
Confidence            578999999999999999


No 10 
>KOG1039|consensus
Probab=63.61  E-value=4.1  Score=37.65  Aligned_cols=27  Identities=56%  Similarity=1.148  Sum_probs=21.0

Q ss_pred             chhHHHHHHcCCCCccccCCCCCCccccccCCCcc
Q psy12936          2 CKYFIEAVENSKYGWFWSCPNGPTCIYKHALPPGF   36 (187)
Q Consensus         2 Ck~fl~Ave~~kYGwfW~CPnG~~C~YrH~LPpG~   36 (187)
                      |+||-      ++  -=.||.|.+|-|+|.+|-|=
T Consensus       252 c~yf~------~~--~g~cPf~s~~~y~h~~~~~~  278 (344)
T KOG1039|consen  252 CKYFS------QG--LGSCPFGSKCFYKHLLPSGA  278 (344)
T ss_pred             hhhhc------CC--CCCCCCCCcccccccccccc
Confidence            77776      11  24699999999999999764


No 11 
>KOG2185|consensus
Probab=60.72  E-value=4.2  Score=38.96  Aligned_cols=22  Identities=41%  Similarity=1.056  Sum_probs=19.3

Q ss_pred             CchhHHHHHHcCCCCccccCCCCCCccccccC
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNGPTCIYKHAL   32 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG~~C~YrH~L   32 (187)
                      .|+|||+-          .|-.|.+|.+.|-+
T Consensus       142 pC~ffLeg----------~CRF~enCRfSHG~  163 (486)
T KOG2185|consen  142 PCKFFLEG----------RCRFGENCRFSHGL  163 (486)
T ss_pred             cchHhhcc----------ccccCcccccccCc
Confidence            59999986          69999999999954


No 12 
>COG5175 MOT2 Transcriptional repressor [Transcription]
Probab=54.99  E-value=10  Score=35.94  Aligned_cols=16  Identities=50%  Similarity=1.151  Sum_probs=13.1

Q ss_pred             ccCCCCCCccccccCCC
Q psy12936         18 WSCPNGPTCIYKHALPP   34 (187)
Q Consensus        18 W~CPnG~~C~YrH~LPp   34 (187)
                      =+||| .+|||.|-.-|
T Consensus       212 ~~CpN-p~CMyLHEpg~  227 (480)
T COG5175         212 AVCPN-PDCMYLHEPGP  227 (480)
T ss_pred             CCCCC-CCeeeecCCCc
Confidence            47999 88999997553


No 13 
>KOG1039|consensus
Probab=53.81  E-value=4.3  Score=37.55  Aligned_cols=24  Identities=42%  Similarity=0.955  Sum_probs=20.7

Q ss_pred             CchhHHHHHHcCCCCccccCCCCCCccccccCCC
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNGPTCIYKHALPP   34 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG~~C~YrH~LPp   34 (187)
                      |||||+.-+          |-.|+.|.|-|.+|.
T Consensus        10 ic~~~~~g~----------c~~g~~cr~~h~~~~   33 (344)
T KOG1039|consen   10 ICKYYQKGN----------CKFGDLCRLSHSLPD   33 (344)
T ss_pred             hhhhccccc----------ccccceeeeeccCch
Confidence            799988764          778899999999994


No 14 
>KOG1040|consensus
Probab=53.14  E-value=6  Score=36.32  Aligned_cols=15  Identities=47%  Similarity=1.028  Sum_probs=12.2

Q ss_pred             cCCCCCCccccccCC
Q psy12936         19 SCPNGPTCIYKHALP   33 (187)
Q Consensus        19 ~CPnG~~C~YrH~LP   33 (187)
                      .|-||.+|-|.|-=|
T Consensus       116 ~c~~~~~c~y~h~dp  130 (325)
T KOG1040|consen  116 ECTNGKDCPYLHGDP  130 (325)
T ss_pred             ccccccCCcccCCCh
Confidence            488888888888877


No 15 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=52.67  E-value=4.6  Score=33.16  Aligned_cols=22  Identities=36%  Similarity=1.109  Sum_probs=19.9

Q ss_pred             CchhHHHHHHcCCCCc--------cccCCC
Q psy12936          1 ICKYFIEAVENSKYGW--------FWSCPN   22 (187)
Q Consensus         1 vCk~fl~Ave~~kYGw--------fW~CPn   22 (187)
                      +|.|||--|--|-||.        ||+|.-
T Consensus        27 icsfflgiiaigyygyifteraiafwvcgi   56 (175)
T PF13295_consen   27 ICSFFLGIIAIGYYGYIFTERAIAFWVCGI   56 (175)
T ss_pred             HHHHHHHHHHHhhhheeehhHHHHHHhhch
Confidence            6999999999999997        899974


No 16 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=49.92  E-value=15  Score=30.61  Aligned_cols=11  Identities=27%  Similarity=0.999  Sum_probs=8.8

Q ss_pred             CCCCccccCCC
Q psy12936         12 SKYGWFWSCPN   22 (187)
Q Consensus        12 ~kYGwfW~CPn   22 (187)
                      +.=-||.+||.
T Consensus        31 ~~~DfFY~C~~   41 (182)
T PF08432_consen   31 DNKDFFYVCPS   41 (182)
T ss_pred             CCCCeEEeCcc
Confidence            34479999998


No 17 
>KOG2494|consensus
Probab=49.68  E-value=6.7  Score=36.28  Aligned_cols=21  Identities=29%  Similarity=0.996  Sum_probs=13.7

