Query         psy12951
Match_columns 111
No_of_seqs    106 out of 1026
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:53:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12951.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12951hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0234 GroS Co-chaperonin Gro 100.0 9.4E-41   2E-45  226.8  10.1   96   14-109     1-96  (96)
  2 PRK00364 groES co-chaperonin G 100.0 1.1E-38 2.4E-43  216.7  11.1   95   14-108     1-95  (95)
  3 PTZ00414 10 kDa heat shock pro 100.0   1E-37 2.2E-42  214.1  10.5   93   11-108     7-99  (100)
  4 cd00320 cpn10 Chaperonin 10 Kd 100.0 2.5E-37 5.4E-42  209.3  10.2   93   15-107     1-93  (93)
  5 PRK14533 groES co-chaperonin G 100.0   7E-37 1.5E-41  206.9  10.3   91   14-109     1-91  (91)
  6 PF00166 Cpn10:  Chaperonin 10  100.0 2.5E-35 5.3E-40  199.0  11.3   93   15-107     1-93  (93)
  7 KOG1641|consensus              100.0 3.9E-33 8.4E-38  191.1   6.6   97   11-107     6-103 (104)
  8 KOG1197|consensus               92.0    0.13 2.8E-06   41.6   2.6   41   35-84     55-99  (336)
  9 PF08240 ADH_N:  Alcohol dehydr  90.3    0.17 3.7E-06   33.6   1.5   26   48-82     38-63  (109)
 10 COG1062 AdhC Zn-dependent alco  89.8    0.22 4.8E-06   41.3   2.1   53   18-80     25-85  (366)
 11 COG4384 Mu-like prophage prote  84.7     2.8 6.1E-05   32.1   5.3   40   63-102    87-133 (203)
 12 COG0604 Qor NADPH:quinone redu  83.1     1.3 2.9E-05   35.4   3.2   71   18-103    25-108 (326)
 13 COG1329 Transcriptional regula  82.9     1.4   3E-05   33.0   3.0   38   70-107     3-50  (166)
 14 KOG0025|consensus               81.8       3 6.4E-05   34.4   4.7   72   18-99     46-130 (354)
 15 TIGR02819 fdhA_non_GSH formald  79.4     1.6 3.4E-05   35.5   2.5   25   48-81     68-92  (393)
 16 TIGR03366 HpnZ_proposed putati  78.4       2 4.2E-05   32.8   2.6   30   49-82      6-36  (280)
 17 PF06890 Phage_Mu_Gp45:  Bacter  78.0      10 0.00022   28.0   6.2   40   37-84     48-87  (162)
 18 KOG0022|consensus               77.1     1.9   4E-05   35.9   2.2   53   17-79     29-90  (375)
 19 PF08140 Cuticle_1:  Crustacean  75.9     4.8 0.00011   23.4   3.1   26   35-60      2-29  (40)
 20 PF02559 CarD_CdnL_TRCF:  CarD-  75.1     4.7  0.0001   26.5   3.4   29   72-100     2-38  (98)
 21 COG1064 AdhP Zn-dependent alco  74.8     2.2 4.9E-05   35.0   2.1   26   46-80     62-87  (339)
 22 cd08230 glucose_DH Glucose deh  73.6     2.5 5.5E-05   33.2   2.1   24   48-81     64-87  (355)
 23 COG1465 Predicted alternative   70.7      20 0.00043   29.7   6.6   86   12-100   203-316 (376)
 24 PLN02586 probable cinnamyl alc  70.6     3.5 7.6E-05   32.8   2.3   24   48-80     73-96  (360)
 25 KOG0024|consensus               67.7     2.1 4.5E-05   35.5   0.5   54   20-82     29-93  (354)
 26 PF10794 DUF2606:  Protein of u  67.5      31 0.00068   24.8   6.3   67   20-89     41-112 (131)
 27 cd08281 liver_ADH_like1 Zinc-d  66.6     4.5 9.8E-05   32.0   2.2   24   48-80     68-91  (371)
 28 TIGR02822 adh_fam_2 zinc-bindi  66.5       5 0.00011   31.4   2.4   25   48-81     63-87  (329)
 29 PF12508 DUF3714:  Protein of u  66.3      17 0.00036   27.8   5.1   39   18-62     66-104 (200)
 30 cd08261 Zn_ADH7 Alcohol dehydr  66.2      12 0.00027   28.7   4.5   24   48-80     60-83  (337)
 31 PRK10309 galactitol-1-phosphat  66.1     4.9 0.00011   31.3   2.3   26   47-81     59-84  (347)
 32 cd08301 alcohol_DH_plants Plan  65.8     5.1 0.00011   31.6   2.3   25   48-81     63-87  (369)
 33 cd08269 Zn_ADH9 Alcohol dehydr  65.7      11 0.00024   28.2   4.1   27   48-83     58-84  (312)
 34 COG2140 Thermophilic glucose-6  64.7     9.9 0.00021   29.4   3.6   36   63-98    121-157 (209)
 35 PLN02178 cinnamyl-alcohol dehy  64.5     5.4 0.00012   32.1   2.3   24   48-80     67-90  (375)
 36 PLN02827 Alcohol dehydrogenase  64.0     5.3 0.00011   32.0   2.1   25   48-81     70-94  (378)
 37 cd08293 PTGR2 Prostaglandin re  63.1     6.2 0.00013   30.4   2.3   24   48-80     75-98  (345)
 38 TIGR01202 bchC 2-desacetyl-2-h  62.5     6.1 0.00013   30.6   2.2   47   48-104    65-115 (308)
 39 cd05279 Zn_ADH1 Liver alcohol   62.3      18  0.0004   28.5   4.9   25   48-81     60-84  (365)
 40 cd08239 THR_DH_like L-threonin  62.0     7.2 0.00016   30.1   2.5   26   48-82     61-86  (339)
 41 TIGR02818 adh_III_F_hyde S-(hy  62.0     6.5 0.00014   31.2   2.3   25   48-81     62-86  (368)
 42 PLN02740 Alcohol dehydrogenase  60.9     6.5 0.00014   31.4   2.1   25   48-81     72-96  (381)
 43 cd08300 alcohol_DH_class_III c  60.8     6.9 0.00015   31.0   2.3   25   48-81     63-87  (368)
 44 TIGR02227 sigpep_I_bact signal  60.6      39 0.00085   24.2   6.0   38   19-56     36-77  (163)
 45 TIGR03451 mycoS_dep_FDH mycoth  60.4     7.2 0.00016   30.7   2.3   24   48-80     61-84  (358)
 46 PLN02514 cinnamyl-alcohol dehy  60.2     7.5 0.00016   30.7   2.3   24   48-80     70-93  (357)
 47 TIGR03214 ura-cupin putative a  59.6      18 0.00039   28.2   4.4   49   49-99    201-252 (260)
 48 cd08238 sorbose_phosphate_red   59.6     7.5 0.00016   31.4   2.3   26   48-81     69-94  (410)
 49 PRK10083 putative oxidoreducta  59.4     8.4 0.00018   29.6   2.4   25   48-81     60-84  (339)
 50 cd08237 ribitol-5-phosphate_DH  58.9      20 0.00044   28.1   4.6   24   48-82     65-88  (341)
 51 cd08260 Zn_ADH6 Alcohol dehydr  57.7      11 0.00023   29.1   2.8   25   48-81     61-85  (345)
 52 cd08277 liver_alcohol_DH_like   56.7     9.1  0.0002   30.2   2.3   25   48-81     62-86  (365)
 53 smart00696 DM9 Repeats found i  56.5      29 0.00062   22.0   4.2   50   40-91     12-63  (71)
 54 cd08233 butanediol_DH_like (2R  55.9       9  0.0002   29.8   2.1   24   48-80     71-94  (351)
 55 cd05278 FDH_like Formaldehyde   55.1      11 0.00024   28.9   2.5   24   48-80     61-84  (347)
 56 TIGR00692 tdh L-threonine 3-de  54.8      11 0.00023   29.2   2.4   25   48-81     62-86  (340)
 57 TIGR02817 adh_fam_1 zinc-bindi  54.7      11 0.00024   28.8   2.4   25   48-81     65-89  (336)
 58 cd08292 ETR_like_2 2-enoyl thi  54.5      11 0.00024   28.4   2.4   26   48-82     65-90  (324)
 59 cd08264 Zn_ADH_like2 Alcohol d  54.2      10 0.00022   28.8   2.2   25   48-81     61-85  (325)
 60 COG3450 Predicted enzyme of th  53.8      33 0.00071   24.1   4.5   35   63-99     79-115 (116)
 61 cd07376 PLPDE_III_DSD_D-TA_lik  53.5      20 0.00044   28.3   3.8   37   71-108   305-342 (345)
 62 cd08287 FDH_like_ADH3 formalde  53.0      11 0.00024   29.0   2.2   24   48-80     60-83  (345)
 63 cd08291 ETR_like_1 2-enoyl thi  52.3      12 0.00026   28.7   2.3   26   48-81     67-92  (324)
 64 cd08284 FDH_like_2 Glutathione  52.1      12 0.00027   28.6   2.3   24   48-80     60-83  (344)
 65 cd08255 2-desacetyl-2-hydroxye  51.3      19 0.00041   26.7   3.1   26   47-81     26-51  (277)
 66 cd08278 benzyl_alcohol_DH Benz  51.3      12 0.00026   29.5   2.2   24   48-80     62-85  (365)
 67 cd08262 Zn_ADH8 Alcohol dehydr  50.8      13 0.00028   28.6   2.2   25   48-81     70-95  (341)
 68 PRK10838 spr outer membrane li  50.6     9.9 0.00021   28.7   1.5   34   36-82    106-139 (190)
 69 cd05188 MDR Medium chain reduc  50.5      14 0.00029   26.8   2.2   26   48-82     36-61  (271)
 70 cd05284 arabinose_DH_like D-ar  50.5      13 0.00028   28.5   2.2   25   48-81     64-88  (340)
 71 cd08285 NADP_ADH NADP(H)-depen  50.2      14 0.00031   28.6   2.4   25   48-81     60-84  (351)
 72 cd08235 iditol_2_DH_like L-idi  50.1      14  0.0003   28.4   2.3   24   48-80     60-83  (343)
 73 cd08286 FDH_like_ADH2 formalde  49.4      15 0.00032   28.4   2.4   25   48-81     61-85  (345)
 74 cd08236 sugar_DH NAD(P)-depend  48.7      16 0.00034   28.1   2.4   25   48-81     59-83  (343)
 75 cd08232 idonate-5-DH L-idonate  48.3      14 0.00031   28.3   2.1   24   48-80     60-83  (339)
 76 PF10844 DUF2577:  Protein of u  48.2      15 0.00033   24.6   2.0   22   71-98     76-97  (100)
 77 cd08283 FDH_like_1 Glutathione  48.1      15 0.00032   29.4   2.3   25   48-81     61-85  (386)
 78 cd08279 Zn_ADH_class_III Class  47.5      16 0.00034   28.7   2.3   24   48-80     60-83  (363)
 79 cd08258 Zn_ADH4 Alcohol dehydr  47.5      15 0.00033   28.1   2.2   25   48-81     62-86  (306)
 80 PLN02702 L-idonate 5-dehydroge  47.0      15 0.00033   28.8   2.2   24   48-80     80-103 (364)
 81 PF01079 Hint:  Hint module;  I  46.7      37  0.0008   26.1   4.1   24   62-85     21-45  (217)
 82 cd08231 MDR_TM0436_like Hypoth  46.0      17 0.00037   28.3   2.3   30   48-81     61-91  (361)
 83 cd05283 CAD1 Cinnamyl alcohol   46.0      17 0.00036   28.2   2.2   24   48-80     60-83  (337)
 84 PTZ00354 alcohol dehydrogenase  46.0      18 0.00039   27.3   2.3   24   48-80     65-88  (334)
 85 COG1063 Tdh Threonine dehydrog  45.9      18 0.00039   29.0   2.4   54   47-110    61-141 (350)
 86 PF09871 DUF2098:  Uncharacteri  45.5      55  0.0012   22.0   4.4   34   71-104     2-40  (91)
 87 PRK05396 tdh L-threonine 3-deh  45.3      18  0.0004   27.9   2.3   25   48-81     64-88  (341)
 88 PRK05889 putative acetyl-CoA c  45.3      45 0.00097   20.5   3.7   29   79-107    42-70  (71)
 89 cd08290 ETR 2-enoyl thioester   44.7      19 0.00042   27.6   2.4   26   48-82     70-95  (341)
 90 cd08282 PFDH_like Pseudomonas   44.6      19  0.0004   28.6   2.3   24   48-80     60-83  (375)
 91 KOG0023|consensus               44.6      18 0.00038   30.2   2.2   24   48-80     72-95  (360)
 92 PRK10754 quinone oxidoreductas  44.1      20 0.00044   27.2   2.4   25   48-81     64-88  (327)
 93 cd08259 Zn_ADH5 Alcohol dehydr  43.7      20 0.00043   27.0   2.2   25   48-81     61-85  (332)
 94 smart00829 PKS_ER Enoylreducta  43.6      19 0.00042   26.0   2.1   26   48-82     30-55  (288)
 95 cd08274 MDR9 Medium chain dehy  43.3      19 0.00042   27.6   2.2   25   48-81     84-108 (350)
 96 cd08245 CAD Cinnamyl alcohol d  43.2      23  0.0005   27.0   2.6   25   48-81     60-84  (330)
 97 cd08297 CAD3 Cinnamyl alcohol   42.9      47   0.001   25.4   4.3   24   48-80     63-86  (341)
 98 COG4079 Uncharacterized protei  42.6      30 0.00064   27.9   3.1   28   71-99    261-292 (293)
 99 cd08246 crotonyl_coA_red croto  42.6      22 0.00047   28.3   2.4   25   48-81     88-112 (393)
100 cd05285 sorbitol_DH Sorbitol d  42.4      21 0.00046   27.6   2.3   24   48-80     61-84  (343)
101 TIGR00739 yajC preprotein tran  42.4      58  0.0013   21.3   4.1   25   71-95     37-62  (84)
102 PRK11479 hypothetical protein;  42.2     8.4 0.00018   30.9  -0.0   38   32-82     38-75  (274)
103 cd08268 MDR2 Medium chain dehy  41.8      21 0.00046   26.5   2.1   24   48-80     64-87  (328)
104 cd08240 6_hydroxyhexanoate_dh_  41.6      21 0.00044   27.7   2.1   25   48-81     73-97  (350)
105 cd08266 Zn_ADH_like1 Alcohol d  41.6      22 0.00047   26.7   2.2   25   48-81     64-88  (342)
106 TIGR01751 crot-CoA-red crotony  40.8      22 0.00047   28.5   2.2   24   49-81     85-108 (398)
107 PRK09422 ethanol-active dehydr  40.7      23 0.00051   27.0   2.3   24   48-80     60-83  (338)
