Query         psy12937
Match_columns 111
No_of_seqs    111 out of 163
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:33:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12937.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12937hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1763|consensus              100.0   3E-48 6.5E-53  320.4   4.2   90   10-111    92-189 (343)
  2 COG5252 Uncharacterized conser 100.0 6.3E-33 1.4E-37  225.7   4.1   76   16-111    97-174 (299)
  3 KOG1040|consensus               91.3    0.13 2.7E-06   43.4   1.9   38    7-44     74-119 (325)
  4 PF14608 zf-CCCH_2:  Zinc finge  90.0    0.16 3.4E-06   26.4   0.9   12  100-111     7-19  (19)
  5 PF00642 zf-CCCH:  Zinc finger   89.1    0.15 3.2E-06   28.1   0.4   12   16-27     16-27  (27)
  6 smart00356 ZnF_C3H1 zinc finge  86.8    0.35 7.5E-06   25.3   1.0   12   16-27     16-27  (27)
  7 PF01396 zf-C4_Topoisom:  Topoi  80.2     1.2 2.5E-05   26.6   1.5   20   90-109    13-33  (39)
  8 COG5175 MOT2 Transcriptional r  79.7    0.73 1.6E-05   40.6   0.6   24   78-110   200-223 (480)
  9 KOG1677|consensus               78.8    0.53 1.2E-05   37.5  -0.5   22   80-110   177-199 (332)
 10 PF02662 FlpD:  Methyl-viologen  58.2     8.8 0.00019   27.6   2.2   27   84-110    43-70  (124)
 11 PF13295 DUF4077:  Domain of un  53.6     6.1 0.00013   30.7   0.8   23   80-102    25-55  (175)
 12 KOG2494|consensus               43.2      14 0.00031   31.8   1.5   25   76-110    33-59  (331)
 13 PF14753 DUF4475:  Domain of un  37.2      15 0.00033   29.4   0.7   20   87-107    28-48  (196)
 14 KOG2295|consensus               37.0      29 0.00064   32.3   2.6   42   60-106   476-517 (648)
 15 COG1592 Rubrerythrin [Energy p  34.9      32 0.00069   26.7   2.2   21   85-110   124-144 (166)
 16 PF06839 zf-GRF:  GRF zinc fing  33.7      26 0.00056   20.9   1.2   17   92-108    19-38  (45)
 17 PF07936 Defensin_4:  Potassium  33.1      15 0.00032   22.3   0.0    8   97-104    13-22  (34)
 18 PF04054 Not1:  CCR4-Not comple  32.6      25 0.00055   30.0   1.4   41   59-103   322-362 (379)
 19 COG5152 Uncharacterized conser  30.5      18 0.00038   30.1   0.1   12   17-28    155-166 (259)
 20 KOG2068|consensus               30.4      43 0.00093   28.8   2.4   44   51-110   140-183 (327)
 21 PRK14973 DNA topoisomerase I;   30.0      19 0.00042   34.2   0.3   20   87-108   646-665 (936)
 22 PRK07220 DNA topoisomerase I;   29.8      27 0.00058   32.1   1.2   14   93-108   652-665 (740)
 23 PF00706 Toxin_4:  Anenome neur  28.9      18  0.0004   22.9  -0.0   11   97-107    21-33  (43)
 24 PRK11788 tetratricopeptide rep  27.3      26 0.00056   27.1   0.5    7   97-103   367-373 (389)
 25 PF09929 DUF2161:  Uncharacteri  26.1      29 0.00062   25.9   0.6    9   90-98     92-100 (118)
 26 KOG1155|consensus               26.1      52  0.0011   30.2   2.3   34   59-101   167-200 (559)
 27 COG0551 TopA Zn-finger domain   24.8      43 0.00093   23.9   1.3   17   92-108    31-48  (140)
 28 PF14194 Cys_rich_VLP:  Cystein  24.7      46 0.00099   22.1   1.3   11   80-90     42-52  (56)
 29 PF02891 zf-MIZ:  MIZ/SP-RING z  23.7      50  0.0011   20.4   1.3   15   86-103    32-46  (50)
 30 PF13413 HTH_25:  Helix-turn-he  23.6      58  0.0013   20.8   1.6   15   82-96     22-36  (62)
 31 KOG1813|consensus               23.5      28 0.00061   29.9   0.1   13   16-28    199-211 (313)
 32 PF08806 Sep15_SelM:  Sep15/Sel  22.8      43 0.00092   22.7   0.9   18   51-68     58-75  (78)
 33 KOG2333|consensus               21.7      38 0.00082   31.4   0.6   17   11-29     88-104 (614)
 34 KOG1544|consensus               20.2      54  0.0012   29.2   1.2   16   82-97    148-163 (470)