Q ss_pred             CchhHHHHHHcCCCCccccCCCCCC-cccccc
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPNGPT-CIYKHA   31 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPnG~~-C~YrH~   31 (187)
                      ||+-||--+          |--|+. |+|+|-
T Consensus        39 VCReF~rn~----------C~R~d~~CkfaHP   60 (331)
T KOG2494|consen   39 VCREFLRNT----------CSRGDRECKFAHP   60 (331)
T ss_pred             HHHHHHhcc----------ccCCCccccccCC
Confidence            677777653          666665 777774


No 18 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=45.92  E-value=40  Score=25.05  Aligned_cols=33  Identities=30%  Similarity=0.489  Sum_probs=22.1

Q ss_pred             ccccc-HHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy12936         70 FTKVT-LDSFLAWKKRKLKEKSEAMTKAEEKKRS  102 (187)
Q Consensus        70 gTpVT-~EsFl~WKkkk~~Ek~~~~~~~~e~kk~  102 (187)
                      +||.= +--|+.||-.+.-+++++.++.+.+|.+
T Consensus        30 LtPlfiisa~lSwkLaK~ie~~ere~K~k~Kr~~   63 (74)
T PF15086_consen   30 LTPLFIISAVLSWKLAKAIEKEEREKKKKAKRQA   63 (74)
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56654 3459999999988877766654444443


No 19 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=45.53  E-value=9.5  Score=24.65  Aligned_cols=25  Identities=24%  Similarity=0.553  Sum_probs=19.5

Q ss_pred             ccccCCCCCCccccccCCCccccccchh
Q psy12936         16 WFWSCPNGPTCIYKHALPPGFVLKKDKK   43 (187)
Q Consensus        16 wfW~CPnG~~C~YrH~LPpG~Vlk~~~k   43 (187)
                      ..|+||.   |-|.|.++|-.|++....
T Consensus        19 ~~~vC~~---Cg~~~~~~~~~~~~~~~~   43 (52)
T smart00661       19 RRFVCRK---CGYEEPIEQKYVYKEKLK   43 (52)
T ss_pred             CEEECCc---CCCeEECCCcEEEEEEec
Confidence            4899995   889999998867765543


No 20 
>KOG0878|consensus
Probab=43.78  E-value=11  Score=30.37  Aligned_cols=14  Identities=43%  Similarity=0.786  Sum_probs=11.4

Q ss_pred             CCCccccccCCCcc
Q psy12936         23 GPTCIYKHALPPGF   36 (187)
Q Consensus        23 G~~C~YrH~LPpG~   36 (187)
                      |.+=+.||.||+||
T Consensus        60 gsnKkTrh~lP~G~   73 (124)
T KOG0878|consen   60 GSNKKTRHMLPNGF   73 (124)
T ss_pred             CCCccceecCChhh
Confidence            45667899999996


No 21 
>PRK07561 DNA topoisomerase I subunit omega; Validated
Probab=42.87  E-value=12  Score=38.19  Aligned_cols=26  Identities=27%  Similarity=0.560  Sum_probs=21.6

Q ss_pred             HHcCCCCccccCCCC---CCccccccCCC
Q psy12936          9 VENSKYGWFWSCPNG---PTCIYKHALPP   34 (187)
Q Consensus         9 ve~~kYGwfW~CPnG---~~C~YrH~LPp   34 (187)
                      +..|+||.||.|.|.   ..|.|..-++|
T Consensus       599 ~r~gr~G~Fl~Cs~y~~~p~C~~~~~l~~  627 (859)
T PRK07561        599 IRTGKTGVFLGCSGYALKERCKTTRNLTP  627 (859)
T ss_pred             EEecCCCCeeeccCCcCCCCCCCCCCCCc
Confidence            345899999999986   79999887775


No 22 
>KOG2295|consensus
Probab=40.45  E-value=9.2  Score=37.94  Aligned_cols=47  Identities=23%  Similarity=0.282  Sum_probs=30.2

Q ss_pred             hHHHHHHcCCCCccccCCCCCCccccccCCCccccccchhh-HhhhcccC
Q psy12936          4 YFIEAVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKK-EEKKDQIS   52 (187)
Q Consensus         4 ~fl~Ave~~kYGwfW~CPnG~~C~YrH~LPpG~Vlk~~~k~-ee~~~eis   52 (187)
                      -||+-+--.+|+|.|-||-+.--+--|  -|.||-|.=.+| .++-++|+
T Consensus       496 ~~v~s~t~e~~kdKy~C~lsgc~KlF~--gpEFvrKHi~~KH~d~leeir  543 (648)
T KOG2295|consen  496 NFVDSNTMELDKDKYLCPLSGCAKLFK--GPEFVRKHINKKHKDKLEEIR  543 (648)
T ss_pred             HHHHHHHHHhhcccccCCCcchHhhcc--CHHHHHHHHHHHHHHHHHHHH
Confidence            377777788999999999832212223  367888876655 44433443


No 23 
>PF06839 zf-GRF:  GRF zinc finger;  InterPro: IPR010666 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This presumed zinc-binding domain is found in a variety of DNA-binding proteins. It seems likely that this domain is involved in nucleic acid binding. It is named GRF after three conserved residues in the centre of the alignment of the domain. This zinc finger may be related to IPR000380 from INTERPRO. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=40.29  E-value=19  Score=23.31  Aligned_cols=20  Identities=25%  Similarity=0.549  Sum_probs=14.8