108 cd05195 enoyl_red enoyl reduct  40.5      23 0.00051   25.5   2.1   25   48-81     34-58  (293)
109 cd06555 ASCH_PF0470_like ASC-1  40.0      19 0.00041   25.0   1.5   15   71-85     31-45  (109)
110 TIGR03779 Bac_Flav_CT_M Bacter  39.7      68  0.0015   27.2   5.0   38   18-61    269-306 (410)
111 cd08234 threonine_DH_like L-th  39.5      26 0.00057   26.6   2.4   24   48-80     59-82  (334)
112 cd08256 Zn_ADH2 Alcohol dehydr  39.3      60  0.0013   25.1   4.4   26   48-80     69-94  (350)
113 cd08254 hydroxyacyl_CoA_DH 6-h  39.2      25 0.00055   26.6   2.2   24   48-80     63-86  (338)
114 cd08299 alcohol_DH_class_I_II_  39.1      25 0.00054   28.0   2.3   25   48-81     67-91  (373)
115 cd08298 CAD2 Cinnamyl alcohol   39.0      55  0.0012   24.9   4.1   24   48-80     65-88  (329)
116 TIGR03201 dearomat_had 6-hydro  39.0      28 0.00061   27.2   2.5   24   48-81     60-83  (349)
117 cd08270 MDR4 Medium chain dehy  38.6      28 0.00061   26.0   2.4   25   48-81     58-82  (305)
118 cd08251 polyketide_synthase po  38.5      26 0.00056   25.7   2.1   25   48-81     44-68  (303)
119 cd05282 ETR_like 2-enoyl thioe  38.3      28 0.00062   26.1   2.4   26   48-82     63-88  (323)
120 cd08244 MDR_enoyl_red Possible  38.1      28 0.00061   26.1   2.3   26   48-82     66-91  (324)
121 cd08248 RTN4I1 Human Reticulon  37.8      26 0.00057   26.8   2.2   25   48-81     80-104 (350)
122 PLN03154 putative allyl alcoho  37.8      25 0.00054   27.8   2.0   24   48-80     81-104 (348)
123 cd08273 MDR8 Medium chain dehy  37.5      28  0.0006   26.4   2.2   25   48-81     64-88  (331)
124 cd08265 Zn_ADH3 Alcohol dehydr  37.3      26 0.00057   27.9   2.1   24   48-80     94-117 (384)
125 cd08296 CAD_like Cinnamyl alco  36.6      30 0.00066   26.7   2.3   24   48-80     61-84  (333)
126 cd08249 enoyl_reductase_like e  35.2      34 0.00074   26.5   2.4   25   48-81     61-85  (339)
127 cd08263 Zn_ADH10 Alcohol dehyd  35.1      30 0.00066   27.1   2.2   27   48-80     60-86  (367)
128 cd08253 zeta_crystallin Zeta-c  34.8      31 0.00068   25.4   2.1   26   48-82     64-89  (325)
129 cd08267 MDR1 Medium chain dehy  34.7      34 0.00074   25.4   2.3   25   48-81     65-89  (319)
130 PF12124 Nsp3_PL2pro:  Coronavi  34.5      81  0.0018   19.7   3.5   25   71-95     31-56  (66)
131 PF08206 OB_RNB:  Ribonuclease   34.1      66  0.0014   19.2   3.1    9   20-28     35-43  (58)
132 PRK13771 putative alcohol dehy  34.1      36 0.00077   26.0   2.4   25   48-81     61-85  (334)
133 cd05286 QOR2 Quinone oxidoredu  33.6      35 0.00076   25.0   2.2   25   48-81     61-85  (320)
134 cd00148 PROF Profilin binds ac  33.5      81  0.0018   21.8   3.9   19   86-104    60-78  (127)
135 PRK11171 hypothetical protein;  33.4 1.9E+02  0.0041   22.5   6.4   50   48-99    205-257 (266)
136 COG3264 Small-conductance mech  33.1      49  0.0011   30.5   3.3   15   71-85    660-674 (835)
137 cd08272 MDR6 Medium chain dehy  33.1      35 0.00076   25.3   2.1   25   48-81     64-88  (326)
138 cd08271 MDR5 Medium chain dehy  33.1      36 0.00077   25.4   2.2   25   48-81     63-87  (325)
139 PF01052 SpoA:  Surface present  33.0      60  0.0013   20.0   2.9   25   71-95     28-54  (77)
140 PRK10579 hypothetical protein;  32.8 1.3E+02  0.0028   20.5   4.6   62   35-105    26-88  (94)
141 PRK09880 L-idonate 5-dehydroge  32.3      41 0.00089   26.2   2.5   23   48-81     66-88  (343)
142 PF00235 Profilin:  Profilin;    31.8      44 0.00096   22.3   2.3   18   85-102    58-75  (121)
143 TIGR00074 hypC_hupF hydrogenas  31.7      64  0.0014   20.9   2.9   12   71-82     35-46  (76)
144 cd08252 AL_MDR Arginate lyase   31.5      41 0.00089   25.5   2.3   25   48-81     66-90  (336)
145 PRK05585 yajC preprotein trans  31.1   1E+02  0.0022   21.1   4.0   22   71-92     52-74  (106)
146 cd08250 Mgc45594_like Mgc45594  31.1      44 0.00096   25.3   2.4   26   48-82     67-92  (329)
147 PF11901 DUF3421:  Protein of u  30.9      68  0.0015   22.1   3.1   49   40-90     68-118 (119)
148 PF07883 Cupin_2:  Cupin domain  30.9      86  0.0019   18.2   3.3   40   57-98     28-68  (71)
149 cd06819 PLPDE_III_LS_D-TA Type  30.1      70  0.0015   25.3   3.5   37   71-108   316-353 (358)
150 PF02699 YajC:  Preprotein tran  30.0      17 0.00037   23.6   0.0   28   71-99     36-64  (82)
151 cd04456 S1_IF1A_like S1_IF1A_l  30.0      62  0.0014   20.9   2.7   22   18-39     40-61  (78)
152 cd05276 p53_inducible_oxidored  29.8      42 0.00091   24.6   2.0   25   48-81     64-88  (323)
153 TIGR03784 marine_sortase sorta  29.6      58  0.0013   24.1   2.8   32   71-102   108-139 (174)
154 cd05281 TDH Threonine dehydrog  29.4      43 0.00093   25.8   2.1   24   48-80     64-87  (341)
155 smart00392 PROF Profilin. Bind  29.2      56  0.0012   22.6   2.5   18   86-103    62-79  (129)
156 PF06560 GPI:  Glucose-6-phosph  29.1      76  0.0017   23.8   3.3   50   49-98     82-141 (182)
157 PRK04190 glucose-6-phosphate i  28.8 1.1E+02  0.0024   23.0   4.1   35   63-97    115-150 (191)
158 COG4043 Preprotein translocase  28.7      27  0.0006   24.4   0.8   12   71-82     33-44  (111)
159 COG2217 ZntA Cation transport   28.5      57  0.0012   29.4   3.0   31   48-79    245-278 (713)
160 PF11302 DUF3104:  Protein of u  28.5      31 0.00067   22.6   1.0   15   70-84      4-18  (75)
161 PRK06531 yajC preprotein trans  28.2 1.1E+02  0.0024   21.3   3.8   34   71-104    36-71  (113)
162 PF01455 HupF_HypC:  HupF/HypC   28.1      64  0.0014   20.3   2.4   12   71-82     37-48  (68)
163 PRK12278 50S ribosomal protein  28.0 2.3E+02   0.005   22.0   5.9   21   71-91     13-36  (221)
164 TIGR02876 spore_yqfD sporulati  27.9 1.9E+02  0.0042   23.9   5.8   36   71-107   208-245 (382)
165 PF13856 Gifsy-2:  ATP-binding   27.6 1.2E+02  0.0026   19.8   3.8   33   67-101    53-85  (95)
166 TIGR02824 quinone_pig3 putativ  27.5      50  0.0011   24.4   2.1   25   48-81     64-88  (325)
167 cd08275 MDR3 Medium chain dehy  27.5      51  0.0011   24.7   2.2   25   48-81     63-87  (337)
168 cd05289 MDR_like_2 alcohol deh  26.5      52  0.0011   24.1   2.0   26   48-82     66-91  (309)
169 PRK10689 transcription-repair   25.9      87  0.0019   29.8   3.8   31   71-101   476-514 (1147)
170 PF07378 FlbT:  Flagellar prote  25.7      57  0.0012   23.1   2.0   34   70-104     3-42  (126)
171 PRK02268 hypothetical protein;  25.4      34 0.00073   24.8   0.8   16   65-80     28-44  (141)
172 cd04451 S1_IF1 S1_IF1: Transla  24.8      45 0.00097   20.2   1.2   11   71-81     40-50  (64)
173 cd08276 MDR7 Medium chain dehy  24.8      61  0.0013   24.3   2.2   25   48-81     64-88  (336)
174 PF02643 DUF192:  Uncharacteriz  24.4      21 0.00046   24.1  -0.4   25   52-82     84-108 (108)
175 PF03293 Pox_RNA_pol:  Poxvirus  24.4 1.8E+02  0.0038   21.5   4.4   34   71-104    98-131 (160)
176 PF12852 Cupin_6:  Cupin         24.4      60  0.0013   23.2   2.0   25   64-88     51-75  (186)
177 PF11948 DUF3465:  Protein of u  24.4 1.1E+02  0.0023   22.1   3.2   11   71-81     85-95  (131)
178 TIGR00580 mfd transcription-re  24.1      98  0.0021   28.8   3.7   32   70-101   326-365 (926)
179 cd06820 PLPDE_III_LS_D-TA_like  24.0 1.1E+02  0.0023   24.3   3.5   37   71-108   311-348 (353)
180 cd03703 aeIF5B_II aeIF5B_II: T  23.6      97  0.0021   21.5   2.8   19   71-89     26-47  (110)
181 CHL00010 infA translation init  23.4 1.2E+02  0.0025   19.4   3.0   11   71-81     46-56  (78)
182 KOG3309|consensus               23.4      24 0.00053   26.2  -0.2   22   61-82     49-70  (159)
183 PF06865 DUF1255:  Protein of u  23.1 1.6E+02  0.0034   20.0   3.7   64   35-107    26-90  (94)
184 PF11549 Sec31:  Protein transp  22.9      30 0.00064   21.1   0.1   19   40-58     29-47  (51)
185 cd05794 S1_EF-P_repeat_2 S1_EF  22.9      56  0.0012   20.1   1.3   17   68-84     34-50  (56)
186 PRK13914 invasion associated s  22.8      61  0.0013   28.1   2.0   35   36-83    404-438 (481)
187 PF00924 MS_channel:  Mechanose  22.8 1.2E+02  0.0027   21.6   3.4   21   71-91     60-80  (206)
188 PRK05886 yajC preprotein trans  22.4 2.1E+02  0.0045   19.8   4.3    8   50-57     52-59  (109)
189 PRK12426 elongation factor P;   22.4 1.3E+02  0.0028   22.7   3.5   40   63-102    45-87  (185)
190 PHA02951 Hypothetical protein;  22.3 4.6E+02  0.0099   21.8   7.6   84   13-99     92-181 (337)
191 PF13375 RnfC_N:  RnfC Barrel s  22.3      92   0.002   21.0   2.5   11   70-80     44-54  (101)
192 PRK12784 hypothetical protein;  22.2   1E+02  0.0022   20.6   2.5   23   52-79     44-66  (84)
193 PHA02965 hypothetical protein;  22.2 2.6E+02  0.0057   23.7   5.5   82   12-99    119-209 (466)
194 PRK10861 signal peptidase I; P  22.0   3E+02  0.0065   22.5   5.8   67   19-92     98-169 (324)
195 COG0261 RplU Ribosomal protein  21.9 2.8E+02  0.0061   19.2   4.8   30   71-102    13-45  (103)
196 PRK11507 ribosome-associated p  21.7 2.3E+02   0.005   18.1   4.2   28   71-98     38-69  (70)
197 PRK00276 infA translation init  21.6      57  0.0012   20.4   1.3   11   71-81     46-56  (72)
198 cd06812 PLPDE_III_DSD_D-TA_lik  21.5 1.2E+02  0.0027   24.1   3.4   37   71-108   331-369 (374)
199 cd07557 trimeric_dUTPase Trime  21.5 1.4E+02   0.003   18.8   3.1   35   20-56     19-55  (92)
200 TIGR02480 fliN flagellar motor  21.3 1.3E+02  0.0029   18.9   3.0   26   71-96     28-55  (77)
201 PF09285 Elong-fact-P_C:  Elong  21.3      88  0.0019   19.2   2.0   18   68-85     34-51  (56)
202 PF07591 PT-HINT:  Pretoxin HIN  21.2      32 0.00069   24.0   0.0   19   63-82      5-24  (130)
203 PF06236 MelC1:  Tyrosinase co-  21.1 1.2E+02  0.0027   21.6   3.0   18   85-102    70-87  (125)
204 PRK04542 elongation factor P;   21.1 1.4E+02  0.0031   22.5   3.5   40   63-102    47-89  (189)
205 TIGR00061 L21 ribosomal protei  21.1 2.8E+02   0.006   18.8   5.8   21   71-91     12-35  (101)
206 PF13533 Biotin_lipoyl_2:  Biot  21.0      68  0.0015   18.5   1.4    9   71-79     23-31  (50)
207 cd08247 AST1_like AST1 is a cy  21.0      91   0.002   24.1   2.5   25   48-80     65-89  (352)
208 COG0231 Efp Translation elonga  20.8 1.5E+02  0.0032   21.0   3.4   40   63-102    47-89  (131)
209 PF12791 RsgI_N:  Anti-sigma fa  20.7      94   0.002   18.2   2.0   12   71-82     25-36  (56)
210 PRK14578 elongation factor P;   20.7 1.4E+02  0.0031   22.4   3.5   40   63-102    47-89  (187)
211 PF13403 Hint_2:  Hint domain    20.7   2E+02  0.0043   20.4   4.1   34   62-95     11-44  (147)
212 PRK06033 hypothetical protein;  20.5 1.4E+02   0.003   19.4   2.9   25   71-95     27-53  (83)
213 COG0309 HypE Hydrogenase matur  20.4      71  0.0015   26.5   1.9   22   65-86    154-175 (339)
214 cd08243 quinone_oxidoreductase  20.2      85  0.0018   23.3   2.2   23   48-81     63-85  (320)
215 PF04943 Pox_F11:  Poxvirus F11  20.1 5.3E+02   0.012   21.7   8.0   86   11-99     82-173 (366)
216 PRK10334 mechanosensitive chan  20.1 1.3E+02  0.0028   23.9   3.2   18   71-88    129-146 (286)
217 cd08241 QOR1 Quinone oxidoredu  20.1      88  0.0019   23.0   2.2   25   48-81     64-88  (323)
218 TIGR02178 yeiP elongation fact  20.0 1.3E+02  0.0029   22.6   3.1   40   63-102    45-87  (186)