No 1  
>KOG1763|consensus
Probab=100.00  E-value=3e-48  Score=320.42  Aligned_cols=90  Identities=63%  Similarity=1.272  Sum_probs=85.3

Q ss_pred             ceeeee------ccCCccccCCCchhHHHhhhhhhhhcccccCcccchhhhhccHHHHHHHHHhhhcccccCCCcchhhh
Q psy12937         10 YLPCLF------QSGAKCKFSHDLTIERKAEKRSLYVDMRDDGEDVNETMENWDEDKLKEVVEKKHGEAEKKRPTTTIIC   83 (111)
Q Consensus        10 ~~~C~f------~KG~KCKFSHDl~~~rk~eK~dlY~D~Rd~~~e~~dtmd~WDe~kLe~VV~~Khg~~~k~~~~TdiVC   83 (111)
                      .++|+|      +||++|||||||+++|+.+|+|||.|+|++       |  ||+++|++||++|||+   ++++|+|||
T Consensus        92 SvvCafFk~g~C~KG~kCKFsHdl~~~~k~eK~dly~d~rde-------m--WD~~kl~~vv~~K~~k---~k~~tdiVC  159 (343)
T KOG1763|consen   92 SVVCAFFKQGTCTKGDKCKFSHDLAVERKKEKIDLYPDTRDE-------M--WDEEKLEEVVLKKHGK---PKPTTDIVC  159 (343)
T ss_pred             HHHHHHHhccCCCCCCcccccchHHHhhhccchhccccchhh-------h--hhHHHHHHHHHhhccC---CCCchhHHH
Confidence            478988      689999999999999999999999999975       5  9999999999999994   789999999


Q ss_pred             HHHHHHHHccccccceecCCC-C-cccccC
Q psy12937         84 KYFIEAVENSKYGWFWSCPNG-P-CTFENG  111 (111)
Q Consensus        84 K~FLeAvE~~kYGWFW~CPNG-d-C~YRHa  111 (111)
                      ||||||||+|+|||||+|||| + |+||||
T Consensus       160 KfFLeAvE~~kYGWfW~CPnGg~~C~YrHa  189 (343)
T KOG1763|consen  160 KFFLEAVENGKYGWFWECPNGGDKCIYRHA  189 (343)
T ss_pred             HHHHHHHhcCCccceeECCCCCCeeeeeec
Confidence            999999999999999999999 6 999997


No 2  
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only]
Probab=99.97  E-value=6.3e-33  Score=225.67  Aligned_cols=76  Identities=43%  Similarity=0.911  Sum_probs=69.7

Q ss_pred             ccCCccccCCCchhHHHhhhhhhhhcccccCcccchhhhhccHHHHHHHHHhhhcccccCCCcchhhhHHHHHHHHcccc
Q psy12937         16 QSGAKCKFSHDLTIERKAEKRSLYVDMRDDGEDVNETMENWDEDKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKY   95 (111)
Q Consensus        16 ~KG~KCKFSHDl~~~rk~eK~dlY~D~Rd~~~e~~dtmd~WDe~kLe~VV~~Khg~~~k~~~~TdiVCK~FLeAvE~~kY   95 (111)
                      .||+.|||+|+++..|+.||+|||.|.|++++  +++|+                +  .+.++||+||||||||+|+|+|
T Consensus        97 ~kg~~ckF~h~~ee~r~~eK~DLYsDvRd~~e--d~pl~----------------k--rP~intd~VCkffieA~e~GkY  156 (299)
T COG5252          97 AKGDACKFAHGKEEARKTEKPDLYSDVRDKEE--DVPLG----------------K--RPWINTDRVCKFFIEAMESGKY  156 (299)
T ss_pred             ccCchhhhhcchHHHhhhcccchhhhhhhhhc--cCCcc----------------c--CCCCChhHHHHHHHHHHhcCCc
Confidence            59999999999999999999999999999876  47776                1  1678999999999999999999


Q ss_pred             ccceecCCC-C-cccccC
Q psy12937         96 GWFWSCPNG-P-CTFENG  111 (111)
Q Consensus        96 GWFW~CPNG-d-C~YRHa  111 (111)
                      ||||.|||| + |+|+|+
T Consensus       157 gw~W~CPng~~~C~y~H~  174 (299)
T COG5252         157 GWGWTCPNGNMRCSYIHK  174 (299)
T ss_pred             cceeeCCCCCceeeeeec
Confidence            999999999 6 999996


No 3  
>KOG1040|consensus
Probab=91.28  E-value=0.13  Score=43.41  Aligned_cols=38  Identities=24%  Similarity=0.553  Sum_probs=29.2