Q ss_pred             cCCCCccccCCCCC--Cccccc
Q psy12936         11 NSKYGWFWSCPNGP--TCIYKH   30 (187)
Q Consensus        11 ~~kYGwfW~CPnG~--~C~YrH   30 (187)
                      .|.--.||.||+..  .|.|-.
T Consensus        19 ~N~GR~Fy~C~~~~~~~C~fF~   40 (45)
T PF06839_consen   19 PNPGRRFYKCPNYKDKGCNFFQ   40 (45)
T ss_pred             CCCCCcceECCCCCCCCcCCEE
Confidence            45667899999954  688743


No 24 
>KOG1040|consensus
Probab=40.10  E-value=12  Score=34.30  Aligned_cols=17  Identities=29%  Similarity=0.606  Sum_probs=14.5

Q ss_pred             cCCCCCCccccccCCCc
Q psy12936         19 SCPNGPTCIYKHALPPG   35 (187)
Q Consensus        19 ~CPnG~~C~YrH~LPpG   35 (187)
                      .|++|.+|+|||.++++
T Consensus       144 ~c~~g~~c~~~h~~~~~  160 (325)
T KOG1040|consen  144 FCRGGPSCKKRHERKVL  160 (325)
T ss_pred             cCCCcchhhhhhhcccC
Confidence            49999999999988754


No 25 
>PF00706 Toxin_4:  Anenome neurotoxin;  InterPro: IPR000693 Sea anemones produce many different neurotoxins with related structure and function. Proteins belonging to this family include the neurotoxins, of which there are several, including calitoxin and anthopleurin. The neurotoxins bind specifically to the sodium channel, thereby delaying its inactivation during signal transduction, resulting in strong stimulation of mammalian cardiac muscle contraction. Calitoxin 1 has been found in neuromuscular prearations of crustaceans, where it increases transmitter release, causing firing of the axons. Three disulphide bonds are present in this protein [, , ].; GO: 0009966 regulation of signal transduction, 0005576 extracellular region; PDB: 2H9X_A 1AHL_A 1APF_A 1SHI_A 1SH1_A 2SH1_A 1ATX_A.
Probab=39.84  E-value=9.7  Score=25.59  Aligned_cols=14  Identities=36%  Similarity=1.270  Sum_probs=11.0

Q ss_pred             ccccCCCC-CCcccc
Q psy12936         16 WFWSCPNG-PTCIYK   29 (187)
Q Consensus        16 wfW~CPnG-~~C~Yr   29 (187)
                      |+|.||.| .+|.-.
T Consensus        21 w~~~CpsGWh~C~~~   35 (43)
T PF00706_consen   21 WLFGCPSGWHKCKSS   35 (43)
T ss_dssp             ETSSS-TTEEECCSC
T ss_pred             eecCCCchhhhhhcc
Confidence            99999999 899753


No 26 
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated
Probab=39.62  E-value=17  Score=37.12  Aligned_cols=24  Identities=25%  Similarity=0.558  Sum_probs=20.1

Q ss_pred             HcCCCCccccCCCCCCccccccCC
Q psy12936         10 ENSKYGWFWSCPNGPTCIYKHALP   33 (187)
Q Consensus        10 e~~kYGwfW~CPnG~~C~YrH~LP   33 (187)
                      .+|+||-||.|.|...|+|.-.+|
T Consensus       658 K~gr~G~Fl~Cs~yP~Ck~~~~l~  681 (860)
T PRK06319        658 RHGRFGTFLGCENYPECRGIINIH  681 (860)
T ss_pred             ecCCCCceeeCCCCccccccccCC
Confidence            468999999999889999875554


No 27 
>KOG4791|consensus
Probab=39.42  E-value=15  Score=36.23  Aligned_cols=18  Identities=33%  Similarity=0.818  Sum_probs=14.1

Q ss_pred             cccCCCC---CCccccccCCC
Q psy12936         17 FWSCPNG---PTCIYKHALPP   34 (187)
Q Consensus        17 fW~CPnG---~~C~YrH~LPp   34 (187)
                      .|-=|||   ++|-|||+-||
T Consensus        66 we~~p~gC~k~~CgfRH~~pP   86 (667)
T KOG4791|consen   66 WENQPTGCQKLNCGFRHNRPP   86 (667)
T ss_pred             eecCCCccCCCccccccCCCc
Confidence            3556775   89999999876


No 28 
>PRK07220 DNA topoisomerase I; Validated
Probab=37.08  E-value=28  Score=34.93  Aligned_cols=68  Identities=22%  Similarity=0.396  Sum_probs=0.0

Q ss_pred             cCCCCccccCCCCCCccccccCCCc---------------cccccchhh-----HhhhcccChHHHHHHHHHHhccCCCc
Q psy12936         11 NSKYGWFWSCPNGPTCIYKHALPPG---------------FVLKKDKKK-----EEKKDQISLEDLIERERAALAASSKF   70 (187)
Q Consensus        11 ~~kYGwfW~CPnG~~C~YrH~LPpG---------------~Vlk~~~k~-----ee~~~eisLEE~iE~ER~kL~~~~~g   70 (187)
                      .|+.+|||.||+   |.|.....|.               .--++...+     ......-+++++....+..+...   
T Consensus       651 ~g~~~~~~~Cp~---C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kt~~Kl~~~~i~t~~~l~~a~~~~~a~~---  724 (740)
T PRK07220        651 GGKRPWDLGCPQ---CNFIEWQKKQKEEKAQQPKKEKPKSIKDIKGIGKKTAEKLEEAGITTVEALAEADPVELSKT---  724 (740)
T ss_pred             cCCccceeeCCC---CCCccccCCcccccccccccccchhhhcccccchhhhhhhhhcCccchhhhccCCHHHhhhh---