No 1  
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=9.4e-41  Score=226.81  Aligned_cols=96  Identities=44%  Similarity=0.785  Sum_probs=93.8

Q ss_pred             cceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCE
Q psy12951         14 QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQ   93 (111)
Q Consensus        14 ~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~   93 (111)
                      |+|+||+|||||++.++|++|+|||+||+++++|+++|+|+|||+|..+++|+.+|++||+||+|+|++|+|+++++||+
T Consensus         1 m~ikPL~DRVlVk~~e~EekT~gGIvlpdsakeK~~~g~VvAVG~G~~~~~g~~~~~~VkvGD~Vlf~ky~G~evk~dge   80 (96)
T COG0234           1 MKIKPLGDRVLVKRVEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRDENGELVPLDVKVGDRVLFGKYAGTEVKIDGE   80 (96)
T ss_pred             CCceecCCEEEEEEchhhccccCcEEecCccccCCcceEEEEEccceecCCCCEeccccccCCEEEECccCCcEEEECCE
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEecCcEEEEeec
Q psy12951         94 ELHLFKEADLLAVIEK  109 (111)
Q Consensus        94 ~y~iv~~~DIlavi~~  109 (111)
                      +|++++++||||++++
T Consensus        81 eylil~e~DILAiv~~   96 (96)
T COG0234          81 EYLILSESDILAIVEK   96 (96)
T ss_pred             EEEEechHHeeEEecC
Confidence            9999999999999874


No 2  
>PRK00364 groES co-chaperonin GroES; Reviewed
Probab=100.00  E-value=1.1e-38  Score=216.71  Aligned_cols=95  Identities=43%  Similarity=0.773  Sum_probs=92.5

Q ss_pred             cceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCE
Q psy12951         14 QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQ   93 (111)
Q Consensus        14 ~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~   93 (111)
                      ++|+||+|||||++.+++++|+|||+||+++++++++|+|+|||||+.+++|++.|++||+||+|+|++|+|++|+++++
T Consensus         1 ~~i~Pl~drVLV~~~~~e~~T~gGI~Lp~~a~~k~~~G~VvaVG~G~~~~~G~~~~~~vk~GD~Vlf~~~~g~ev~~~~~   80 (95)
T PRK00364          1 MNLKPLGDRVLVKRLEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRLDNGERVPLDVKVGDKVLFGKYAGTEVKIDGE   80 (95)
T ss_pred             CcceEcCCEEEEEEcccCccccceEEcCccccCCcceEEEEEECCCeECCCCCEeecccCCCCEEEEcCCCCeEEEECCE
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEecCcEEEEee
Q psy12951         94 ELHLFKEADLLAVIE  108 (111)
Q Consensus        94 ~y~iv~~~DIlavi~  108 (111)
                      +|+|+|++||||+++
T Consensus        81 ~y~iv~~~DIlavi~   95 (95)
T PRK00364         81 EYLILRESDILAIVE   95 (95)
T ss_pred             EEEEEEHHHEEEEeC
Confidence            999999999999985


No 3  
>PTZ00414 10 kDa heat shock protein; Provisional
Probab=100.00  E-value=1e-37  Score=214.14  Aligned_cols=93  Identities=44%  Similarity=0.759  Sum_probs=88.1

Q ss_pred             hcccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEE
Q psy12951         11 TLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEV   90 (111)
Q Consensus        11 ~~~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~   90 (111)
                      .++++|+||+|||||++.++|++|+|||+||+++++|+++|+|+|||+|..+     .|++||+||+|+|++|+|++|++
T Consensus         7 ~~~~~ikPL~dRVLVk~~~~e~kT~gGIiLP~sakekp~~g~VvAVG~G~~~-----~~~~Vk~GD~Vl~~~y~Gtevk~   81 (100)
T PTZ00414          7 PALKKLQPLGQRVLVKRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKD-----WTPTVKVGDTVLLPEFGGSSVKV   81 (100)
T ss_pred             cccccceecCCEEEEEEcccccccccCEEcccccccCCceeEEEEECCCCcc-----ccceecCCCEEEEcCCCCcEEEE
Confidence            5578899999999999999999999999999999999999999999999753     48899999999999999999999


Q ss_pred             CCEEEEEEecCcEEEEee
Q psy12951         91 EGQELHLFKEADLLAVIE  108 (111)
Q Consensus        91 ~g~~y~iv~~~DIlavi~  108 (111)
                      +|++|++++++||||+++
T Consensus        82 dg~ey~i~~e~DILavi~   99 (100)
T PTZ00414         82 EGEEFFLYNEDSLLGVLQ   99 (100)
T ss_pred             CCEEEEEEEhHHEEEEec
Confidence            999999999999999986


No 4  
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts. It forms heptameric rings with a dome-like structure, forming a lid to the large cavity of the tetradecameric cpn60 cylinder and thereby tightly regulating release and binding of proteins to the cpn60 surface.
Probab=100.00  E-value=2.5e-37  Score=209.31  Aligned_cols=93  Identities=48%  Similarity=0.852  Sum_probs=90.9

Q ss_pred             ceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCEE
Q psy12951         15 KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQE   94 (111)
Q Consensus        15 ~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~~   94 (111)
                      +|+||+|||||++.++|++|+|||+||+++++++++|+|+|||||+.+++|++.|++|++||+|+|++|+|++|+++|++
T Consensus         1 ~i~Pl~DrVLV~~~~~e~~T~~GI~Lp~~~~~k~~~g~VvAVG~g~~~~~g~~~~~~vk~GD~Vl~~~~~g~~v~~~~~~   80 (93)
T cd00320           1 KIKPLGDRVLVKRIEAEEKTKGGIILPDSAKEKPQEGKVVAVGPGRRNENGERVPLSVKVGDKVLFPKYAGTEVKLDGEE   80 (93)
T ss_pred             CceecCCEEEEEEccccceecceEEeCCCcCCCceEEEEEEECCCeECCCCCCccccccCCCEEEECCCCceEEEECCEE
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCcEEEEe
Q psy12951         95 LHLFKEADLLAVI  107 (111)
Q Consensus        95 y~iv~~~DIlavi  107 (111)
                      |+|+|++||||++
T Consensus        81 y~i~~~~DIla~i   93 (93)
T cd00320          81 YLILRESDILAVI   93 (93)
T ss_pred             EEEEEHHHEEEEC
Confidence            9999999999985


No 5  
>PRK14533 groES co-chaperonin GroES; Provisional
Probab=100.00  E-value=7e-37  Score=206.89  Aligned_cols=91  Identities=34%  Similarity=0.536  Sum_probs=86.2

Q ss_pred             cceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCE
Q psy12951         14 QKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQ   93 (111)
Q Consensus        14 ~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~   93 (111)
                      ++|+||+|||||++.+++++|+|||+||+++++|++.|+|+|||+|..     ..|++||+||+|+|++|+|++|+++|+
T Consensus         1 ~~i~Pl~DRVLVk~~~~e~~T~gGI~Lp~~a~ek~~~G~VvavG~g~~-----~~~~~Vk~GD~Vl~~~y~g~ev~~~~~   75 (91)
T PRK14533          1 MKVIPLGERLLIKPIKEEKKTEGGIVLPDSAKEKPMKAEVVAVGKLDD-----EEDFDIKVGDKVIFSKYAGTEIKIDDE   75 (91)
T ss_pred             CCceEcCCEEEEEEccccceecccEEecccccCCcceEEEEEECCCCc-----cccccccCCCEEEEccCCCeEEEECCE
Confidence            479999999999999999999999999999999999999999999852     458899999999999999999999999


Q ss_pred             EEEEEecCcEEEEeec
Q psy12951         94 ELHLFKEADLLAVIEK  109 (111)
Q Consensus        94 ~y~iv~~~DIlavi~~  109 (111)
                      +|++++++||||++++
T Consensus        76 ~y~iv~e~DILa~i~~   91 (91)
T PRK14533         76 DYIIIDVNDILAKIEE   91 (91)
T ss_pred             EEEEEEhHhEEEEeeC
Confidence            9999999999999985


No 6  
>PF00166 Cpn10:  Chaperonin 10 Kd subunit;  InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins []. These are required for normal cell growth [], and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10) [].  The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits []. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner []. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60.  Escherichia coli GroES has also been shown to bind ATP cooperatively, and with an affinity comparable to that of GroEL []. Each GroEL subunit contains three structurally distinct domains: an apical, an intermediate and an equatorial domain. The apical domain contains the binding sites for both GroES and the unfolded protein substrate. The equatorial domain contains the ATP-binding site and most of the oligomeric contacts. The intermediate domain links the apical and equatorial domains and transfers allosteric information between them. The GroEL oligomer is a tetradecamer, cylindrically shaped, that is organised in two heptameric rings stacked back to back. Each GroEL ring contains a central cavity, known as the `Anfinsen cage', that provides an isolated environment for protein folding. The identical 10 kDa subunits of GroES form a dome-like heptameric oligomer in solution. ATP binding to GroES may be important in charging the seven subunits of the interacting GroEL ring with ATP, to facilitate cooperative ATP binding and hydrolysis for substrate protein release.; GO: 0006457 protein folding, 0005737 cytoplasm; PDB: 1PF9_Q 1AON_P 1SX4_T 1SVT_R 2C7D_P 1PCQ_O 2C7C_Q 1GRU_Q 1WNR_F 1P3H_I ....
Probab=100.00  E-value=2.5e-35  Score=198.97  Aligned_cols=93  Identities=47%  Similarity=0.772  Sum_probs=87.7

Q ss_pred             ceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCEE
Q psy12951         15 KFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQE   94 (111)
Q Consensus        15 ~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~~   94 (111)
                      +|+||+|||||++.+.+++|+|||+||+++++++++|+|||||+|+.+.+|+..|+.|++||+|+|++|+|++++++|++
T Consensus         1 ki~Pl~drVLV~~~~~e~~T~~GiiLp~~~~~~~~~G~VvaVG~G~~~~~g~~~~~~vk~GD~Vl~~~~~g~~v~~~~~~   80 (93)
T PF00166_consen    1 KIKPLGDRVLVKKIEAEEKTASGIILPESAKEKPNQGKVVAVGPGRYNENGEEVPMDVKVGDKVLFPKYAGTEVKFDGEK   80 (93)
T ss_dssp             EEEESTTEEEEEECSCTCTCTTSCCE-CCSSSSEEEEEEEEE-SEEETTTSSEEETSS-TTSEEEEETTTSEEEEETTEE
T ss_pred             CceecCCEEEEEEccccceecceEEeccccccccceeEEEEcCCccccCCCcEeeeeeeeccEEeccccCceEEEECCEE
Confidence            58999999999999999999999999998889999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCcEEEEe
Q psy12951         95 LHLFKEADLLAVI  107 (111)
Q Consensus        95 y~iv~~~DIlavi  107 (111)
                      |+++|++||||++
T Consensus        81 ~~~~~~~dIlavi   93 (93)
T PF00166_consen   81 YLIVREDDILAVI   93 (93)
T ss_dssp             EEEEEGGGEEEEE
T ss_pred             EEEEEHHHeEEEC
Confidence            9999999999986


No 7  
>KOG1641|consensus
Probab=99.98  E-value=3.9e-33  Score=191.10  Aligned_cols=97  Identities=48%  Similarity=0.783  Sum_probs=92.5

Q ss_pred             hcccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEE
Q psy12951         11 TLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEV   90 (111)
Q Consensus        11 ~~~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~   90 (111)
                      ..++++.|+.|||||++.+++++|+|||+||+++++|.++|+|+|||||..+..|+.+|..|++||+|||++|+|++|++
T Consensus         6 ~~~kk~vPl~DRVLVqr~~a~~KT~gGilLPEks~~K~~~g~VvavGpG~~~~~G~~v~~~Vk~Gd~VLlpeygGt~V~l   85 (104)
T KOG1641|consen    6 WEIKKVVPLLDRVLVQRIEAPTKTAGGILLPEKSVGKLLQGTVVAVGPGSRDKGGEIVPVSVKVGDRVLLPEYGGTKVKL   85 (104)
T ss_pred             hhhhhhccccceeeeeeeeccccccceeEeccccccccceEEEEEEcCccccCCCCCcCccccCCCEEEeeccCCcEEec
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CC-EEEEEEecCcEEEEe
Q psy12951         91 EG-QELHLFKEADLLAVI  107 (111)
Q Consensus        91 ~g-~~y~iv~~~DIlavi  107 (111)
                      ++ ++|+++|.+|+|+.+
T Consensus        86 ~~~~~~~~fr~e~~l~~~  103 (104)
T KOG1641|consen   86 GDEDEYHLFRDEDDLLAI  103 (104)
T ss_pred             cCCceeEEecchhhhhhh
Confidence            85 699999999998865


No 8  
>KOG1197|consensus
Probab=91.95  E-value=0.13  Score=41.65  Aligned_cols=41  Identities=34%  Similarity=0.460  Sum_probs=29.0

Q ss_pred             cceEE-eccCc--cccceeeEEEEecCceeCCCCeeecceeeeCCEEEccC-CC
Q psy12951         35 KGGVL-IPEKA--QQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK-FG   84 (111)
Q Consensus        35 ~gGIi-LP~~~--~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~-y~   84 (111)
                      ..||| .|+.-  -.+.-.|+|+|||.|..         +.++||+|.|-. |+
T Consensus        55 RkGlY~~~plPytpGmEaaGvVvAvG~gvt---------drkvGDrVayl~~~g   99 (336)
T KOG1197|consen   55 RKGLYDPAPLPYTPGMEAAGVVVAVGEGVT---------DRKVGDRVAYLNPFG   99 (336)
T ss_pred             hccccCCCCCCcCCCcccceEEEEecCCcc---------ccccccEEEEeccch
Confidence            34677 33321  23567899999999986         579999999855 44


No 9  
>PF08240 ADH_N:  Alcohol dehydrogenase GroES-like domain;  InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1.1.1.1 from EC). Many of them contain an inserted zinc binding domain. This domain has a GroES-like structure; a name derived from the superfamily of proteins with a GroES fold. Proteins with a GroES fold structure have a highly conserved hydrophobic core and a glycyl-aspartate dipeptide which is thought to maintain the fold [, ].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1YKF_D 2NVB_A 3FSR_D 1BXZ_B 3FTN_A 3MEQ_D 3UOG_B 3HZZ_B 4DVJ_A 1P0F_A ....
Probab=90.27  E-value=0.17  Score=33.60  Aligned_cols=26  Identities=46%  Similarity=0.714  Sum_probs=21.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|....
T Consensus        38 E~~G~V~~vG~~v~---------~~~~Gd~V~~~~   63 (109)
T PF08240_consen   38 EGVGVVVAVGPGVT---------DFKVGDRVVVSP   63 (109)
T ss_dssp             EEEEEEEEESTTTT---------SSGTT-EEEEES
T ss_pred             ceeeeeeeeccccc---------cccccceeeeec
Confidence            57899999999875         489999999854