Q ss_pred             CCCceeeee------ccCCccccCCCchhH--HHhhhhhhhhcccc
Q psy12937          7 YSGYLPCLF------QSGAKCKFSHDLTIE--RKAEKRSLYVDMRD   44 (111)
Q Consensus         7 ~~~~~~C~f------~KG~KCKFSHDl~~~--rk~eK~dlY~D~Rd   44 (111)
                      -++-++|-+      .||+.|-|+|+.++-  |.+-.-++|.+-..
T Consensus        74 ~~~~~vcK~~l~glC~kgD~C~Flhe~~~~k~rec~ff~~~g~c~~  119 (325)
T KOG1040|consen   74 SRGKVVCKHWLRGLCKKGDQCEFLHEYDLTKMRECKFFSLFGECTN  119 (325)
T ss_pred             cCCceeehhhhhhhhhccCcCcchhhhhhccccccccccccccccc
Confidence            456789987      799999999987765  45666777777665


No 4  
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=90.04  E-value=0.16  Score=26.43  Aligned_cols=12  Identities=42%  Similarity=1.126  Sum_probs=10.3

Q ss_pred             ecCCCC-cccccC
Q psy12937        100 SCPNGP-CTFENG  111 (111)
Q Consensus       100 ~CPNGd-C~YRHa  111 (111)
                      .|+||+ |.|.|.
T Consensus         7 ~C~~~~~C~f~HP   19 (19)
T PF14608_consen    7 NCTNGDNCPFSHP   19 (19)
T ss_pred             CCCCCCcCccCCc
Confidence            499995 999994


No 5  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=89.06  E-value=0.15  Score=28.08  Aligned_cols=12  Identities=42%  Similarity=0.891  Sum_probs=10.4

Q ss_pred             ccCCccccCCCc
Q psy12937         16 QSGAKCKFSHDL   27 (111)
Q Consensus        16 ~KG~KCKFSHDl   27 (111)
                      ..|++|+|+|+.
T Consensus        16 ~~G~~C~f~H~~   27 (27)
T PF00642_consen   16 PFGDKCRFAHGE   27 (27)
T ss_dssp             TTGGGSSSBSSG
T ss_pred             CCCCCcCccCCC
Confidence            579999999983


No 6  
>smart00356 ZnF_C3H1 zinc finger.
Probab=86.76  E-value=0.35  Score=25.26  Aligned_cols=12  Identities=50%  Similarity=1.082  Sum_probs=10.3

Q ss_pred             ccCCccccCCCc
Q psy12937         16 QSGAKCKFSHDL   27 (111)
Q Consensus        16 ~KG~KCKFSHDl   27 (111)
                      ..|..|.|+|++
T Consensus        16 ~~g~~C~~~H~~   27 (27)
T smart00356       16 PYGDRCKFAHPL   27 (27)
T ss_pred             CCCCCcCCCCcC
Confidence            579999999984


No 7  
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=80.21  E-value=1.2  Score=26.58  Aligned_cols=20  Identities=30%  Similarity=0.694  Sum_probs=16.5

Q ss_pred             HHccccccceecCCC-Ccccc
Q psy12937         90 VENSKYGWFWSCPNG-PCTFE  109 (111)
Q Consensus        90 vE~~kYGWFW~CPNG-dC~YR  109 (111)
                      +..+++|.||.|.|= +|.|.
T Consensus        13 ~r~~k~g~F~~Cs~yP~C~~~   33 (39)
T PF01396_consen   13 LRRGKKGKFLGCSNYPECKYT   33 (39)
T ss_pred             EEECCCCCEEECCCCCCcCCe
Confidence            346899999999996 59985


No 8  
>COG5175 MOT2 Transcriptional repressor [Transcription]
Probab=79.71  E-value=0.73  Score=40.63  Aligned_cols=24  Identities=29%  Similarity=0.683  Sum_probs=17.9

Q ss_pred             cchhhhHHHHHHHHccccccceecCCCCccccc
Q psy12937         78 TTTIICKYFIEAVENSKYGWFWSCPNGPCTFEN  110 (111)
Q Consensus        78 ~TdiVCK~FLeAvE~~kYGWFW~CPNGdC~YRH  110 (111)
                      -|..-|-.+|.-         =+|||++|||-|
T Consensus       200 GTTKYCtsYLRn---------~~CpNp~CMyLH  223 (480)
T COG5175         200 GTTKYCTSYLRN---------AVCPNPDCMYLH  223 (480)
T ss_pred             CchHHHHHHHcC---------CCCCCCCeeeec
Confidence            355667766642         489999999998


No 9  
>KOG1677|consensus
Probab=78.76  E-value=0.53  Score=37.46  Aligned_cols=22  Identities=36%  Similarity=0.859  Sum_probs=17.7