Q ss_pred             ccccHHHHHHHHHH
Q psy12936         71 TKVTLDSFLAWKKR   84 (187)
Q Consensus        71 TpVT~EsFl~WKkk   84 (187)
                      |-|....-..|++.
T Consensus       725 ~~is~~~~~~~~~~  738 (740)
T PRK07220        725 TKISVKKIKSWQES  738 (740)
T ss_pred             cCCchhhhhhhhhh


No 29 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=37.08  E-value=41  Score=31.52  Aligned_cols=58  Identities=28%  Similarity=0.461  Sum_probs=42.9

Q ss_pred             HHHHcCCCCccccCCCCCCccccccCCCccccccchhhHhhhcccChHHHHHHHHHHhccCC-Cccccc
Q psy12936          7 EAVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASS-KFTKVT   74 (187)
Q Consensus         7 ~Ave~~kYGwfW~CPnG~~C~YrH~LPpG~Vlk~~~k~ee~~~eisLEE~iE~ER~kL~~~~-~gTpVT   74 (187)
                      ++|++...---.+|||   |.-|..|=.|++---++++|       +|-+++.+|.+.++.- .-||.|
T Consensus       300 eci~~al~dsDf~Cpn---C~rkdvlld~l~pD~dk~~E-------vE~~lkkq~~~~gts~d~n~p~s  358 (427)
T COG5222         300 ECIGTALLDSDFKCPN---CSRKDVLLDGLTPDIDKKLE-------VEKALKKQRKKVGTSDDNNTPMS  358 (427)
T ss_pred             HHHhhhhhhccccCCC---cccccchhhccCccHHHHHH-------HHHHHHHHHHhcCCCCCCCCchh
Confidence            6777777777889998   88888888888876666544       6677888998887431 146655


No 30 
>PRK07219 DNA topoisomerase I; Validated
Probab=35.94  E-value=17  Score=36.72  Aligned_cols=24  Identities=29%  Similarity=0.638  Sum_probs=19.8

Q ss_pred             cCCCC-ccccCCCCCCccccccCCC
Q psy12936         11 NSKYG-WFWSCPNGPTCIYKHALPP   34 (187)
Q Consensus        11 ~~kYG-wfW~CPnG~~C~YrH~LPp   34 (187)
                      +++.| +||.|.|...|.|...||.
T Consensus       616 ~~~~g~~F~gCs~yp~C~~t~~lp~  640 (822)
T PRK07219        616 RTDKGSRFVGCSGYPDCRNTFPLPS  640 (822)
T ss_pred             eccCCceeeecCCCcCCCCeeecCC
Confidence            34556 9999999788999988885


No 31 
>PF02662 FlpD:  Methyl-viologen-reducing hydrogenase, delta subunit;  InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) []. No specific functions have been assigned to the delta subunit.; GO: 0015948 methanogenesis, 0055114 oxidation-reduction process
Probab=34.40  E-value=31  Score=26.97  Aligned_cols=28  Identities=25%  Similarity=0.657  Sum_probs=21.6

Q ss_pred             hhHHHHHHcCCCCccc-cCCCCCCcccccc
Q psy12936          3 KYFIEAVENSKYGWFW-SCPNGPTCIYKHA   31 (187)
Q Consensus         3 k~fl~Ave~~kYGwfW-~CPnG~~C~YrH~   31 (187)
                      .|.|.|+++|-=|=+= -||.| +|+|++.
T Consensus        43 ~~il~Af~~GADGV~V~gC~~g-~Ch~~~G   71 (124)
T PF02662_consen   43 EFILRAFEKGADGVLVAGCHPG-DCHYREG   71 (124)
T ss_pred             HHHHHHHHcCCCEEEEeCCCCC-CCCcchh
Confidence            4789999999877544 79984 5999854


No 32 
>PF05416 Peptidase_C37:  Southampton virus-type processing peptidase;  InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C37, (clan PA(C)). The type example is calicivirin from Southampton virus, an endopeptidase that cleaves the polyprotein at sites N-terminal to itself, liberating the polyprotein helicase. Southampton virus is a positive-stranded ssRNA virus belonging to the Caliciviruses, which are viruses that cause gastroenteritis. The calicivirus genome contains two open reading frames, ORF1 and ORF2. ORF1 encodes a non-structural polypeptide, which has RNA helicase, cysteine protease and RNA polymerase activity []. The regions of the polyprotein in which these activities lie are similar to proteins produced by the picornaviruses []. ORF2 encodes a structural, capsid protein. Two different families of caliciviruses can be distinguished on the basis of sequence similarity, namely the Norwalk-like viruses or small round structured viruses (SRSVs), and those classed as non-SRSVs.; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 2FYQ_A 2FYR_A 1WQS_D 4ASH_A 2IPH_B.
Probab=34.03  E-value=13  Score=36.07  Aligned_cols=20  Identities=45%  Similarity=1.197  Sum_probs=13.1

Q ss_pred             Cc-cccCCCCCCccccccCCCc
Q psy12936         15 GW-FWSCPNGPTCIYKHALPPG   35 (187)
Q Consensus        15 Gw-fW~CPnG~~C~YrH~LPpG   35 (187)
                      || |||-|+ -----.|.+|+|
T Consensus       381 GWGfWVS~~-lfITttHViP~g  401 (535)
T PF05416_consen  381 GWGFWVSPT-LFITTTHVIPPG  401 (535)
T ss_dssp             EEEEESSSS-EEEEEGGGS-ST
T ss_pred             ceeeeecce-EEEEeeeecCCc
Confidence            56 899998 111246999988