No 10 
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]
Probab=89.81  E-value=0.22  Score=41.26  Aligned_cols=53  Identities=32%  Similarity=0.374  Sum_probs=35.5

Q ss_pred             eeCCeEEEEecCC-----CCcccceEEeccCc---cccceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         18 PLLDRILVIKDEP-----LTKTKGGVLIPEKA---QQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        18 PlgDrVLVk~~~~-----e~~T~gGIiLP~~~---~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      |--|-|||+....     .-.+-+|.+ |+.-   -.-.-.|+|.+||+|..         +||+||+|+.
T Consensus        25 P~~gEVlVri~AtGVCHTD~~~~~G~~-p~~~P~vLGHEgAGiVe~VG~gVt---------~vkpGDhVI~   85 (366)
T COG1062          25 PRAGEVLVRITATGVCHTDAHTLSGDD-PEGFPAVLGHEGAGIVEAVGEGVT---------SVKPGDHVIL   85 (366)
T ss_pred             CCCCeEEEEEEEeeccccchhhhcCCC-CCCCceecccccccEEEEecCCcc---------ccCCCCEEEE
Confidence            7788899988622     223333332 2221   12356799999999987         7999999985


No 11 
>COG4384 Mu-like prophage protein gp45 [Function unknown]
Probab=84.66  E-value=2.8  Score=32.14  Aligned_cols=40  Identities=23%  Similarity=0.372  Sum_probs=29.1

Q ss_pred             CCCeeecceeeeCCEEEccCCC-------ceEEEECCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFG-------GTKIEVEGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~-------g~~v~~~g~~y~iv~~~D  102 (111)
                      .++...|+.++.||+++|..++       |..++.+-+.|.+....+
T Consensus        87 ~~~syR~~GL~aGeT~iY~~eG~~i~Lteg~~Ie~~ck~~~v~a~~~  133 (203)
T COG4384          87 QHGSYRITGLKAGETVIYNHEGAKIVLTEGGIIEADCKTLTVNAATG  133 (203)
T ss_pred             cCCccccccccCCceEEEeccCcEEEEccCcEEEEeccEEEEecCCc
Confidence            4566678899999999999876       345666667777555444


No 12 
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=83.06  E-value=1.3  Score=35.37  Aligned_cols=71  Identities=28%  Similarity=0.337  Sum_probs=43.2

Q ss_pred             eeCCeEEEEecCC-----CCcccceEE-----eccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccC-CCce
Q psy12951         18 PLLDRILVIKDEP-----LTKTKGGVL-----IPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK-FGGT   86 (111)
Q Consensus        18 PlgDrVLVk~~~~-----e~~T~gGIi-----LP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~-y~g~   86 (111)
                      |--+.|||+....     +.....|-.     +|- .-..-..|+|+++|++..         ..++||+|.+.. ..  
T Consensus        25 p~~geVlVrV~a~gvN~~D~~~r~G~~~~~~~~P~-i~G~d~aG~V~avG~~V~---------~~~~GdrV~~~~~~~--   92 (326)
T COG0604          25 PGPGEVLVRVKAAGVNPIDVLVRQGLAPPVRPLPF-IPGSEAAGVVVAVGSGVT---------GFKVGDRVAALGGVG--   92 (326)
T ss_pred             CCCCeEEEEEEEeecChHHHHhccCCCCCCCCCCC-cccceeEEEEEEeCCCCC---------CcCCCCEEEEccCCC--
Confidence            6668899998732     222333321     122 123357899999999876         348999999984 21  


Q ss_pred             EEEECC--EEEEEEecCcE
Q psy12951         87 KIEVEG--QELHLFKEADL  103 (111)
Q Consensus        87 ~v~~~g--~~y~iv~~~DI  103 (111)
                         .+|  -+|..+.++.+
T Consensus        93 ---~~G~~AEy~~v~a~~~  108 (326)
T COG0604          93 ---RDGGYAEYVVVPADWL  108 (326)
T ss_pred             ---CCCcceeEEEecHHHc
Confidence               112  36666665433


No 13 
>COG1329 Transcriptional regulators, similar to M. xanthus CarD [Transcription]
Probab=82.93  E-value=1.4  Score=32.97  Aligned_cols=38  Identities=26%  Similarity=0.529  Sum_probs=25.7

Q ss_pred             ceeeeCCEEEccCCCceEE------EECC--EEEEEEe--cCcEEEEe
Q psy12951         70 PVVNVGDKVLLPKFGGTKI------EVEG--QELHLFK--EADLLAVI  107 (111)
Q Consensus        70 ~~vk~GD~Vl~~~y~g~~v------~~~g--~~y~iv~--~~DIlavi  107 (111)
                      +.+++||+|+||.|+.-.|      ++.|  .+|+++.  .+|....+
T Consensus         3 ~~Fk~Gd~VVYP~HGvG~I~~Ieeke~~Ge~~~yyVI~f~~~dm~v~V   50 (166)
T COG1329           3 MAFKIGDHVVYPAHGVGIIQAIEEKEIAGETLEYYVIDFPQSDMTVMV   50 (166)
T ss_pred             ccccCCCEEEecCCCceeeehhhhHhhcCceeEEEEEEEcCCCcEEEe
Confidence            4689999999999984333      3455  4777765  44555444


No 14 
>KOG0025|consensus
Probab=81.79  E-value=3  Score=34.38  Aligned_cols=72  Identities=26%  Similarity=0.216  Sum_probs=43.0

Q ss_pred             eeCCeEEEEecCCCCcc-----cceEEe--ccC--ccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCC-ceE
Q psy12951         18 PLLDRILVIKDEPLTKT-----KGGVLI--PEK--AQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG-GTK   87 (111)
Q Consensus        18 PlgDrVLVk~~~~e~~T-----~gGIiL--P~~--~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~-g~~   87 (111)
                      |..| |+|+-+.+.-..     --|.|=  |+-  .......|+||+||++..         .+|+||+|+-..-+ |+.
T Consensus        46 ~~s~-v~Vk~LAaPINPsDIN~IQGvYpvrP~~PAVgGnEGv~eVv~vGs~vk---------gfk~Gd~VIp~~a~lGtW  115 (354)
T KOG0025|consen   46 PGSD-VLVKMLAAPINPSDINQIQGVYPVRPELPAVGGNEGVGEVVAVGSNVK---------GFKPGDWVIPLSANLGTW  115 (354)
T ss_pred             CCCc-eeeeeeecCCChHHhhhhccccCCCCCCCcccCCcceEEEEEecCCcC---------ccCCCCeEeecCCCCccc
Confidence            5666 888887554222     235441  221  123467899999998654         48999999966533 533


Q ss_pred             ---EEECCEEEEEEe
Q psy12951         88 ---IEVEGQELHLFK   99 (111)
Q Consensus        88 ---v~~~g~~y~iv~   99 (111)
                         ..+++.+++-+.
T Consensus       116 ~t~~v~~e~~Li~vd  130 (354)
T KOG0025|consen  116 RTEAVFSESDLIKVD  130 (354)
T ss_pred             eeeEeecccceEEcC
Confidence               344544444443


No 15 
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent. Members of this family represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols, a family that also includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this protein family have a tightly bound NAD that can act as a true cofactor, rather than a cosubstrate in dehydrogenase reactions, in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent.
Probab=79.43  E-value=1.6  Score=35.52  Aligned_cols=25  Identities=24%  Similarity=0.434  Sum_probs=21.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|.+.
T Consensus        68 E~~G~V~~vG~~V~---------~~~vGdrV~~~   92 (393)
T TIGR02819        68 EITGEVIEKGRDVE---------FIKIGDIVSVP   92 (393)
T ss_pred             eeEEEEEEEcCccc---------cccCCCEEEEe
Confidence            46899999999865         58999999774


No 16 
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=78.41  E-value=2  Score=32.77  Aligned_cols=30  Identities=23%  Similarity=0.312  Sum_probs=21.3

Q ss_pred             eeeEEEEecCceeC-CCCeeecceeeeCCEEEccC
Q psy12951         49 NNAVVVAVGPGART-PNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        49 ~~G~VvaVG~G~~~-~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ..|+|+++|++... ..|.    .+++||+|....
T Consensus         6 ~~G~V~~vG~~v~~~~~~~----~~~~GdrV~~~~   36 (280)
T TIGR03366         6 IVGEVVALRGGFTPADDGV----PLRLGQRVVWSV   36 (280)
T ss_pred             cceEEEEeCCCccccccCC----CCCCCCEEEEcC
Confidence            57999999998741 1121    478999998754


No 17 
>PF06890 Phage_Mu_Gp45:  Bacteriophage Mu Gp45 protein;  InterPro: IPR014462 This entry is represented by the Bacteriophage Mu, Gp45. The characteristics of the protein distribution suggest prophage matches.
Probab=78.01  E-value=10  Score=28.04  Aligned_cols=40  Identities=23%  Similarity=0.265  Sum_probs=26.7

Q ss_pred             eEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCC
Q psy12951         37 GVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG   84 (111)
Q Consensus        37 GIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~   84 (111)
                      +|+||-.  .+...|.|+++..++      ..|-.++.|+.++|.+++
T Consensus        48 ~vvl~lG--G~rs~~Vvia~~d~~------yR~~~L~~GEvalY~~~G   87 (162)
T PF06890_consen   48 AVVLFLG--GDRSHGVVIAVEDRR------YRPKGLKPGEVALYDDEG   87 (162)
T ss_pred             EEEEEec--cCCcceEEEEeCCcc------ccccCCCCCcEEEEcCCC
Confidence            4555542  345677778777544      344468999999999764


No 18 
>KOG0022|consensus
Probab=77.15  E-value=1.9  Score=35.86  Aligned_cols=53  Identities=23%  Similarity=0.245  Sum_probs=33.7

Q ss_pred             eeeCCeEEEEec-----CCCCcccceEEeccCcc----ccceeeEEEEecCceeCCCCeeecceeeeCCEEE
Q psy12951         17 RPLLDRILVIKD-----EPLTKTKGGVLIPEKAQ----QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVL   79 (111)
Q Consensus        17 ~PlgDrVLVk~~-----~~e~~T~gGIiLP~~~~----~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl   79 (111)
                      .|-...|.||-+     -....+=+|-- |+..-    ...-.|+|.+||+|..         .+++||+|+
T Consensus        29 pPka~EVRIKI~~t~vCHTD~~~~~g~~-~~~~fP~IlGHEaaGIVESvGegV~---------~vk~GD~Vi   90 (375)
T KOG0022|consen   29 PPKAHEVRIKILATGVCHTDAYVWSGKD-PEGLFPVILGHEAAGIVESVGEGVT---------TVKPGDHVI   90 (375)
T ss_pred             CCCCceEEEEEEEEeeccccceeecCCC-ccccCceEecccceeEEEEecCCcc---------ccCCCCEEe
Confidence            377777777765     22222323322 33221    1246799999999886         699999998


No 19 
>PF08140 Cuticle_1:  Crustacean cuticle protein repeat;  InterPro: IPR012539 This family consists of the cuticle proteins from the Cancer pagurus (Rock crab) and the Homarus americanus (American lobster). These proteins are isolated from the calcified regions of the crustacean and they contain two copies of an 18 residue sequence motif, which thus far has been found only in crustacean calcified exoskeletons [].; GO: 0042302 structural constituent of cuticle
Probab=75.87  E-value=4.8  Score=23.40  Aligned_cols=26  Identities=23%  Similarity=0.570  Sum_probs=17.4

Q ss_pred             cceEEeccCccccc--eeeEEEEecCce
Q psy12951         35 KGGVLIPEKAQQEV--NNAVVVAVGPGA   60 (111)
Q Consensus        35 ~gGIiLP~~~~~k~--~~G~VvaVG~G~   60 (111)
                      .|||+.|+......  -.+.|+.+||.-
T Consensus         2 ~SGii~~dG~~~q~~~~~a~ivl~GpSG   29 (40)
T PF08140_consen    2 PSGIITPDGTNVQFPHGVANIVLIGPSG   29 (40)
T ss_pred             CCceECCCCCEEECCcccceEEEECCce
Confidence            48999999754332  223789999743


No 20 
>PF02559 CarD_CdnL_TRCF:  CarD-like/TRCF domain;  InterPro: IPR003711 The bacterium Myxococcus xanthus responds to blue light by producing carotenoids. It also responds to starvation conditions by developing fruiting bodies, where the cells differentiate into myxospores. Each response entails the transcriptional activation of a separate set of genes. A single gene, carD, is required for the activation of both light- and starvation-inducible genes []. The predicted protein contains four repeats of a DNA-binding domain present in mammalian high mobility group I(Y) proteins and other nuclear proteins from animals and plants. Other peptide stretches on CarD also resemble functional domains typical of eukaryotic transcription factors, including a very acidic region and a leucine zipper. High mobility group yI(Y) proteins are known to bind the minor groove of A+T-rich DNA [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3MLQ_H 2EYQ_A.
Probab=75.10  E-value=4.7  Score=26.49  Aligned_cols=29  Identities=34%  Similarity=0.554  Sum_probs=19.0

Q ss_pred             eeeCCEEEccCCCce------EEEECC--EEEEEEec
Q psy12951         72 VNVGDKVLLPKFGGT------KIEVEG--QELHLFKE  100 (111)
Q Consensus        72 vk~GD~Vl~~~y~g~------~v~~~g--~~y~iv~~  100 (111)
                      +++||.|+++.++-.      +.++.|  .+|+++..
T Consensus         2 f~~GD~VVh~~~Gv~~i~~i~~~~~~~~~~~yy~L~~   38 (98)
T PF02559_consen    2 FKIGDYVVHPNHGVGRIEGIEEIEFGGEKQEYYVLEY   38 (98)
T ss_dssp             --TTSEEEETTTEEEEEEEEEEEECTTEEEEEEEEEE
T ss_pred             CCCCCEEEECCCceEEEEEEEEEeeCCeeEEEEEEEE
Confidence            579999999999842      234444  47777754


No 21 
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=74.83  E-value=2.2  Score=35.01  Aligned_cols=26  Identities=35%  Similarity=0.428  Sum_probs=22.3