Q ss_pred             hhhhHHHHHHHHccccccceecCCCC-ccccc
Q psy12937         80 TIICKYFIEAVENSKYGWFWSCPNGP-CTFEN  110 (111)
Q Consensus        80 diVCK~FLeAvE~~kYGWFW~CPNGd-C~YRH  110 (111)
                      .+.|.+|..-      |   .||.|. |+|.|
T Consensus       177 t~lC~~f~~t------G---~C~yG~rC~F~H  199 (332)
T KOG1677|consen  177 TKLCPKFQKT------G---LCKYGSRCRFIH  199 (332)
T ss_pred             CcCCCccccC------C---CCCCCCcCeecC
Confidence            4679999764      3   799996 99998


No 10 
>PF02662 FlpD:  Methyl-viologen-reducing hydrogenase, delta subunit;  InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) []. No specific functions have been assigned to the delta subunit.; GO: 0015948 methanogenesis, 0055114 oxidation-reduction process
Probab=58.20  E-value=8.8  Score=27.59  Aligned_cols=27  Identities=22%  Similarity=0.623  Sum_probs=22.5

Q ss_pred             HHHHHHHHccccccc-eecCCCCccccc
Q psy12937         84 KYFIEAVENSKYGWF-WSCPNGPCTFEN  110 (111)
Q Consensus        84 K~FLeAvE~~kYGWF-W~CPNGdC~YRH  110 (111)
                      .+.|+|+++|-=|=+ .-||.|+|+|++
T Consensus        43 ~~il~Af~~GADGV~V~gC~~g~Ch~~~   70 (124)
T PF02662_consen   43 EFILRAFEKGADGVLVAGCHPGDCHYRE   70 (124)
T ss_pred             HHHHHHHHcCCCEEEEeCCCCCCCCcch
Confidence            578999999987744 479998999975


No 11 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=53.59  E-value=6.1  Score=30.71  Aligned_cols=23  Identities=35%  Similarity=1.084  Sum_probs=20.5

Q ss_pred             hhhhHHHHHHHHcccccc--------ceecC
Q psy12937         80 TIICKYFIEAVENSKYGW--------FWSCP  102 (111)
Q Consensus        80 diVCK~FLeAvE~~kYGW--------FW~CP  102 (111)
                      --+|.+||--|.-|-||.        ||+|.
T Consensus        25 iticsfflgiiaigyygyifteraiafwvcg   55 (175)
T PF13295_consen   25 ITICSFFLGIIAIGYYGYIFTERAIAFWVCG   55 (175)
T ss_pred             HHHHHHHHHHHHHhhhheeehhHHHHHHhhc
Confidence            358999999999999998        89995


No 12 
>KOG2494|consensus
Probab=43.19  E-value=14  Score=31.76  Aligned_cols=25  Identities=28%  Similarity=0.784  Sum_probs=20.0

Q ss_pred             CCcchhhhHHHHHHHHccccccceecCCCC--ccccc
Q psy12937         76 RPTTTIICKYFIEAVENSKYGWFWSCPNGP--CTFEN  110 (111)
Q Consensus        76 ~~~TdiVCK~FLeAvE~~kYGWFW~CPNGd--C~YRH  110 (111)
                      +--|+-||+-||--          +|--||  |+|+|
T Consensus        33 ~wl~~eVCReF~rn----------~C~R~d~~CkfaH   59 (331)
T KOG2494|consen   33 KWLTLEVCREFLRN----------TCSRGDRECKFAH   59 (331)
T ss_pred             chhHHHHHHHHHhc----------cccCCCccccccC
Confidence            44799999999964          577773  99988


No 13 
>PF14753 DUF4475:  Domain of unknown function (DUF4475)
Probab=37.21  E-value=15  Score=29.43  Aligned_cols=20  Identities=30%  Similarity=0.647  Sum_probs=17.1

Q ss_pred             HHHHHccccccceecCCC-Ccc
Q psy12937         87 IEAVENSKYGWFWSCPNG-PCT  107 (111)
Q Consensus        87 LeAvE~~kYGWFW~CPNG-dC~  107 (111)
                      ..||.++.|-. |.+|+| ||+
T Consensus        28 p~~~knrlyv~-Wr~~~~~DC~   48 (196)
T PF14753_consen   28 PLRIKNRLYVS-WRNPTGMDCK   48 (196)
T ss_pred             HhhhcCceEEE-EeCCCCccee
Confidence            35899999997 999999 686


No 14 
>KOG2295|consensus
Probab=36.99  E-value=29  Score=32.26  Aligned_cols=42  Identities=21%  Similarity=0.328  Sum_probs=31.9