No 33 
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only]
Probab=33.75  E-value=17  Score=32.89  Aligned_cols=18  Identities=44%  Similarity=1.091  Sum_probs=11.5

Q ss_pred             CCCCCCccccccCCCccc
Q psy12936         20 CPNGPTCIYKHALPPGFV   37 (187)
Q Consensus        20 CPnG~~C~YrH~LPpG~V   37 (187)
                      |-+|..|-|.|-+|-++.
T Consensus       146 cs~g~~c~~~h~dp~~~~  163 (285)
T COG5084         146 CSSGPSCGYSHIDPDSFA  163 (285)
T ss_pred             eccCCCCCccccCccccc
Confidence            666777777777764443


No 34 
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=31.98  E-value=15  Score=32.37  Aligned_cols=22  Identities=36%  Similarity=0.922  Sum_probs=16.9

Q ss_pred             CchhHHHHHHcCCCCccccCCC----C-----CCccccccC
Q psy12936          1 ICKYFIEAVENSKYGWFWSCPN----G-----PTCIYKHAL   32 (187)
Q Consensus         1 vCk~fl~Ave~~kYGwfW~CPn----G-----~~C~YrH~L   32 (187)
                      ||||||=.+          ||+    +     ..|...|..
T Consensus        32 VCk~~L~g~----------CPhdLF~nTK~DLG~C~kiHd~   62 (254)
T PF03194_consen   32 VCKYFLVGF----------CPHDLFVNTKSDLGPCPKIHDE   62 (254)
T ss_pred             cCHHHHhCC----------CcHHHHhhcccccchhhhhcCH
Confidence            899999775          897    2     378888853


No 35 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=31.15  E-value=19  Score=33.13  Aligned_cols=9  Identities=33%  Similarity=1.040  Sum_probs=7.8

Q ss_pred             CCccccCCC
Q psy12936         14 YGWFWSCPN   22 (187)
Q Consensus        14 YGwfW~CPn   22 (187)
                      .-|+|.||+
T Consensus        11 ~~~~g~cp~   19 (372)
T cd01121          11 PKWLGKCPE   19 (372)
T ss_pred             CCccEECcC
Confidence            459999998


No 36 
>KOG4312|consensus
Probab=30.62  E-value=26  Score=33.23  Aligned_cols=17  Identities=29%  Similarity=0.712  Sum_probs=14.8

Q ss_pred             cCCCCCCccccccCCCc
Q psy12936         19 SCPNGPTCIYKHALPPG   35 (187)
Q Consensus        19 ~CPnG~~C~YrH~LPpG   35 (187)
                      -||.-..|+|||++--|
T Consensus       368 ~CP~~~~C~h~H~~~~g  384 (449)
T KOG4312|consen  368 ACPVRLSCKHRHSNKTG  384 (449)
T ss_pred             cCCCCcccccccCCccc
Confidence            49988999999998855


No 37 
>PF07141 Phage_term_sma:  Putative bacteriophage terminase small subunit;  InterPro: IPR010789 This entry is represented by Bacteriophage 712, Gp1; it is a family of uncharacterised viral proteins. This family consists of several putative Lactococcus bacteriophage terminase small subunit proteins. The exact function of this family is unknown.
Probab=30.37  E-value=57  Score=27.24  Aligned_cols=47  Identities=15%  Similarity=0.339  Sum_probs=26.5

Q ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHHHhhhhh----hhhccccCcccccccccC
Q psy12936         71 TKVTLDSFLAWKKRKLKEKSEAMTKAEEKKRSD----FKAGRQVGLSGRDMFSFN  121 (187)
Q Consensus        71 TpVT~EsFl~WKkkk~~Ek~~~~~~~~e~kk~~----~kaGk~~~LSGRELFe~d  121 (187)
                      -.++.-||.+||..+++.-....    ..+...    ..+.-..+|+||-|=+..
T Consensus        41 L~isrKtFyeWrdtk~eA~eeA~----~~rdd~LlmLArssLk~KLegyTLtET~   91 (174)
T PF07141_consen   41 LHISRKTFYEWRDTKIEAYEEAK----GIRDDNLLMLARSSLKSKLEGYTLTETE   91 (174)
T ss_pred             HhccHHHHHHHHhhhHHHHHHHH----hhccchHHHHHHHHHHhhcceeeeccce
Confidence            45778999999998853322211    111000    011112579999988776


No 38 
>KOG0378|consensus
Probab=30.16  E-value=24  Score=31.74  Aligned_cols=34  Identities=21%  Similarity=0.216  Sum_probs=28.1

Q ss_pred             cCCCCccccCCCCCCccccccCCCccccccchhh
Q psy12936         11 NSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKK   44 (187)
Q Consensus        11 ~~kYGwfW~CPnG~~C~YrH~LPpG~Vlk~~~k~   44 (187)
                      .++=|=||.+|+-.-=+||-|||-+|+|...-|.
T Consensus        21 dk~~G~fa~~ps~gphk~reclpl~~~~~~~Lky   54 (263)
T KOG0378|consen   21 DKLGGVFAPMPSSGPHKLRECLPLIVFLRNRLKY   54 (263)
T ss_pred             cccCcEEecCCCCCCcccccceeEEEEeehhhhh
Confidence            4667899999994467899999999999876665


No 39 
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated
Probab=29.76  E-value=29  Score=35.45  Aligned_cols=26  Identities=27%  Similarity=0.533  Sum_probs=21.4