Q ss_pred             ccceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         46 QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        46 ~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      .-...|+|++||++..         .+|+||+|-.
T Consensus        62 GHEivG~V~~vG~~V~---------~~k~GDrVgV   87 (339)
T COG1064          62 GHEIVGTVVEVGEGVT---------GLKVGDRVGV   87 (339)
T ss_pred             CcceEEEEEEecCCCc---------cCCCCCEEEe
Confidence            4468899999999876         5899999988


No 22 
>cd08230 glucose_DH Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contai
Probab=73.55  E-value=2.5  Score=33.16  Aligned_cols=24  Identities=33%  Similarity=0.358  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++ .         .+++||+|+..
T Consensus        64 e~~G~V~~vG~~-~---------~~~vGdrV~~~   87 (355)
T cd08230          64 EALGVVEEVGDG-S---------GLSPGDLVVPT   87 (355)
T ss_pred             ccceEEEEecCC-C---------CCCCCCEEEec
Confidence            467999999986 4         47899999864


No 23 
>COG1465 Predicted alternative 3-dehydroquinate synthase [Amino acid transport and metabolism]
Probab=70.68  E-value=20  Score=29.65  Aligned_cols=86  Identities=24%  Similarity=0.329  Sum_probs=50.6

Q ss_pred             cccceeee--CCeEEEEecCC----C----CcccceEEec--cCccc--------cceeeEEEEecCceeC-CCCeeecc
Q psy12951         12 LSQKFRPL--LDRILVIKDEP----L----TKTKGGVLIP--EKAQQ--------EVNNAVVVAVGPGART-PNGEYIKP   70 (111)
Q Consensus        12 ~~~~i~Pl--gDrVLVk~~~~----e----~~T~gGIiLP--~~~~~--------k~~~G~VvaVG~G~~~-~~G~~~p~   70 (111)
                      .+..+.|+  ||||-|--+.-    |    -.+++|++|=  ++.++        +.|.|-|-|-=   +. .++++--.
T Consensus       203 ~vt~ieplG~gDRVCVDTcsLm~~gEGMLVGs~s~gmFlVhsEs~espYVAaRPFRVNAG~VhaYi---~vPg~kTkYLa  279 (376)
T COG1465         203 TVTEIEPLGSGDRVCVDTCSLMTRGEGMLVGSQSRGMFLVHSESEESPYVAARPFRVNAGAVHAYI---RVPGGKTKYLA  279 (376)
T ss_pred             EEEEEeecCCCceEEEeeecccccCCceEeecccCcEEEEecccccCcccccCceeecccceeEEE---EcCCCceEEhh
Confidence            45778887  59999887632    2    2356788773  33222        13445444321   11 12222233


Q ss_pred             eeeeCCEEEccCCCceE-------EEECCEEEEEEec
Q psy12951         71 VVNVGDKVLLPKFGGTK-------IEVEGQELHLFKE  100 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~-------v~~~g~~y~iv~~  100 (111)
                      .++.||.|+.-+|.|..       ++++...+++++.
T Consensus       280 EL~aGDeV~iVD~dGr~R~aiVGRvKIErRPl~lIeA  316 (376)
T COG1465         280 ELKAGDEVLIVDFDGRTRSAIVGRVKIERRPLMLIEA  316 (376)
T ss_pred             hhcCCCeEEEEecCCceeEEEEEEEEeecCceEEEEE
Confidence            89999999999999832       4666666666653


No 24 
>PLN02586 probable cinnamyl alcohol dehydrogenase
Probab=70.61  E-value=3.5  Score=32.79  Aligned_cols=24  Identities=21%  Similarity=0.318  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|.+
T Consensus        73 E~~G~V~~vG~~v~---------~~~vGdrV~~   96 (360)
T PLN02586         73 EIVGIVTKLGKNVK---------KFKEGDRVGV   96 (360)
T ss_pred             ceeEEEEEECCCCC---------ccCCCCEEEE
Confidence            46799999998764         4789999974


No 25 
>KOG0024|consensus
Probab=67.74  E-value=2.1  Score=35.49  Aligned_cols=54  Identities=22%  Similarity=0.234  Sum_probs=36.6

Q ss_pred             CCeEEEEec-------CCCCcccceEEeccCc----cccceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         20 LDRILVIKD-------EPLTKTKGGVLIPEKA----QQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        20 gDrVLVk~~-------~~e~~T~gGIiLP~~~----~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      -|-|||+..       +...-+.|+|-.+.-.    -.-...|+|..||++..         .+|+||+|....
T Consensus        29 p~eVlv~i~a~GICGSDvHy~~~G~ig~~v~k~PmvlGHEssGiV~evG~~Vk---------~LkVGDrVaiEp   93 (354)
T KOG0024|consen   29 PDEVLVAIKAVGICGSDVHYYTHGRIGDFVVKKPMVLGHESSGIVEEVGDEVK---------HLKVGDRVAIEP   93 (354)
T ss_pred             CCEEEEEeeeEEecCccchhhccCCcCccccccccccccccccchhhhccccc---------ccccCCeEEecC
Confidence            355676654       3345566666544311    13467899999999887         699999999854


No 26 
>PF10794 DUF2606:  Protein of unknown function (DUF2606);  InterPro: IPR019730 This entry represents bacterial proteins with unknown function. 
Probab=67.52  E-value=31  Score=24.76  Aligned_cols=67  Identities=9%  Similarity=0.167  Sum_probs=48.7

Q ss_pred             CCeEEEEecCCCCcccceE--Ee---ccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEE
Q psy12951         20 LDRILVIKDEPLTKTKGGV--LI---PEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIE   89 (111)
Q Consensus        20 gDrVLVk~~~~e~~T~gGI--iL---P~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~   89 (111)
                      .+-|-....+++.+..-|+  .|   |++ ...|+.-..+.+|  +.+.+|+.++-.++.|+..+|-+-+++.+.
T Consensus        41 ~~pVT~hVen~e~~pi~~~ev~lmKa~ds-~~qPs~eig~~IG--KTD~~Gki~Wk~~~kG~Y~v~l~n~e~~~~  112 (131)
T PF10794_consen   41 VNPVTFHVENAEGQPIKDFEVTLMKAADS-DPQPSKEIGISIG--KTDEEGKIIWKNGRKGKYIVFLPNGETQET  112 (131)
T ss_pred             cccEEEEEecCCCCcccceEEEEEecccc-CCCCchhhceeec--ccCCCCcEEEecCCcceEEEEEcCCCceeE
Confidence            3445666677777777774  33   343 3457777777777  567899999999999999999888876654


No 27 
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  Class III ADH are also know as glutathione-dependent formaldehyde dehyd
Probab=66.57  E-value=4.5  Score=32.04  Aligned_cols=24  Identities=46%  Similarity=0.674  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        68 E~~G~V~~vG~~v~---------~~~~GdrV~~   91 (371)
T cd08281          68 EAAGVVVEVGEGVT---------DLEVGDHVVL   91 (371)
T ss_pred             cceeEEEEeCCCCC---------cCCCCCEEEE
Confidence            46799999998764         4789999985


No 28 
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized.
Probab=66.47  E-value=5  Score=31.45  Aligned_cols=25  Identities=28%  Similarity=0.251  Sum_probs=20.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        63 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   87 (329)
T TIGR02822        63 EVVGEVAGRGADAG---------GFAVGDRVGIA   87 (329)
T ss_pred             ceEEEEEEECCCCc---------ccCCCCEEEEc
Confidence            46899999998764         47899999753


No 29 
>PF12508 DUF3714:  Protein of unknown function (DUF3714) ;  InterPro: IPR022187  Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. 
Probab=66.34  E-value=17  Score=27.79  Aligned_cols=39  Identities=18%  Similarity=0.060  Sum_probs=30.1

Q ss_pred             eeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCceeC
Q psy12951         18 PLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGART   62 (111)
Q Consensus        18 PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~   62 (111)
                      --|.||=++..  |..+.+|++||...   +..| +..++..+..
T Consensus        66 ~~Gs~vrlRLl--e~i~i~g~~IPkgt---~l~G-~~~~~~~Rl~  104 (200)
T PF12508_consen   66 VDGSRVRLRLL--EDIQIGGILIPKGT---YLYG-VASFQGQRLL  104 (200)
T ss_pred             eCCCEEEEEEc--CceEECCEEeCCCC---EEEE-EEeeeccEEE
Confidence            46788888888  45677999999765   7888 8888877763


No 30 
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase,
Probab=66.15  E-value=12  Score=28.72  Aligned_cols=24  Identities=38%  Similarity=0.566  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (337)
T cd08261          60 ELSGEVVEVGEGVA---------GLKVGDRVVV   83 (337)
T ss_pred             ccEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46799999998653         4789999996


No 31 
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=66.11  E-value=4.9  Score=31.28  Aligned_cols=26  Identities=31%  Similarity=0.316  Sum_probs=20.7

Q ss_pred             cceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         47 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        47 k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ....|+|+++|++..         .+++||+|...
T Consensus        59 ~e~~G~V~~vG~~v~---------~~~vGd~V~~~   84 (347)
T PRK10309         59 HEFSGYVEAVGSGVD---------DLHPGDAVACV   84 (347)
T ss_pred             cceEEEEEEeCCCCC---------CCCCCCEEEEC
Confidence            356899999998754         47899999864


No 32 
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the
Probab=65.80  E-value=5.1  Score=31.58  Aligned_cols=25  Identities=32%  Similarity=0.438  Sum_probs=20.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        63 e~~G~V~~vG~~v~---------~~~~GdrV~~~   87 (369)
T cd08301          63 EAAGIVESVGEGVT---------DLKPGDHVLPV   87 (369)
T ss_pred             ccceEEEEeCCCCC---------ccccCCEEEEc
Confidence            45799999998764         58999999863


No 33 
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=65.73  E-value=11  Score=28.21  Aligned_cols=27  Identities=41%  Similarity=0.446  Sum_probs=20.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccCC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKF   83 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y   83 (111)
                      ...|+|+++|++..         ..++||+|+.-.+
T Consensus        58 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~~   84 (312)
T cd08269          58 EGWGRVVALGPGVR---------GLAVGDRVAGLSG   84 (312)
T ss_pred             eeEEEEEEECCCCc---------CCCCCCEEEEecC
Confidence            45799999998653         4689999997543


No 34 
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]
Probab=64.66  E-value=9.9  Score=29.41  Aligned_cols=36  Identities=25%  Similarity=0.344  Sum_probs=26.8

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEE-EECCEEEEEE
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKI-EVEGQELHLF   98 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v-~~~g~~y~iv   98 (111)
                      .+|+.+...++.||+++.+++-|--+ +..++.+.|+
T Consensus       121 ~~G~~~v~~~~~Gd~iyVPp~~gH~t~N~Gd~pLvf~  157 (209)
T COG2140         121 PEGEARVIAVRAGDVIYVPPGYGHYTINTGDEPLVFL  157 (209)
T ss_pred             CCCcEEEEEecCCcEEEeCCCcceEeecCCCCCEEEE
Confidence            56888888999999999999877444 4455555543


No 35 
>PLN02178 cinnamyl-alcohol dehydrogenase
Probab=64.48  E-value=5.4  Score=32.12  Aligned_cols=24  Identities=21%  Similarity=0.254  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|..
T Consensus        67 E~aG~Vv~vG~~v~---------~~~vGdrV~~   90 (375)
T PLN02178         67 EIVGIATKVGKNVT---------KFKEGDRVGV   90 (375)
T ss_pred             eeeEEEEEECCCCC---------ccCCCCEEEE
Confidence            46799999998764         4789999974


No 36 
>PLN02827 Alcohol dehydrogenase-like
Probab=64.00  E-value=5.3  Score=32.05  Aligned_cols=25  Identities=28%  Similarity=0.457  Sum_probs=20.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        70 E~~G~V~~vG~~v~---------~~~~GdrV~~~   94 (378)
T PLN02827         70 EASGIVESIGEGVT---------EFEKGDHVLTV   94 (378)
T ss_pred             cceEEEEEcCCCCc---------ccCCCCEEEEe
Confidence            46799999998764         47899999864


No 37 
>cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acid
Probab=63.09  E-value=6.2  Score=30.40  Aligned_cols=24  Identities=25%  Similarity=0.141  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|..
T Consensus        75 e~~G~V~~vG~~v~---------~~~~Gd~V~~   98 (345)
T cd08293          75 DGGGVGVVEESKHQ---------KFAVGDIVTS   98 (345)
T ss_pred             EeeEEEEEeccCCC---------CCCCCCEEEe
Confidence            46799999998763         4789999986


No 38 
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase.
Probab=62.47  E-value=6.1  Score=30.57  Aligned_cols=47  Identities=19%  Similarity=0.287  Sum_probs=28.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCc-eEE-EECC--EEEEEEecCcEE
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG-TKI-EVEG--QELHLFKEADLL  104 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g-~~v-~~~g--~~y~iv~~~DIl  104 (111)
                      ...|+|+++|++.          .+++||+|....... ... -..|  .+|++++++.++
T Consensus        65 E~~G~V~~vG~~v----------~~~vGdrV~~~~~~c~~~~~~~~G~~aey~~v~~~~~~  115 (308)
T TIGR01202        65 ESVGRVVEAGPDT----------GFRPGDRVFVPGSNCYEDVRGLFGGASKRLVTPASRVC  115 (308)
T ss_pred             eeEEEEEEecCCC----------CCCCCCEEEEeCccccccccccCCcccceEEcCHHHce
Confidence            4689999999863          268999998632100 000 0112  478888776543


No 39 
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall 
Probab=62.30  E-value=18  Score=28.49  Aligned_cols=25  Identities=32%  Similarity=0.602  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~Vv~~   84 (365)
T cd05279          60 EGAGIVESIGPGVT---------TLKPGDKVIPL   84 (365)
T ss_pred             ceeEEEEEeCCCcc---------cCCCCCEEEEc
Confidence            46799999997653         47899999864


No 40 
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones.  Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc at
Probab=62.02  E-value=7.2  Score=30.10  Aligned_cols=26  Identities=46%  Similarity=0.710  Sum_probs=20.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~   86 (339)
T cd08239          61 EPAGVVVAVGPGVT---------HFRVGDRVMVYH   86 (339)
T ss_pred             CceEEEEEECCCCc---------cCCCCCEEEECC
Confidence            46799999998764         478999998643


No 41 
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols.
Probab=62.00  E-value=6.5  Score=31.22  Aligned_cols=25  Identities=40%  Similarity=0.558  Sum_probs=20.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        62 E~~G~V~~vG~~v~---------~~~~GdrV~~~   86 (368)
T TIGR02818        62 EGAGIVEAVGEGVT---------SVKVGDHVIPL   86 (368)
T ss_pred             ccEEEEEEECCCCc---------cCCCCCEEEEc
Confidence            46799999998764         57899999864