Q ss_pred             HHHHHHHhhhcccccCCCcchhhhHHHHHHHHccccccceecCCCCc
Q psy12937         60 KLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSCPNGPC  106 (111)
Q Consensus        60 kLe~VV~~Khg~~~k~~~~TdiVCK~FLeAvE~~kYGWFW~CPNGdC  106 (111)
                      -|+++-.+|-|.    +..++-|= -||+-+-..+|+|-|-||-+.|
T Consensus       476 ~lee~eakkkg~----k~~e~eve-~~v~s~t~e~~kdKy~C~lsgc  517 (648)
T KOG2295|consen  476 ELEEEEAKKKGA----KDVEDEVE-NFVDSNTMELDKDKYLCPLSGC  517 (648)
T ss_pred             cchHHHHHHhcc----cCHHHHHH-HHHHHHHHHhhcccccCCCcch
Confidence            456777777774    44666654 6889999999999999998655


No 15 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=34.93  E-value=32  Score=26.69  Aligned_cols=21  Identities=33%  Similarity=0.960  Sum_probs=16.7

Q ss_pred             HHHHHHHccccccceecCCCCccccc
Q psy12937         85 YFIEAVENSKYGWFWSCPNGPCTFEN  110 (111)
Q Consensus        85 ~FLeAvE~~kYGWFW~CPNGdC~YRH  110 (111)
                      -.|+-+++|+   .|+||-  |=|.|
T Consensus       124 ~~Le~~~~~~---~~vC~v--CGy~~  144 (166)
T COG1592         124 GLLERLEEGK---VWVCPV--CGYTH  144 (166)
T ss_pred             HHHHhhhcCC---EEEcCC--CCCcc
Confidence            5689999999   999995  55554


No 16 
>PF06839 zf-GRF:  GRF zinc finger;  InterPro: IPR010666 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This presumed zinc-binding domain is found in a variety of DNA-binding proteins. It seems likely that this domain is involved in nucleic acid binding. It is named GRF after three conserved residues in the centre of the alignment of the domain. This zinc finger may be related to IPR000380 from INTERPRO. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=33.67  E-value=26  Score=20.94  Aligned_cols=17  Identities=35%  Similarity=0.808  Sum_probs=12.8

Q ss_pred             ccccccceecCCC-C--ccc
Q psy12937         92 NSKYGWFWSCPNG-P--CTF  108 (111)
Q Consensus        92 ~~kYGWFW~CPNG-d--C~Y  108 (111)
                      ++.--.||.||+. +  |.|
T Consensus        19 ~N~GR~Fy~C~~~~~~~C~f   38 (45)
T PF06839_consen   19 PNPGRRFYKCPNYKDKGCNF   38 (45)
T ss_pred             CCCCCcceECCCCCCCCcCC
Confidence            3555679999998 3  876


No 17 
>PF07936 Defensin_4:  Potassium-channel blocking toxin;  InterPro: IPR012414 This family features the antihypertensive and antiviral proteins BDS-I (P11494 from SWISSPROT) and BDS-II (P59084 from SWISSPROT) expressed by Anemonia sulcata. BDS-I is organised into a triple-stranded antiparallel beta-sheet, with an additional small antiparallel beta-sheet at the N terminus []. Both peptides are known to specifically block the Kv3.4 potassium channel, and thus bring about a decrease in blood pressure []. Moreover, they inhibit the cytopathic effects of mouse hepatitis virus strain MHV-A59 on mouse liver cells, by an unknown mechanism []. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0042151 nematocyst; PDB: 2BDS_A 1BDS_A 1WXN_A 1WQK_A.
Probab=33.10  E-value=15  Score=22.26  Aligned_cols=8  Identities=75%  Similarity=1.909  Sum_probs=5.1

Q ss_pred             cce--ecCCC
Q psy12937         97 WFW--SCPNG  104 (111)
Q Consensus        97 WFW--~CPNG  104 (111)
                      |||  .||+|
T Consensus        13 W~~~~~CP~g   22 (34)
T PF07936_consen   13 WFARGSCPGG   22 (34)
T ss_dssp             EESTSS--TT
T ss_pred             EEEecCCCCC
Confidence            888  79998


No 18 
>PF04054 Not1:  CCR4-Not complex component, Not1;  InterPro: IPR007196 The Ccr4-Not complex is a global regulator of gene expression that is conserved from yeast to human. It affects genes positively and negatively and is thought to regulate transcription factor IID function. In Saccharomyces cerevisiae, it exists in two prominent forms and consists of at least nine core subunits: the five Not proteins (Not1p to Not5p), Caf1p, Caf40p, Caf130p and Ccr4p []. The Ccr4-Not complex regulates many different cellular functions, including RNA degradation and transcription initiation. It may be a regulatory platform that senses nutrient levels and stress []. Caf1p and Ccr4p, are directly involved in mRNA deadenylation, and Caf1p is associated with Dhh1p, a putative RNA helicase thought to be a component of the decapping complex []. Pop2, a component of the Ccr4-Not complex, functions as a deadenylase []. The Ccr4-Not complex is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID [].
Probab=32.56  E-value=25  Score=29.99  Aligned_cols=41  Identities=27%  Similarity=0.519  Sum_probs=25.8