Q ss_pred             HHcCCCCccccCCCCCCccccccCCC
Q psy12936          9 VENSKYGWFWSCPNGPTCIYKHALPP   34 (187)
Q Consensus         9 ve~~kYGwfW~CPnG~~C~YrH~LPp   34 (187)
                      +..++||-||.|.|...|.|.-.|++
T Consensus       605 ~k~gr~G~Fl~Cs~yP~C~~t~~~~~  630 (860)
T PRK06319        605 KIWAKNRYFYGCSEYPECDYKTSEEE  630 (860)
T ss_pred             EEecCCCceeeccCCccccccCCccc
Confidence            34689999999999889998776663


No 40 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=29.72  E-value=20  Score=33.82  Aligned_cols=9  Identities=33%  Similarity=0.826  Sum_probs=7.9

Q ss_pred             CCccccCCC
Q psy12936         14 YGWFWSCPN   22 (187)
Q Consensus        14 YGwfW~CPn   22 (187)
                      .-|+|.||+
T Consensus        18 ~~~~g~Cp~   26 (454)
T TIGR00416        18 PKWQGKCPA   26 (454)
T ss_pred             ccccEECcC
Confidence            459999998


No 41 
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=28.92  E-value=30  Score=28.91  Aligned_cols=26  Identities=27%  Similarity=0.662  Sum_probs=20.1

Q ss_pred             cccCCCCCCcccccc--CCCccccccchh
Q psy12936         17 FWSCPNGPTCIYKHA--LPPGFVLKKDKK   43 (187)
Q Consensus        17 fW~CPnG~~C~YrH~--LPpG~Vlk~~~k   43 (187)
                      +-.||| .+|+-.+.  .++.|++.++..
T Consensus       106 vlkCpN-~nCITn~e~pv~s~F~~~~~~~  133 (153)
T COG1781         106 VLRCPN-PNCITNAEEPVESKFYVVSKEP  133 (153)
T ss_pred             EEEcCC-CCcccCCCccCCccEEEEecCC
Confidence            367999 99996655  778898887554


No 42 
>KOG1677|consensus
Probab=28.14  E-value=29  Score=30.53  Aligned_cols=15  Identities=33%  Similarity=0.835  Sum_probs=13.9

Q ss_pred             cCCCCCCccccccCC
Q psy12936         19 SCPNGPTCIYKHALP   33 (187)
Q Consensus        19 ~CPnG~~C~YrH~LP   33 (187)
                      .||.|..|+|.|-.+
T Consensus       188 ~C~yG~rC~F~H~~~  202 (332)
T KOG1677|consen  188 LCKYGSRCRFIHGEP  202 (332)
T ss_pred             CCCCCCcCeecCCCc
Confidence            599999999999987


No 43 
>PF14753 DUF4475:  Domain of unknown function (DUF4475)
Probab=27.88  E-value=24  Score=30.47  Aligned_cols=22  Identities=27%  Similarity=0.502  Sum_probs=18.1

Q ss_pred             HHHHHcCCCCccccCCCCCCccc
Q psy12936          6 IEAVENSKYGWFWSCPNGPTCIY   28 (187)
Q Consensus         6 l~Ave~~kYGwfW~CPnG~~C~Y   28 (187)
                      ..||.|+.|-+ |.||+|-+|+-
T Consensus        28 p~~~knrlyv~-Wr~~~~~DC~~   49 (196)
T PF14753_consen   28 PLRIKNRLYVS-WRNPTGMDCKR   49 (196)
T ss_pred             HhhhcCceEEE-EeCCCCcceeE
Confidence            34899999997 99999877763


No 44 
>PRK11823 DNA repair protein RadA; Provisional
Probab=27.76  E-value=23  Score=33.22  Aligned_cols=9  Identities=33%  Similarity=1.028  Sum_probs=7.9

Q ss_pred             CCccccCCC
Q psy12936         14 YGWFWSCPN   22 (187)
Q Consensus        14 YGwfW~CPn   22 (187)
                      .-|+|.||+
T Consensus        18 ~~~~g~Cp~   26 (446)
T PRK11823         18 PKWLGRCPE   26 (446)
T ss_pred             cccCeeCcC
Confidence            459999999


No 45 
>KOG4791|consensus
Probab=27.18  E-value=22  Score=35.10  Aligned_cols=8  Identities=38%  Similarity=1.086  Sum_probs=6.7

Q ss_pred             CCcccccc
Q psy12936         24 PTCIYKHA   31 (187)
Q Consensus        24 ~~C~YrH~   31 (187)
                      +.|.|||.
T Consensus        46 k~C~YRHS   53 (667)
T KOG4791|consen   46 KVCRYRHS   53 (667)
T ss_pred             ccccchhh
Confidence            68999996


No 46 
>PF07936 Defensin_4:  Potassium-channel blocking toxin;  InterPro: IPR012414 This family features the antihypertensive and antiviral proteins BDS-I (P11494 from SWISSPROT) and BDS-II (P59084 from SWISSPROT) expressed by Anemonia sulcata. BDS-I is organised into a triple-stranded antiparallel beta-sheet, with an additional small antiparallel beta-sheet at the N terminus []. Both peptides are known to specifically block the Kv3.4 potassium channel, and thus bring about a decrease in blood pressure []. Moreover, they inhibit the cytopathic effects of mouse hepatitis virus strain MHV-A59 on mouse liver cells, by an unknown mechanism []. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0042151 nematocyst; PDB: 2BDS_A 1BDS_A 1WXN_A 1WQK_A.
Probab=27.12  E-value=16  Score=23.41  Aligned_cols=13  Identities=62%  Similarity=1.551  Sum_probs=7.5