No 42 
>PLN02740 Alcohol dehydrogenase-like
Probab=60.94  E-value=6.5  Score=31.38  Aligned_cols=25  Identities=28%  Similarity=0.445  Sum_probs=20.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        72 E~~G~V~~vG~~v~---------~~~vGdrV~~~   96 (381)
T PLN02740         72 EAAGIVESVGEGVE---------DLKAGDHVIPI   96 (381)
T ss_pred             cceEEEEEeCCCCC---------cCCCCCEEEec
Confidence            46799999998654         47899999864


No 43 
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dim
Probab=60.84  E-value=6.9  Score=30.95  Aligned_cols=25  Identities=32%  Similarity=0.472  Sum_probs=20.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        63 E~~G~V~~vG~~v~---------~~~vGdrV~~~   87 (368)
T cd08300          63 EGAGIVESVGEGVT---------SVKPGDHVIPL   87 (368)
T ss_pred             ceeEEEEEeCCCCc---------cCCCCCEEEEc
Confidence            46799999998764         47899999864


No 44 
>TIGR02227 sigpep_I_bact signal peptidase I, bacterial type. A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes.
Probab=60.58  E-value=39  Score=24.18  Aligned_cols=38  Identities=21%  Similarity=0.246  Sum_probs=21.1

Q ss_pred             eCCeEEEEecCC--CCcccceEEeccC--ccccceeeEEEEe
Q psy12951         19 LLDRILVIKDEP--LTKTKGGVLIPEK--AQQEVNNAVVVAV   56 (111)
Q Consensus        19 lgDrVLVk~~~~--e~~T~gGIiLP~~--~~~k~~~G~VvaV   56 (111)
                      -||+||+.+..-  .+-..|-|++=..  ...+...-+|+++
T Consensus        36 ~Gd~vlv~k~~~~~~~~~rGDiVvf~~~~~~~~~~iKRVig~   77 (163)
T TIGR02227        36 EGDRILVNKFAYGTSDPKRGDIVVFKDPDDNKNIYVKRVIGL   77 (163)
T ss_pred             CCCEEEEEEeEcCCCCCCCCcEEEEecCCCCCceeEEEEEec
Confidence            599999998632  2334566665221  1223445566655


No 45 
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=60.42  E-value=7.2  Score=30.68  Aligned_cols=24  Identities=46%  Similarity=0.530  Sum_probs=20.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|..
T Consensus        61 e~~G~V~~vG~~v~---------~~~~GdrV~~   84 (358)
T TIGR03451        61 EAAGVVEAVGEGVT---------DVAPGDYVVL   84 (358)
T ss_pred             ceEEEEEEeCCCCc---------ccCCCCEEEE
Confidence            46899999998764         4789999986


No 46 
>PLN02514 cinnamyl-alcohol dehydrogenase
Probab=60.16  E-value=7.5  Score=30.74  Aligned_cols=24  Identities=33%  Similarity=0.304  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|++
T Consensus        70 E~~G~Vv~vG~~v~---------~~~~Gd~V~~   93 (357)
T PLN02514         70 EVVGEVVEVGSDVS---------KFTVGDIVGV   93 (357)
T ss_pred             eeeEEEEEECCCcc---------cccCCCEEEE
Confidence            46799999998764         4789999975


No 47 
>TIGR03214 ura-cupin putative allantoin catabolism protein. This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis).
Probab=59.65  E-value=18  Score=28.15  Aligned_cols=49  Identities=18%  Similarity=0.368  Sum_probs=37.9

Q ss_pred             eeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECCE---EEEEEe
Q psy12951         49 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQ---ELHLFK   99 (111)
Q Consensus        49 ~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~---~y~iv~   99 (111)
                      ..+.-|=-|.|....||+..  .|+.||.+.++.|.=+.+..-|+   +|++.+
T Consensus       201 eh~~yiL~G~G~~~~~g~~~--~V~~GD~i~i~~~~~h~~~~~G~~~~~~l~yk  252 (260)
T TIGR03214       201 EHGLYVLEGKGVYNLDNNWV--PVEAGDYIWMGAYCPQACYAGGRGEFRYLLYK  252 (260)
T ss_pred             eeEEEEEeceEEEEECCEEE--EecCCCEEEECCCCCEEEEecCCCcEEEEEEc
Confidence            35667777888887788765  69999999999999888877542   666664


No 48 
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to  (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate).  The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the found
Probab=59.60  E-value=7.5  Score=31.45  Aligned_cols=26  Identities=12%  Similarity=0.203  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++...        .+++||+|...
T Consensus        69 E~~G~V~~vG~~v~~--------~~~vGdrV~~~   94 (410)
T cd08238          69 EFAGTILKVGKKWQG--------KYKPGQRFVIQ   94 (410)
T ss_pred             ccEEEEEEeCCCccC--------CCCCCCEEEEc
Confidence            357999999987531        27899999875


No 49 
>PRK10083 putative oxidoreductase; Provisional
Probab=59.35  E-value=8.4  Score=29.60  Aligned_cols=25  Identities=28%  Similarity=0.444  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   84 (339)
T PRK10083         60 EFFGVIDAVGEGVD---------AARIGERVAVD   84 (339)
T ss_pred             ceEEEEEEECCCCc---------cCCCCCEEEEc
Confidence            46799999998653         47899999853


No 50 
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase. NAD-linked ribitol-5-phosphate dehydrogenase, a member of the MDR/zinc-dependent alcohol dehydrogenase-like family, oxidizes the phosphate ester of ribitol-5-phosphate to xylulose-5-phosphate of the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (
Probab=58.88  E-value=20  Score=28.10  Aligned_cols=24  Identities=33%  Similarity=0.393  Sum_probs=18.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|.+           .+++||+|.+..
T Consensus        65 E~~G~V~~~g~~-----------~~~vGdrV~~~~   88 (341)
T cd08237          65 EGIGVVVSDPTG-----------TYKVGTKVVMVP   88 (341)
T ss_pred             eeEEEEEeeCCC-----------ccCCCCEEEECC
Confidence            468999998752           378999998754


No 51 
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (ty
Probab=57.73  E-value=11  Score=29.13  Aligned_cols=25  Identities=40%  Similarity=0.528  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+.+
T Consensus        61 e~~G~V~~~G~~~~---------~~~~Gd~V~~~   85 (345)
T cd08260          61 EFAGVVVEVGEDVS---------RWRVGDRVTVP   85 (345)
T ss_pred             ceeEEEEEECCCCc---------cCCCCCEEEEC
Confidence            46799999998653         47999999863


No 52 
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ i
Probab=56.70  E-value=9.1  Score=30.24  Aligned_cols=25  Identities=32%  Similarity=0.469  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~GdrV~~~   86 (365)
T cd08277          62 EGAGIVESVGEGVT---------NLKPGDKVIPL   86 (365)
T ss_pred             ceeEEEEeeCCCCc---------cCCCCCEEEEC
Confidence            46899999998764         47899999864


No 53 
>smart00696 DM9 Repeats found in Drosophila proteins.
Probab=56.52  E-value=29  Score=22.02  Aligned_cols=50  Identities=18%  Similarity=0.286  Sum_probs=39.0

Q ss_pred             eccCcc--ccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEEC
Q psy12951         40 IPEKAQ--QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVE   91 (111)
Q Consensus        40 LP~~~~--~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~   91 (111)
                      +|..|-  .....|..+-||-+..  +|.++|-.+-+.....|=.|.|.++.++
T Consensus        12 vP~~AV~~G~~~~G~~lYvgR~~~--~g~~~pGKv~p~~~~~yi~~~g~E~~~~   63 (71)
T smart00696       12 IPPNAVVGGTDSDGEPLYVGRAYY--EGSLLPGKVVPSHGCAYIPYGGQEVRLD   63 (71)
T ss_pred             CCCCcEEcccCCCCCEEEEEEEEE--CCcEEEEEEEccCCEEEEEECCEEEEcC
Confidence            476653  2345678888987766  7788888899999999999999999874


No 54 
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.
Probab=55.87  E-value=9  Score=29.78  Aligned_cols=24  Identities=42%  Similarity=0.632  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        71 e~~G~V~~vG~~v~---------~~~~Gd~V~~   94 (351)
T cd08233          71 EFSGVVVEVGSGVT---------GFKVGDRVVV   94 (351)
T ss_pred             cceEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46799999998653         4789999986


No 55 
>cd05278 FDH_like Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde.  This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typicall
Probab=55.11  E-value=11  Score=28.86  Aligned_cols=24  Identities=29%  Similarity=0.382  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~   84 (347)
T cd05278          61 EFVGEVVEVGSDVK---------RLKPGDRVSV   84 (347)
T ss_pred             ceEEEEEEECCCcc---------ccCCCCEEEe
Confidence            46799999998654         4789999986


No 56 
>TIGR00692 tdh L-threonine 3-dehydrogenase. E. coli His-90 modulates substrate specificity and is believed part of the active site.
Probab=54.84  E-value=11  Score=29.21  Aligned_cols=25  Identities=36%  Similarity=0.557  Sum_probs=20.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   86 (340)
T TIGR00692        62 EVAGEVVGIGPGVE---------GIKVGDYVSVE   86 (340)
T ss_pred             ceEEEEEEECCCCC---------cCCCCCEEEEC
Confidence            46899999998653         47899999874


No 57 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model.
Probab=54.69  E-value=11  Score=28.77  Aligned_cols=25  Identities=36%  Similarity=0.460  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        65 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   89 (336)
T TIGR02817        65 DAAGVVVAVGDEVT---------LFKPGDEVWYA   89 (336)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46899999998653         47899999863


No 58 
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina
Probab=54.49  E-value=11  Score=28.44  Aligned_cols=26  Identities=35%  Similarity=0.486  Sum_probs=20.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        65 e~~G~V~~~G~~v~---------~~~~Gd~V~~~~   90 (324)
T cd08292          65 EAVGVVDAVGEGVK---------GLQVGQRVAVAP   90 (324)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEecc
Confidence            56899999998653         478999998754


No 59 
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the clo
Probab=54.24  E-value=10  Score=28.85  Aligned_cols=25  Identities=32%  Similarity=0.373  Sum_probs=20.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   85 (325)
T cd08264          61 EFAGVVEEVGDHVK---------GVKKGDRVVVY   85 (325)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEEC
Confidence            46799999998764         47899999853


No 60 
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]
Probab=53.78  E-value=33  Score=24.11  Aligned_cols=35  Identities=29%  Similarity=0.451  Sum_probs=24.0

Q ss_pred             CCCeeecceeeeCCEEEccC-CCceEEEECC-EEEEEEe
Q psy12951         63 PNGEYIKPVVNVGDKVLLPK-FGGTKIEVEG-QELHLFK   99 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~-y~g~~v~~~g-~~y~iv~   99 (111)
                      ++|+  |..+++||.++|+. |.|..-..+. .++++++
T Consensus        79 d~Ge--~v~~~aGD~~~~~~G~~g~W~V~EtvrK~Yv~~  115 (116)
T COG3450          79 DGGE--PVEVRAGDSFVFPAGFKGTWEVLETVRKHYVIR  115 (116)
T ss_pred             CCCe--EEEEcCCCEEEECCCCeEEEEEeeeeEEEEEEe
Confidence            4554  55899999999998 8886655544 3444443


No 61 
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase. This family includes eukaryotic D-serine dehydratases (DSD), cryptic DSDs from bacteria, D-threonine aldolases (D-TA), low specificity D-TAs, and similar uncharacterized proteins. DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. Members of this family are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on similarity to AR, it is poss
Probab=53.45  E-value=20  Score=28.32  Aligned_cols=37  Identities=19%  Similarity=0.392  Sum_probs=30.8

Q ss_pred             eeeeCCEEEc-cCCCceEEEECCEEEEEEecCcEEEEee
Q psy12951         71 VVNVGDKVLL-PKFGGTKIEVEGQELHLFKEADLLAVIE  108 (111)
Q Consensus        71 ~vk~GD~Vl~-~~y~g~~v~~~g~~y~iv~~~DIlavi~  108 (111)
                      .+++||+|.+ +.+....+.+-+. |++++...|.+.|.
T Consensus       305 ~~~vGd~v~~ip~H~c~t~~~~~~-~~vv~~~~v~~~w~  342 (345)
T cd07376         305 DLPIGDRVFLVPNHACETVALHDE-LYVVEGGRVAATWP  342 (345)
T ss_pred             CCCCCCEEEEeCCccccchhcCCE-EEEEECCEEEEEEe
Confidence            4789999999 7788888877655 99999998888774


No 62 
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family.  The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=53.01  E-value=11  Score=29.01  Aligned_cols=24  Identities=33%  Similarity=0.309  Sum_probs=19.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (345)
T cd08287          60 EFVGVVEEVGSEVT---------SVKPGDFVIA   83 (345)
T ss_pred             ceEEEEEEeCCCCC---------ccCCCCEEEe
Confidence            46799999997653         4789999985


No 63 
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin
Probab=52.31  E-value=12  Score=28.73  Aligned_cols=26  Identities=27%  Similarity=0.371  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++...        .+++||+|...
T Consensus        67 e~~G~V~~vG~~v~~--------~~~vGd~V~~~   92 (324)
T cd08291          67 EGSGTVVAAGGGPLA--------QSLIGKRVAFL   92 (324)
T ss_pred             ceEEEEEEECCCccc--------cCCCCCEEEec
Confidence            467999999987531        26899999863


No 64 
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.   These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typical
Probab=52.06  E-value=12  Score=28.64  Aligned_cols=24  Identities=42%  Similarity=0.596  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (344)
T cd08284          60 EFVGEVVEVGPEVR---------TLKVGDRVVS   83 (344)
T ss_pred             ceEEEEEeeCCCcc---------ccCCCCEEEE
Confidence            46799999998654         5789999986


No 65 
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MD
Probab=51.32  E-value=19  Score=26.73  Aligned_cols=26  Identities=31%  Similarity=0.349  Sum_probs=20.4

Q ss_pred             cceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         47 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        47 k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ....|+|+++|++..         ..++||+|+..
T Consensus        26 ~e~~G~V~~vG~~v~---------~~~~Gd~V~~~   51 (277)
T cd08255          26 YSSVGRVVEVGSGVT---------GFKPGDRVFCF   51 (277)
T ss_pred             cceeEEEEEeCCCCC---------CCCCCCEEEec
Confidence            467799999997643         36899999875


No 66 
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions  near  the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates.  Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononu
Probab=51.30  E-value=12  Score=29.50  Aligned_cols=24  Identities=38%  Similarity=0.493  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~   85 (365)
T cd08278          62 EGAGVVEAVGSAVT---------GLKPGDHVVL   85 (365)
T ss_pred             ceeEEEEEeCCCcc---------cCCCCCEEEE
Confidence            46799999998653         4789999983