Q ss_pred             HHHHHHHHhhhcccccCCCcchhhhHHHHHHHHccccccceecCC
Q psy12937         59 DKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSCPN  103 (111)
Q Consensus        59 ~kLe~VV~~Khg~~~k~~~~TdiVCK~FLeAvE~~kYGWFW~CPN  103 (111)
                      |.+--|+.++.=- +++.|  =-+=--|+|-|.+.+|+ ||++|-
T Consensus       322 EqItRVLLERliv-~rPHP--WGllitfiELikN~~y~-f~~~pF  362 (379)
T PF04054_consen  322 EQITRVLLERLIV-NRPHP--WGLLITFIELIKNPKYN-FWELPF  362 (379)
T ss_pred             HHHHHHHHHHHhc-CCCCC--ccHHHHHHHHHhCccCC-cccCcc
Confidence            4455566666521 22332  22223799999999999 999985


No 19 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=30.51  E-value=18  Score=30.09  Aligned_cols=12  Identities=50%  Similarity=0.946  Sum_probs=10.4

Q ss_pred             cCCccccCCCch
Q psy12937         17 SGAKCKFSHDLT   28 (111)
Q Consensus        17 KG~KCKFSHDl~   28 (111)
                      =|+-|||+|+-+
T Consensus       155 YGDsCKflH~R~  166 (259)
T COG5152         155 YGDSCKFLHDRS  166 (259)
T ss_pred             CCchhhhhhhhh
Confidence            489999999866


No 20 
>KOG2068|consensus
Probab=30.36  E-value=43  Score=28.81  Aligned_cols=44  Identities=18%  Similarity=0.320  Sum_probs=29.9

Q ss_pred             hhhhhccHHHHHHHHHhhhcccccCCCcchhhhHHHHHHHHccccccceecCCCCccccc
Q psy12937         51 ETMENWDEDKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSCPNGPCTFEN  110 (111)
Q Consensus        51 dtmd~WDe~kLe~VV~~Khg~~~k~~~~TdiVCK~FLeAvE~~kYGWFW~CPNGdC~YRH  110 (111)
                      .-+++||.-.+-=-.++.+       -.|.+-|-+||.-.         .|||.+|||-|
T Consensus       140 rci~~v~g~~~dg~~lka~-------~gttkycs~~l~~~---------~c~~~~cmylh  183 (327)
T KOG2068|consen  140 RCIDDVDGFVDDGRALKAS-------LGTTKYCSFYLRND---------ICQNPDCMYLH  183 (327)
T ss_pred             hHHHHhhhHHhhhhhhHHh-------hCCCcchhHHhhhh---------cccCccccccc
Confidence            4488998766544333332       24667888887643         59998899988


No 21 
>PRK14973 DNA topoisomerase I; Provisional
Probab=30.01  E-value=19  Score=34.22  Aligned_cols=20  Identities=20%  Similarity=0.675  Sum_probs=15.4

Q ss_pred             HHHHHccccccceecCCCCccc
Q psy12937         87 IEAVENSKYGWFWSCPNGPCTF  108 (111)
Q Consensus        87 LeAvE~~kYGWFW~CPNGdC~Y  108 (111)
                      +-.+..|.||||.-||.  |+|
T Consensus       646 ~~~~r~Gr~g~fl~CP~--C~~  665 (936)
T PRK14973        646 VRLIRKGARPWDIGCPL--CSH  665 (936)
T ss_pred             eEEeecCCCcccccCcc--ccc
Confidence            44458899999999974  665


No 22 
>PRK07220 DNA topoisomerase I; Validated
Probab=29.83  E-value=27  Score=32.05  Aligned_cols=14  Identities=43%  Similarity=1.151  Sum_probs=11.0

Q ss_pred             cccccceecCCCCccc
Q psy12937         93 SKYGWFWSCPNGPCTF  108 (111)
Q Consensus        93 ~kYGWFW~CPNGdC~Y  108 (111)
                      ++.+|||.||+  |.|
T Consensus       652 g~~~~~~~Cp~--C~~  665 (740)
T PRK07220        652 GKRPWDLGCPQ--CNF  665 (740)
T ss_pred             CCccceeeCCC--CCC
Confidence            56789999986  655