Q ss_pred             ccc--cCCCC----CCccc
Q psy12936         16 WFW--SCPNG----PTCIY   28 (187)
Q Consensus        16 wfW--~CPnG----~~C~Y   28 (187)
                      |||  .||+|    ..|-|
T Consensus        13 W~~~~~CP~g~GYTg~C~y   31 (34)
T PF07936_consen   13 WFARGSCPGGYGYTGSCGY   31 (34)
T ss_dssp             EESTSS--TTST--EEEEE
T ss_pred             EEEecCCCCCCccccEeee
Confidence            888  79995    36655


No 47 
>PRK06599 DNA topoisomerase I; Validated
Probab=26.46  E-value=40  Score=33.39  Aligned_cols=25  Identities=28%  Similarity=0.609  Sum_probs=20.6

Q ss_pred             HcCCCCccccCCCCCCccccccCCC
Q psy12936         10 ENSKYGWFWSCPNGPTCIYKHALPP   34 (187)
Q Consensus        10 e~~kYGwfW~CPnG~~C~YrH~LPp   34 (187)
                      .+++||=||.|.|-+.|.+...+|.
T Consensus       599 k~~k~g~F~~Cs~~p~C~~~~~~~~  623 (675)
T PRK06599        599 KLGKNGKFLGCSGYPECKYTKNITR  623 (675)
T ss_pred             EecCCCceeeCCCCCccCCCCCCcc
Confidence            3578999999998788998887773


No 48 
>PF10587 EF-1_beta_acid:  Eukaryotic elongation factor 1 beta central acidic region;  InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF1B (also known as EF-Ts or EF-1beta/gamma/delta) is a nucleotide exchange factor that is required to regenerate EF1A from its inactive form (EF1A-GDP) to its active form (EF1A-GTP). EF1A is then ready to interact with a new aminoacyl-tRNA to begin the cycle again. EF1B is more complex in eukaryotes than in bacteria, and can consist of three subunits: EF1B-alpha (or EF-1beta), EF1B-gamma (or EF-1gamma) and EF1B-beta (or EF-1delta) []. This region is found in the centre of the beta subunits of Elongation factor-1. More information about these proteins can be found at Protein of the Month: Elongation Factors [].
Probab=25.48  E-value=30  Score=21.31  Aligned_cols=7  Identities=29%  Similarity=0.264  Sum_probs=4.5

Q ss_pred             CccCCCC
Q psy12936        124 LAKDDMD  130 (187)
Q Consensus       124 L~~DD~d  130 (187)
                      ||++|++
T Consensus         1 LFGSddE    7 (28)
T PF10587_consen    1 LFGSDDE    7 (28)
T ss_pred             CCCCccc
Confidence            6787544


No 49 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=25.40  E-value=33  Score=23.39  Aligned_cols=21  Identities=33%  Similarity=0.822  Sum_probs=14.5

Q ss_pred             ccCCCCCCcccc--ccCCCccccc
Q psy12936         18 WSCPNGPTCIYK--HALPPGFVLK   39 (187)
Q Consensus        18 W~CPnG~~C~Yr--H~LPpG~Vlk   39 (187)
                      -.||| .+|+-.  ..+++-|.+.
T Consensus         7 l~C~N-p~CITn~~E~v~~~F~v~   29 (52)
T PF02748_consen    7 LKCPN-PNCITNSNEPVESRFYVI   29 (52)
T ss_dssp             SE-SS-TTBTTT-TSSS--EEEEE
T ss_pred             EEcCC-CCcccCCCCCCCceEEEE
Confidence            47999 999987  7788899773


No 50 
>PRK11548 outer membrane biogenesis protein BamE; Provisional
Probab=23.75  E-value=64  Score=24.67  Aligned_cols=49  Identities=16%  Similarity=0.286  Sum_probs=29.6

Q ss_pred             CCCCCCccccccCCCccccccchhhHhhhcccChHHHHHHHHHHhccCCCcccccHHHH
Q psy12936         20 CPNGPTCIYKHALPPGFVLKKDKKKEEKKDQISLEDLIERERAALAASSKFTKVTLDSF   78 (187)
Q Consensus        20 CPnG~~C~YrH~LPpG~Vlk~~~k~ee~~~eisLEE~iE~ER~kL~~~~~gTpVT~EsF   78 (187)
                      |-..+.+.|++..|.|+++..+.-..-+.- .|-++..    ..|     |||.+.+.|
T Consensus        20 Cs~~~~~~y~~~v~qG~~~~~~~l~~l~~G-mTk~qV~----~lL-----GtP~~~~~f   68 (113)
T PRK11548         20 CSTLERVVYRPDINQGNYLTPNDVAKIHVG-MTQQQVA----YTL-----GTPMMQDPF   68 (113)
T ss_pred             cCCCCcccccccCCccccCCHHHHHHhcCC-CCHHHHH----HHc-----CCCccccCC
Confidence            544456779999999999975443222222 3544443    333     588777665


No 51 
>PRK14973 DNA topoisomerase I; Provisional
Probab=23.42  E-value=32  Score=35.70  Aligned_cols=71  Identities=17%  Similarity=0.248  Sum_probs=35.2