No 67 
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=50.82  E-value=13  Score=28.60  Aligned_cols=25  Identities=32%  Similarity=0.401  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecce-eeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPV-VNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~-vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         . +++||+|+.-
T Consensus        70 e~~G~V~~vG~~v~---------~~~~~Gd~V~~~   95 (341)
T cd08262          70 EFCGEVVDYGPGTE---------RKLKVGTRVTSL   95 (341)
T ss_pred             ceeEEEEEeCCCCc---------CCCCCCCEEEec
Confidence            46799999998653         3 7899999964


No 68 
>PRK10838 spr outer membrane lipoprotein; Provisional
Probab=50.56  E-value=9.9  Score=28.72  Aligned_cols=34  Identities=21%  Similarity=0.334  Sum_probs=21.1

Q ss_pred             ceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         36 GGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        36 gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      .|+-||..+.+....|.-|.             ..++++||.|+|..
T Consensus       106 ~Gi~LPr~t~~Q~~~g~~V~-------------~~~lqpGDLVfF~~  139 (190)
T PRK10838        106 FGLELPRSTYEQQEMGKSVS-------------RSKLRTGDLVLFRA  139 (190)
T ss_pred             CCCCCCCCHHHHHhcCcCcc-------------cCCCCCCcEEEECC
Confidence            57888887654333332111             12689999999974


No 69 
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydro
Probab=50.51  E-value=14  Score=26.77  Aligned_cols=26  Identities=46%  Similarity=0.710  Sum_probs=20.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        36 e~~G~v~~~G~~v~---------~~~~Gd~V~~~~   61 (271)
T cd05188          36 EGAGVVVEVGPGVT---------GVKVGDRVVVLP   61 (271)
T ss_pred             ccEEEEEEECCCCC---------cCCCCCEEEEcC
Confidence            46799999997543         478999999754


No 70 
>cd05284 arabinose_DH_like D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol d
Probab=50.50  E-value=13  Score=28.46  Aligned_cols=25  Identities=32%  Similarity=0.425  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        64 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   88 (340)
T cd05284          64 ENAGWVEEVGSGVD---------GLKEGDPVVVH   88 (340)
T ss_pred             ceeEEEEEeCCCCC---------cCcCCCEEEEc
Confidence            45799999997653         47899999853


No 71 
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain.  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=50.18  E-value=14  Score=28.62  Aligned_cols=25  Identities=32%  Similarity=0.523  Sum_probs=20.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   84 (351)
T cd08285          60 EAVGVVEEVGSEVK---------DFKPGDRVIVP   84 (351)
T ss_pred             ceEEEEEEecCCcC---------ccCCCCEEEEc
Confidence            56799999998753         47899999964


No 72 
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup.  L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain.  The MDR group contains a host of activities, i
Probab=50.14  E-value=14  Score=28.36  Aligned_cols=24  Identities=33%  Similarity=0.530  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 ~~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (343)
T cd08235          60 EIAGEIVEVGDGVT---------GFKVGDRVFV   83 (343)
T ss_pred             ceEEEEEeeCCCCC---------CCCCCCEEEE
Confidence            56899999998653         4789999995


No 73 
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which  is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (
Probab=49.42  E-value=15  Score=28.37  Aligned_cols=25  Identities=36%  Similarity=0.523  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        61 e~~G~V~~~G~~v~---------~~~~Gd~V~~~   85 (345)
T cd08286          61 EGVGVVEEVGSAVT---------NFKVGDRVLIS   85 (345)
T ss_pred             cceEEEEEeccCcc---------ccCCCCEEEEC
Confidence            46799999998653         47899999863


No 74 
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast
Probab=48.67  E-value=16  Score=28.11  Aligned_cols=25  Identities=32%  Similarity=0.452  Sum_probs=20.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        59 ~~~G~V~~~g~~v~---------~~~~Gd~V~~~   83 (343)
T cd08236          59 EFSGTVEEVGSGVD---------DLAVGDRVAVN   83 (343)
T ss_pred             ceEEEEEEECCCCC---------cCCCCCEEEEc
Confidence            57899999998653         57899999863


No 75 
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to  6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate.  L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domai
Probab=48.26  E-value=14  Score=28.30  Aligned_cols=24  Identities=38%  Similarity=0.547  Sum_probs=19.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 e~~G~v~~vG~~v~---------~~~~Gd~V~~   83 (339)
T cd08232          60 EVSGVVEAVGPGVT---------GLAPGQRVAV   83 (339)
T ss_pred             cceEEEEeeCCCCC---------cCCCCCEEEE
Confidence            35799999998653         4789999986


No 76 
>PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=48.23  E-value=15  Score=24.61  Aligned_cols=22  Identities=41%  Similarity=0.590  Sum_probs=15.5

Q ss_pred             eeeeCCEEEccCCCceEEEECCEEEEEE
Q psy12951         71 VVNVGDKVLLPKFGGTKIEVEGQELHLF   98 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~v~~~g~~y~iv   98 (111)
                      .+|+||+|+.-+.      -+|+.|+++
T Consensus        76 ~Lk~GD~V~ll~~------~~gQ~yiVl   97 (100)
T PF10844_consen   76 GLKVGDKVLLLRV------QGGQKYIVL   97 (100)
T ss_pred             CCcCCCEEEEEEe------cCCCEEEEE
Confidence            7899999997652      245666665


No 77 
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. T
Probab=48.08  E-value=15  Score=29.36  Aligned_cols=25  Identities=44%  Similarity=0.696  Sum_probs=20.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   85 (386)
T cd08283          61 EFMGVVEEVGPEVR---------NLKVGDRVVVP   85 (386)
T ss_pred             cceEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46899999998653         47899999864


No 78 
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol.  ADH is a me
Probab=47.49  E-value=16  Score=28.75  Aligned_cols=24  Identities=46%  Similarity=0.666  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (363)
T cd08279          60 EGAGVVEEVGPGVT---------GVKPGDHVVL   83 (363)
T ss_pred             cceEEEEEeCCCcc---------ccCCCCEEEE
Confidence            46799999998653         4789999987


No 79 
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous
Probab=47.47  E-value=15  Score=28.12  Aligned_cols=25  Identities=32%  Similarity=0.481  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   86 (306)
T cd08258          62 EFSGTIVEVGPDVE---------GWKVGDRVVSE   86 (306)
T ss_pred             ceEEEEEEECCCcC---------cCCCCCEEEEc
Confidence            46799999998654         47899999874


No 80 
>PLN02702 L-idonate 5-dehydrogenase
Probab=47.02  E-value=15  Score=28.76  Aligned_cols=24  Identities=29%  Similarity=0.479  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        80 e~~G~V~~vG~~v~---------~~~~Gd~V~~  103 (364)
T PLN02702         80 ECAGIIEEVGSEVK---------HLVVGDRVAL  103 (364)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEE
Confidence            46799999998653         4789999986


No 81 
>PF01079 Hint:  Hint module;  InterPro: IPR001767 This domain identifies a group of cysteine peptidases correspond to MEROPS peptidase family C46 (clan CH). The type example is the Hedgehog protein from Drosophila melanogaster (Fruit fly). These are involved in intracellular signalling required for a variety of patterning events during development. The hedgehog family of proteins self process by a cysteine-dependent mechanism, which is a one-time autolytic cleavage. It is differentiated from a typical peptidase reaction by the fact that the newly-formed carboxyl group is esterified with cholesterol, rather than being left free. The three-dimensional structure of the autolytic domain of the hedgehog protein of D. melanogaster shows that it is formed from two divergent copies of a module that also occurs in inteins, called a Hint domain [,].; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 3K7H_B 3K7I_B 3K7G_B 1AT0_A 3MXW_A 3M1N_B 3HO5_H 2WFR_A 2WFQ_A 2WG3_B ....
Probab=46.67  E-value=37  Score=26.07  Aligned_cols=24  Identities=25%  Similarity=0.393  Sum_probs=14.7

Q ss_pred             CCCCeeecc-eeeeCCEEEccCCCc
Q psy12951         62 TPNGEYIKP-VVNVGDKVLLPKFGG   85 (111)
Q Consensus        62 ~~~G~~~p~-~vk~GD~Vl~~~y~g   85 (111)
                      ..+|..++| ++++||+|+--+-.|
T Consensus        21 ~~~G~~k~m~~L~iGD~Vla~d~~G   45 (217)
T PF01079_consen   21 LEDGGRKRMSDLKIGDRVLAVDSDG   45 (217)
T ss_dssp             BTTS-EEEGGG--TT-EEEEE-TTS
T ss_pred             eCCCCEeEHHHCCCCCEEEEecCCC
Confidence            467777777 999999999988555


No 82 
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima,  proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family.  MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quino
Probab=46.02  E-value=17  Score=28.34  Aligned_cols=30  Identities=37%  Similarity=0.488  Sum_probs=20.6

Q ss_pred             ceeeEEEEecCceeC-CCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGART-PNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~-~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++... ..|    ..+++||+|+..
T Consensus        61 e~~G~V~~vG~~v~~~~~~----~~~~~Gd~V~~~   91 (361)
T cd08231          61 EGVGRVVALGGGVTTDVAG----EPLKVGDRVTWS   91 (361)
T ss_pred             CCceEEEEeCCCccccccC----CccCCCCEEEEc
Confidence            467999999987541 001    137899999864


No 83 
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic
Probab=45.99  E-value=17  Score=28.15  Aligned_cols=24  Identities=38%  Similarity=0.452  Sum_probs=19.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|++
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (337)
T cd05283          60 EIVGIVVAVGSKVT---------KFKVGDRVGV   83 (337)
T ss_pred             ceeeEEEEECCCCc---------ccCCCCEEEE
Confidence            46799999998754         5789999974


No 84 
>PTZ00354 alcohol dehydrogenase; Provisional
Probab=45.96  E-value=18  Score=27.30  Aligned_cols=24  Identities=25%  Similarity=0.356  Sum_probs=19.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|.|+++|++..         .+++||+|+-
T Consensus        65 e~~G~v~~vG~~v~---------~~~~Gd~V~~   88 (334)
T PTZ00354         65 EVAGYVEDVGSDVK---------RFKEGDRVMA   88 (334)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46899999997653         4789999975


No 85 
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]
Probab=45.94  E-value=18  Score=29.02  Aligned_cols=54  Identities=26%  Similarity=0.217  Sum_probs=34.5

Q ss_pred             cceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCC--ce--------------------EE---EECC--EEEEEEe
Q psy12951         47 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG--GT--------------------KI---EVEG--QELHLFK   99 (111)
Q Consensus        47 k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~--g~--------------------~v---~~~g--~~y~iv~   99 (111)
                      -...|+|+++| ...         ..++||+|..+..-  |.                    ..   .++|  -+|+.++
T Consensus        61 HE~~G~V~evG-~~~---------~~~~GdrVvv~~~~~Cg~C~~C~~G~~~~C~~~~~~g~~~~~~~~~G~~aEyv~vp  130 (350)
T COG1063          61 HEFVGEVVEVG-VVR---------GFKVGDRVVVEPNIPCGHCRYCRAGEYNLCENPGFYGYAGLGGGIDGGFAEYVRVP  130 (350)
T ss_pred             ccceEEEEEec-ccc---------CCCCCCEEEECCCcCCCCChhHhCcCcccCCCccccccccccCCCCCceEEEEEec
Confidence            35679999999 433         46788888876421  11                    10   0234  4888888


Q ss_pred             cCcEEEEeecC
Q psy12951        100 EADLLAVIEKD  110 (111)
Q Consensus       100 ~~DIlavi~~~  110 (111)
                      .+..+.++.++
T Consensus       131 ~~~~~~~~pd~  141 (350)
T COG1063         131 ADFNLAKLPDG  141 (350)
T ss_pred             cccCeecCCCC
Confidence            87777776544


No 86 
>PF09871 DUF2098:  Uncharacterized protein conserved in archaea (DUF2098);  InterPro: IPR019209  This family of proteins have no known function. 
Probab=45.46  E-value=55  Score=22.03  Aligned_cols=34  Identities=29%  Similarity=0.480  Sum_probs=24.2

Q ss_pred             eeeeCCEEEccCCC--c--eEEEE-CCEEEEEEecCcEE
Q psy12951         71 VVNVGDKVLLPKFG--G--TKIEV-EGQELHLFKEADLL  104 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~--g--~~v~~-~g~~y~iv~~~DIl  104 (111)
                      .+++|+.|.|..-+  |  .+++. ||..|.++...+++
T Consensus         2 ~I~vGs~VRY~~TGT~G~V~diK~ed~~~wv~LD~t~L~   40 (91)
T PF09871_consen    2 PIKVGSYVRYINTGTVGKVVDIKEEDGETWVLLDSTDLY   40 (91)
T ss_pred             cceeCCEEEECCCCeEEEEEEEEEeCCCeEEEEccCCce
Confidence            47899999998855  5  44444 67788888666654


No 87 
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=45.30  E-value=18  Score=27.86  Aligned_cols=25  Identities=32%  Similarity=0.256  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        64 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   88 (341)
T PRK05396         64 EFVGEVVEVGSEVT---------GFKVGDRVSGE   88 (341)
T ss_pred             eeEEEEEEeCCCCC---------cCCCCCEEEEC
Confidence            36799999998654         47899999864


No 88 
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional
Probab=45.26  E-value=45  Score=20.46  Aligned_cols=29  Identities=31%  Similarity=0.408  Sum_probs=14.3

Q ss_pred             EccCCCceEEEECCEEEEEEecCcEEEEe
Q psy12951         79 LLPKFGGTKIEVEGQELHLFKEADLLAVI  107 (111)
Q Consensus        79 l~~~y~g~~v~~~g~~y~iv~~~DIlavi  107 (111)
                      +..+.+|+=.++.-++--.++..++|+.+
T Consensus        42 I~a~~~G~V~~i~v~~G~~V~~G~~l~~i   70 (71)
T PRK05889         42 VLAEVAGTVSKVSVSVGDVIQAGDLIAVI   70 (71)
T ss_pred             EeCCCCEEEEEEEeCCCCEECCCCEEEEE
Confidence            34556664333322222245667777765


No 89 
>cd08290 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann f
Probab=44.75  E-value=19  Score=27.56  Aligned_cols=26  Identities=31%  Similarity=0.424  Sum_probs=20.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         ..++||+|+...
T Consensus        70 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~   95 (341)
T cd08290          70 EGVGEVVKVGSGVK---------SLKPGDWVIPLR   95 (341)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEecC
Confidence            46899999998653         478999999654


No 90 
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent.  PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins).  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fo
Probab=44.62  E-value=19  Score=28.58  Aligned_cols=24  Identities=29%  Similarity=0.461  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (375)
T cd08282          60 EAMGEVEEVGSAVE---------SLKVGDRVVV   83 (375)
T ss_pred             ccEEEEEEeCCCCC---------cCCCCCEEEE
Confidence            46799999998643         4789999986