No 23 
>PF00706 Toxin_4:  Anenome neurotoxin;  InterPro: IPR000693 Sea anemones produce many different neurotoxins with related structure and function. Proteins belonging to this family include the neurotoxins, of which there are several, including calitoxin and anthopleurin. The neurotoxins bind specifically to the sodium channel, thereby delaying its inactivation during signal transduction, resulting in strong stimulation of mammalian cardiac muscle contraction. Calitoxin 1 has been found in neuromuscular prearations of crustaceans, where it increases transmitter release, causing firing of the axons. Three disulphide bonds are present in this protein [, , ].; GO: 0009966 regulation of signal transduction, 0005576 extracellular region; PDB: 2H9X_A 1AHL_A 1APF_A 1SHI_A 1SH1_A 2SH1_A 1ATX_A.
Probab=28.90  E-value=18  Score=22.86  Aligned_cols=11  Identities=45%  Similarity=1.733  Sum_probs=8.7

Q ss_pred             cceecCCC-C-cc
Q psy12937         97 WFWSCPNG-P-CT  107 (111)
Q Consensus        97 WFW~CPNG-d-C~  107 (111)
                      |+|-||.| . |.
T Consensus        21 w~~~CpsGWh~C~   33 (43)
T PF00706_consen   21 WLFGCPSGWHKCK   33 (43)
T ss_dssp             ETSSS-TTEEECC
T ss_pred             eecCCCchhhhhh
Confidence            99999999 5 86


No 24 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=27.32  E-value=26  Score=27.13  Aligned_cols=7  Identities=43%  Similarity=1.825  Sum_probs=6.2

Q ss_pred             cceecCC
Q psy12937         97 WFWSCPN  103 (111)
Q Consensus        97 WFW~CPN  103 (111)
                      |+|.|||
T Consensus       367 ~~~~c~~  373 (389)
T PRK11788        367 LYWHCPS  373 (389)
T ss_pred             ceeECcC
Confidence            8899998


No 25 
>PF09929 DUF2161:  Uncharacterized conserved protein (DUF2161);  InterPro: IPR018679 This family of various hypothetical prokaryotic proteins has no known function.
Probab=26.11  E-value=29  Score=25.90  Aligned_cols=9  Identities=44%  Similarity=1.534  Sum_probs=7.7

Q ss_pred             HHccccccc
Q psy12937         90 VENSKYGWF   98 (111)
Q Consensus        90 vE~~kYGWF   98 (111)
                      +-+|-||||
T Consensus        92 L~~N~YGWF  100 (118)
T PF09929_consen   92 LRDNHYGWF  100 (118)
T ss_pred             HHhCcccce
Confidence            567999999


No 26 
>KOG1155|consensus
Probab=26.11  E-value=52  Score=30.25  Aligned_cols=34  Identities=38%  Similarity=0.676  Sum_probs=24.8

Q ss_pred             HHHHHHHHhhhcccccCCCcchhhhHHHHHHHHccccccceec
Q psy12937         59 DKLKEVVEKKHGEAEKKRPTTTIICKYFIEAVENSKYGWFWSC  101 (111)
Q Consensus        59 ~kLe~VV~~Khg~~~k~~~~TdiVCK~FLeAvE~~kYGWFW~C  101 (111)
                      -=|.-||.+++|+..       .-=+.|+++|  +.|-|||.|
T Consensus       167 lYL~Gvv~k~~~~~s-------~A~~sfv~~v--~~~P~~W~A  200 (559)
T KOG1155|consen  167 LYLYGVVLKELGLLS-------LAIDSFVEVV--NRYPWFWSA  200 (559)
T ss_pred             HHHHHHHHHhhchHH-------HHHHHHHHHH--hcCCcchHH
Confidence            457888888888621       2235788888  579999986


No 27 
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=24.78  E-value=43  Score=23.90  Aligned_cols=17  Identities=47%  Similarity=1.091  Sum_probs=14.3

Q ss_pred             ccccccceecCCCC-ccc
Q psy12937         92 NSKYGWFWSCPNGP-CTF  108 (111)
Q Consensus        92 ~~kYGWFW~CPNGd-C~Y  108 (111)
                      .++||||+.|-|-. |.|
T Consensus        31 ~~~~g~f~gCs~yP~C~~   48 (140)
T COG0551          31 FGKYGIFLGCSNYPKCDY   48 (140)
T ss_pred             EccCCeEEEeCCCCCCCC
Confidence            47889999999984 875


No 28 
>PF14194 Cys_rich_VLP:  Cysteine-rich VLP
Probab=24.70  E-value=46  Score=22.11  Aligned_cols=11  Identities=45%  Similarity=1.195  Sum_probs=10.1

Q ss_pred             hhhhHHHHHHH
Q psy12937         80 TIICKYFIEAV   90 (111)
Q Consensus        80 diVCK~FLeAv   90 (111)
                      .+.|+||.+||
T Consensus        42 s~~CryFr~AV   52 (56)
T PF14194_consen   42 SLLCRYFRAAV   52 (56)
T ss_pred             cHHHHHHHHhh
Confidence            78899999998