Q ss_pred             HHHcCCCCccccCCCCCCccccccCCCccccccchhh--Hh---hhcccChHHHHHHHHHHhccCCCcccccHHHHHHHH
Q psy12936          8 AVENSKYGWFWSCPNGPTCIYKHALPPGFVLKKDKKK--EE---KKDQISLEDLIERERAALAASSKFTKVTLDSFLAWK   82 (187)
Q Consensus         8 Ave~~kYGwfW~CPnG~~C~YrH~LPpG~Vlk~~~k~--ee---~~~eisLEE~iE~ER~kL~~~~~gTpVT~EsFl~WK   82 (187)
                      .+.+|.||||.-|   +.|+|.-..-+..-......+  .+   ..---++.++...+...+...   +-|...+=-.|+
T Consensus       648 ~~r~Gr~g~fl~C---P~C~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~  721 (936)
T PRK14973        648 LIRKGARPWDIGC---PLCSHIESNTESLLLMPSMTEELLQKLNAVHIYTVSELASREPEALAKS---LGLSKKEAEKLI  721 (936)
T ss_pred             EeecCCCcccccC---ccccchhhcccchhhccccchhhhhhhhhccCCchhhhccCCHhHhhhh---cCcchHHHHHHH
Confidence            3478899999999   468775442221111111111  01   111224445544444444433   226666666777


Q ss_pred             HH
Q psy12936         83 KR   84 (187)
Q Consensus        83 kk   84 (187)
                      +.
T Consensus       722 ~~  723 (936)
T PRK14973        722 RE  723 (936)
T ss_pred             HH
Confidence            65


No 52 
>PF10050 DUF2284:  Predicted metal-binding protein (DUF2284);  InterPro: IPR019271  This entry represents a family of predicted metal-binding bacterial and archaeal proteins with no known function. 
Probab=22.93  E-value=23  Score=28.77  Aligned_cols=11  Identities=55%  Similarity=1.319  Sum_probs=9.6

Q ss_pred             CCCCccccCCC
Q psy12936         12 SKYGWFWSCPN   22 (187)
Q Consensus        12 ~kYGwfW~CPn   22 (187)
                      +.||=.|.||.
T Consensus        25 ~~Yg~~~~CPP   35 (166)
T PF10050_consen   25 PNYGKNWSCPP   35 (166)
T ss_pred             hhcCCCCCCcc
Confidence            67999999997


No 53 
>PF00111 Fer2:  2Fe-2S iron-sulfur cluster binding domain;  InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions. Ferredoxins can be divided into several subgroups depending upon the physiological nature of the iron-sulphur cluster(s) and according to sequence similarities.  This entry represents members of the 2Fe-2S ferredoxin family that have a general core structure consisting of beta(2)-alpha-beta(2), which includes putidaredoxin and terpredoxin, and adrenodoxin [, , , ]. They are proteins of around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This conserved region is also found as a domain in various metabolic enzymes and in multidomain proteins, such as aldehyde oxidoreductase (N-terminal), xanthine oxidase (N-terminal), phthalate dioxygenase reductase (C-terminal), succinate dehydrogenase iron-sulphur protein (N-terminal), and methane monooxygenase reductase (N-terminal).; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3 1JQ4_A 1DOX_A 1DOY_A 2KAJ_A ....
Probab=22.47  E-value=74  Score=21.69  Aligned_cols=32  Identities=28%  Similarity=0.476  Sum_probs=22.5

Q ss_pred             HHHHHHcC-CCCccccCCCCCCcccccc-CCCccc
Q psy12936          5 FIEAVENS-KYGWFWSCPNGPTCIYKHA-LPPGFV   37 (187)
Q Consensus         5 fl~Ave~~-kYGwfW~CPnG~~C~YrH~-LPpG~V   37 (187)
                      .|+|++.. .+++.+.|-+|- |--=|+ +-.|-|
T Consensus        19 ll~~~~~~~gi~i~~~C~~g~-Cg~C~v~v~~G~~   52 (78)
T PF00111_consen   19 LLDALERAGGIGIPYSCGGGG-CGTCRVRVLEGEV   52 (78)
T ss_dssp             HHHHHHHTTTTTSTTSSSSSS-SSTTEEEEEESEE
T ss_pred             HHHHHHHcCCCCcccCCCCCc-cCCcEEEEeeCcc
Confidence            68999987 999999999975 543332 234444


No 54 
>PRK07561 DNA topoisomerase I subunit omega; Validated
Probab=20.68  E-value=47  Score=33.97  Aligned_cols=24  Identities=8%  Similarity=0.193  Sum_probs=17.7

Q ss_pred             HcCCCCccccCC-CCCCccccccCC
Q psy12936         10 ENSKYGWFWSCP-NGPTCIYKHALP   33 (187)
Q Consensus        10 e~~kYGwfW~CP-nG~~C~YrH~LP   33 (187)
                      .+|+||-||.|. +...|.|...+.
T Consensus       716 k~gr~G~yl~c~~~~~sc~~~~~~~  740 (859)
T PRK07561        716 KIGRFGPYVKCGGTYASLKNTRKVL  740 (859)
T ss_pred             ecCCCCCeEEeCCCcCCCCCCCccc
Confidence            589999999994 457887754433


No 55 
>PRK14973 DNA topoisomerase I; Provisional
Probab=20.08  E-value=52  Score=34.26  Aligned_cols=24  Identities=25%  Similarity=0.605  Sum_probs=19.6

Q ss_pred             HcCCCCccccCCCCCCccccccCC
Q psy12936         10 ENSKYGWFWSCPNGPTCIYKHALP   33 (187)
Q Consensus        10 e~~kYGwfW~CPnG~~C~YrH~LP   33 (187)
                      .++++|-||.|.|-..|.|...||
T Consensus       601 k~~k~gkFigCS~Yp~Ck~t~~L~  624 (936)
T PRK14973        601 KHIGSSQFIGCSGYPDCTFNIGLP  624 (936)
T ss_pred             ecccCceeEECCCCCCCCccccCC
Confidence            346889999999878899887765


Done!