No 29 
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=23.70  E-value=50  Score=20.37  Aligned_cols=15  Identities=33%  Similarity=0.970  Sum_probs=7.3

Q ss_pred             HHHHHHccccccceecCC
Q psy12937         86 FIEAVENSKYGWFWSCPN  103 (111)
Q Consensus        86 FLeAvE~~kYGWFW~CPN  103 (111)
                      ||+..++...   |.||-
T Consensus        32 fl~~~~~~~~---W~CPi   46 (50)
T PF02891_consen   32 FLESNQRTPK---WKCPI   46 (50)
T ss_dssp             HHHHHHHS------B-TT
T ss_pred             HHHHhhccCC---eECcC
Confidence            5666665555   99993


No 30 
>PF13413 HTH_25:  Helix-turn-helix domain; PDB: 2WUS_R 3FYM_A.
Probab=23.59  E-value=58  Score=20.77  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=10.4

Q ss_pred             hhHHHHHHHHccccc
Q psy12937         82 ICKYFIEAVENSKYG   96 (111)
Q Consensus        82 VCK~FLeAvE~~kYG   96 (111)
                      |=..+|+|||++.|.
T Consensus        22 I~~~~l~aiE~~~~~   36 (62)
T PF13413_consen   22 ISVSYLEAIENGDFD   36 (62)
T ss_dssp             --HHHHHHHHCT-GC
T ss_pred             CCHHHHHHHHCcChh
Confidence            445899999999875


No 31 
>KOG1813|consensus
Probab=23.53  E-value=28  Score=29.86  Aligned_cols=13  Identities=46%  Similarity=0.848  Sum_probs=11.3

Q ss_pred             ccCCccccCCCch
Q psy12937         16 QSGAKCKFSHDLT   28 (111)
Q Consensus        16 ~KG~KCKFSHDl~   28 (111)
                      ..|+-|||.||..
T Consensus       199 g~gdSckFlh~r~  211 (313)
T KOG1813|consen  199 GYGDSCKFLHDRS  211 (313)
T ss_pred             cccchhhhhhhhh
Confidence            4789999999976


No 32 
>PF08806 Sep15_SelM:  Sep15/SelM redox domain;  InterPro: IPR014912 Sep15 and SelM are eukaryotic selenoproteins that have a thioredoxin-like domain and a surface accessible active site redox motif []. This suggests that they function as thiol-disulphide isomerases involved in disulphide bond formation in the endoplasmic reticulum []. ; PDB: 2A4H_A 2A2P_A.
Probab=22.83  E-value=43  Score=22.65  Aligned_cols=18  Identities=28%  Similarity=0.741  Sum_probs=14.5

Q ss_pred             hhhhhccHHHHHHHHHhh
Q psy12937         51 ETMENWDEDKLKEVVEKK   68 (111)
Q Consensus        51 dtmd~WDe~kLe~VV~~K   68 (111)
                      =.+++|+.+.+++.+.+|
T Consensus        58 i~i~~w~~d~i~efL~~k   75 (78)
T PF08806_consen   58 INIEKWKTDEIEEFLNEK   75 (78)
T ss_dssp             EE-SSSSHCHHHHHHHHH
T ss_pred             EEcccCCHHHHHHHHHHh
Confidence            458999999999998765


No 33 
>KOG2333|consensus
Probab=21.74  E-value=38  Score=31.35  Aligned_cols=17  Identities=41%  Similarity=1.050  Sum_probs=13.2

Q ss_pred             eeeeeccCCccccCCCchh
Q psy12937         11 LPCLFQSGAKCKFSHDLTI   29 (111)
Q Consensus        11 ~~C~f~KG~KCKFSHDl~~   29 (111)
                      ..|.|  |++|+|-||++.
T Consensus        88 ~~C~f--~d~Crf~HDi~a  104 (614)
T KOG2333|consen   88 SKCSF--GDNCRFVHDIEA  104 (614)
T ss_pred             ccCcc--cccccccccHHH
Confidence            44555  799999999875


No 34 
>KOG1544|consensus
Probab=20.18  E-value=54  Score=29.25  Aligned_cols=16  Identities=38%  Similarity=0.887  Sum_probs=13.6

Q ss_pred             hhHHHHHHHHcccccc
Q psy12937         82 ICKYFIEAVENSKYGW   97 (111)
Q Consensus        82 VCK~FLeAvE~~kYGW   97 (111)
                      |=.-.||+|.+|.|||
T Consensus       148 v~Pd~iE~in~G~YgW  163 (470)
T KOG1544|consen  148 VDPDMIEAINQGNYGW  163 (470)
T ss_pred             cCHHHHHHHhcCCccc
Confidence            3356899999999998


Done!