No 91 
>KOG0023|consensus
Probab=44.61  E-value=18  Score=30.19  Aligned_cols=24  Identities=33%  Similarity=0.439  Sum_probs=19.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+.||+...         ..|+||+|=.
T Consensus        72 EiaG~VvkvGs~V~---------~~kiGD~vGV   95 (360)
T KOG0023|consen   72 EIAGVVVKVGSNVT---------GFKIGDRVGV   95 (360)
T ss_pred             eeeEEEEEECCCcc---------cccccCeeee
Confidence            57899999999754         4788888754


No 92 
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=44.12  E-value=20  Score=27.24  Aligned_cols=25  Identities=36%  Similarity=0.640  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|++-
T Consensus        64 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   88 (327)
T PRK10754         64 EAAGVVSKVGSGVK---------HIKVGDRVVYA   88 (327)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEC
Confidence            46799999998654         46899999863


No 93 
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. 
Probab=43.67  E-value=20  Score=27.05  Aligned_cols=25  Identities=32%  Similarity=0.400  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+.+|++..         .+++||+|..-
T Consensus        61 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   85 (332)
T cd08259          61 EIVGTVEEVGEGVE---------RFKPGDRVILY   85 (332)
T ss_pred             cceEEEEEECCCCc---------cCCCCCEEEEC
Confidence            46799999998653         47899999853


No 94 
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=43.59  E-value=19  Score=25.99  Aligned_cols=26  Identities=38%  Similarity=0.533  Sum_probs=20.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        30 e~~G~v~~~G~~~~---------~~~~Gd~V~~~~   55 (288)
T smart00829       30 ECAGVVTRVGPGVT---------GLAVGDRVMGLA   55 (288)
T ss_pred             eeEEEEEeeCCCCc---------CCCCCCEEEEEc
Confidence            46799999997653         478999998743


No 95 
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=43.26  E-value=19  Score=27.58  Aligned_cols=25  Identities=36%  Similarity=0.530  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        84 e~~G~V~~vG~~v~---------~~~~Gd~V~~~  108 (350)
T cd08274          84 DIVGRVVAVGEGVD---------TARIGERVLVD  108 (350)
T ss_pred             cceEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            35799999998653         47899999863


No 96 
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an 
Probab=43.16  E-value=23  Score=26.95  Aligned_cols=25  Identities=36%  Similarity=0.375  Sum_probs=19.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|++.
T Consensus        60 e~~G~v~~~g~~~~---------~~~~Gd~V~~~   84 (330)
T cd08245          60 EIVGEVVEVGAGVE---------GRKVGDRVGVG   84 (330)
T ss_pred             cceEEEEEECCCCc---------ccccCCEEEEc
Confidence            46799999997543         47899999853


No 97 
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=42.93  E-value=47  Score=25.41  Aligned_cols=24  Identities=50%  Similarity=0.735  Sum_probs=19.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        63 e~~G~V~~vG~~~~---------~~~~Gd~V~~   86 (341)
T cd08297          63 EGAGVVVAVGPGVS---------GLKVGDRVGV   86 (341)
T ss_pred             ccceEEEEeCCCCC---------CCCCCCEEEE
Confidence            46799999997653         4789999985


No 98 
>COG4079 Uncharacterized protein conserved in archaea [Function unknown]
Probab=42.59  E-value=30  Score=27.86  Aligned_cols=28  Identities=21%  Similarity=0.358  Sum_probs=19.2

Q ss_pred             eeeeCCEEEccCC----CceEEEECCEEEEEEe
Q psy12951         71 VVNVGDKVLLPKF----GGTKIEVEGQELHLFK   99 (111)
Q Consensus        71 ~vk~GD~Vl~~~y----~g~~v~~~g~~y~iv~   99 (111)
                      .+++||+|...+-    .|++++.. ..|+++|
T Consensus       261 ~~~pGd~vvv~dg~mki~G~d~kV~-t~yiIcr  292 (293)
T COG4079         261 EVEPGDRVVVKDGVMKIDGKDLKVI-TGYIICR  292 (293)
T ss_pred             ccCCCCEEEEecCceEeccccceee-eeeEEec
Confidence            5899999998873    25555544 5677765


No 99 
>cd08246 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA  production for straight-chain fatty acid biosynthesis.  Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossma
Probab=42.59  E-value=22  Score=28.27  Aligned_cols=25  Identities=36%  Similarity=0.550  Sum_probs=20.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        88 e~~G~V~~vG~~v~---------~~~~Gd~V~~~  112 (393)
T cd08246          88 DASGIVWAVGEGVK---------NWKVGDEVVVH  112 (393)
T ss_pred             ceEEEEEEeCCCCC---------cCCCCCEEEEe
Confidence            36799999998753         47899999864


No 100
>cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=42.44  E-value=21  Score=27.59  Aligned_cols=24  Identities=42%  Similarity=0.671  Sum_probs=19.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|+...         .+++||+|+.
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~   84 (343)
T cd05285          61 ESAGTVVAVGSGVT---------HLKVGDRVAI   84 (343)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEE
Confidence            56899999997543         4789999985


No 101
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=42.41  E-value=58  Score=21.30  Aligned_cols=25  Identities=28%  Similarity=0.361  Sum_probs=16.6

Q ss_pred             eeeeCCEEEccC-CCceEEEECCEEE
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQEL   95 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~~y   95 (111)
                      .+++||.|+... .-|+=++++++..
T Consensus        37 ~L~~Gd~VvT~gGi~G~V~~i~d~~v   62 (84)
T TIGR00739        37 SLKKGDKVLTIGGIIGTVTKIAENTI   62 (84)
T ss_pred             hCCCCCEEEECCCeEEEEEEEeCCEE
Confidence            677888887765 5566666665433


No 102
>PRK11479 hypothetical protein; Provisional
Probab=42.16  E-value=8.4  Score=30.86  Aligned_cols=38  Identities=8%  Similarity=0.047  Sum_probs=25.6

Q ss_pred             CcccceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         32 TKTKGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        32 ~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      +.++-|+-||.+++.....|+=|+..             ++++||.|+|..
T Consensus        38 ~~~~~~~~~pr~s~~q~~~g~~Vs~~-------------~LqpGDLVFfst   75 (274)
T PRK11479         38 EAKTWAVKFQHQSSFTEQGIKEITAP-------------DLKPGDLLFSSS   75 (274)
T ss_pred             cchhcceecCcccHHHHhCCcccChh-------------hCCCCCEEEEec
Confidence            34567999999876554444433332             689999999853


No 103
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=41.76  E-value=21  Score=26.46  Aligned_cols=24  Identities=42%  Similarity=0.544  Sum_probs=19.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~   87 (328)
T cd08268          64 EAAGVVEAVGAGVT---------GFAVGDRVSV   87 (328)
T ss_pred             ceEEEEEeeCCCCC---------cCCCCCEEEe
Confidence            46799999997643         4789999985


No 104
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzy
Probab=41.58  E-value=21  Score=27.69  Aligned_cols=25  Identities=56%  Similarity=0.610  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        73 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   97 (350)
T cd08240          73 EIVGEVVAVGPDAA---------DVKVGDKVLVY   97 (350)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEEC
Confidence            46799999998653         47899999753


No 105
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent  alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone
Probab=41.57  E-value=22  Score=26.66  Aligned_cols=25  Identities=40%  Similarity=0.593  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+.+|++..         .+++||+|...
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (342)
T cd08266          64 DGAGVVEAVGPGVT---------NVKPGQRVVIY   88 (342)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46799999997653         47899999864


No 106
>TIGR01751 crot-CoA-red crotonyl-CoA reductase. The enzyme modelled by this alignment is responsible for the conversion of crotonyl-CoA reductase to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate. In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae and coronatine from Pseudomonas syringae.
Probab=40.81  E-value=22  Score=28.50  Aligned_cols=24  Identities=42%  Similarity=0.630  Sum_probs=19.4

Q ss_pred             eeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         49 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        49 ~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        85 ~~G~V~~vG~~v~---------~~~~Gd~V~~~  108 (398)
T TIGR01751        85 ASGVVWRVGPGVT---------RWKVGDEVVAS  108 (398)
T ss_pred             eEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            5799999998754         47899999864


No 107
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional
Probab=40.68  E-value=23  Score=27.04  Aligned_cols=24  Identities=38%  Similarity=0.670  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (338)
T PRK09422         60 EGIGIVKEVGPGVT---------SLKVGDRVSI   83 (338)
T ss_pred             ccceEEEEECCCCc---------cCCCCCEEEE
Confidence            46799999998653         4789999985


No 108
>cd05195 enoyl_red enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase
Probab=40.54  E-value=23  Score=25.47  Aligned_cols=25  Identities=32%  Similarity=0.490  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        34 e~~G~v~~~g~~~~---------~~~~Gd~V~~~   58 (293)
T cd05195          34 ECSGIVTRVGSGVT---------GLKVGDRVMGL   58 (293)
T ss_pred             eeeEEEEeecCCcc---------CCCCCCEEEEE
Confidence            56799999997643         47899999864


No 109
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=40.01  E-value=19  Score=24.95  Aligned_cols=15  Identities=33%  Similarity=0.667  Sum_probs=13.3

Q ss_pred             eeeeCCEEEccCCCc
Q psy12951         71 VVNVGDKVLLPKFGG   85 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g   85 (111)
                      .+++||+++|..+.+
T Consensus        31 ~ikvGD~I~f~~~~~   45 (109)
T cd06555          31 QIKVGDKILFNDLDT   45 (109)
T ss_pred             cCCCCCEEEEEEcCC
Confidence            689999999999864


No 110
>TIGR03779 Bac_Flav_CT_M Bacteroides conjugative transposon TraM protein. Members of this protein family are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage.
Probab=39.71  E-value=68  Score=27.18  Aligned_cols=38  Identities=11%  Similarity=-0.019  Sum_probs=27.5

Q ss_pred             eeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCcee
Q psy12951         18 PLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGAR   61 (111)
Q Consensus        18 PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~~   61 (111)
                      --|.||=++..  |..+.+|.+||...   +..|. ..++..+.
T Consensus       269 ~~G~~vrlRLl--e~~~v~~~~ipkgt---~l~g~-~~~~g~R~  306 (410)
T TIGR03779       269 VDGSAVKLRLL--EPIQAGDLVIPKGT---VLYGT-AKIQGERL  306 (410)
T ss_pred             ecCCEEEEEEc--CceeeCCEEecCCC---EEEEE-eeeccceE
Confidence            35788888888  55778899999765   66777 66665554


No 111
>cd08234 threonine_DH_like L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria),  and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=39.54  E-value=26  Score=26.64  Aligned_cols=24  Identities=42%  Similarity=0.501  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        59 ~~~G~v~~vG~~v~---------~~~~Gd~V~~   82 (334)
T cd08234          59 EFAGVVVAVGSKVT---------GFKVGDRVAV   82 (334)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            57899999997653         4689999986


No 112
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, 
Probab=39.32  E-value=60  Score=25.13  Aligned_cols=26  Identities=38%  Similarity=0.484  Sum_probs=19.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..  +|     .+++||+|+.
T Consensus        69 e~~G~v~~vG~~v~--~~-----~~~~Gd~V~~   94 (350)
T cd08256          69 EFVGRVVELGEGAE--ER-----GVKVGDRVIS   94 (350)
T ss_pred             ceeEEEEEeCCCcc--cC-----CCCCCCEEEE
Confidence            35799999997642  11     3689999985


No 113
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentatio
Probab=39.16  E-value=25  Score=26.59  Aligned_cols=24  Identities=38%  Similarity=0.545  Sum_probs=19.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|+...         .+++||+|+.
T Consensus        63 ~~~G~v~~~G~~v~---------~~~~Gd~V~~   86 (338)
T cd08254          63 EIAGTVVEVGAGVT---------NFKVGDRVAV   86 (338)
T ss_pred             cccEEEEEECCCCc---------cCCCCCEEEE
Confidence            45799999997654         4689999985


No 114
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology  to GroES.  These proteins typically form dimers (typically
Probab=39.10  E-value=25  Score=28.00  Aligned_cols=25  Identities=36%  Similarity=0.510  Sum_probs=19.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        67 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   91 (373)
T cd08299          67 EAAGIVESVGEGVT---------TVKPGDKVIPL   91 (373)
T ss_pred             cceEEEEEeCCCCc---------cCCCCCEEEEC
Confidence            46799999998654         47899999854


No 115
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=39.01  E-value=55  Score=24.85  Aligned_cols=24  Identities=42%  Similarity=0.512  Sum_probs=18.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        65 e~~G~V~~vG~~v~---------~~~~Gd~V~~   88 (329)
T cd08298          65 EIVGRVEAVGPGVT---------RFSVGDRVGV   88 (329)
T ss_pred             cccEEEEEECCCCC---------CCcCCCEEEE
Confidence            46799999997653         4789999975


No 116
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=38.98  E-value=28  Score=27.20  Aligned_cols=24  Identities=29%  Similarity=0.531  Sum_probs=18.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+ +||+|..+
T Consensus        60 E~~G~V~~vG~~v~---------~~-~GdrV~~~   83 (349)
T TIGR03201        60 EISGRVIQAGAGAA---------SW-IGKAVIVP   83 (349)
T ss_pred             cceEEEEEeCCCcC---------CC-CCCEEEEC
Confidence            46799999998753         24 89999864


No 117
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=38.65  E-value=28  Score=25.97  Aligned_cols=25  Identities=20%  Similarity=0.110  Sum_probs=19.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|..-
T Consensus        58 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   82 (305)
T cd08270          58 DAAGVVERAAADGS---------GPAVGARVVGL   82 (305)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            56899999997643         46899999853


No 118
>cd08251 polyketide_synthase polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde a
Probab=38.46  E-value=26  Score=25.73  Aligned_cols=25  Identities=40%  Similarity=0.551  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         ..++||+|+..
T Consensus        44 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   68 (303)
T cd08251          44 EASGVVRAVGPHVT---------RLAVGDEVIAG   68 (303)
T ss_pred             eeeEEEEEECCCCC---------CCCCCCEEEEe
Confidence            46799999997653         46899999853


No 119
>cd05282 ETR_like 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossman
Probab=38.26  E-value=28  Score=26.11  Aligned_cols=26  Identities=38%  Similarity=0.446  Sum_probs=20.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|.|+++|++..         ..++||+|+...
T Consensus        63 e~~G~v~~~G~~v~---------~~~~Gd~V~~~~   88 (323)
T cd05282          63 EGVGVVVEVGSGVS---------GLLVGQRVLPLG   88 (323)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEeC
Confidence            46899999998754         468999999754


No 120
>cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydr
Probab=38.08  E-value=28  Score=26.14  Aligned_cols=26  Identities=35%  Similarity=0.449  Sum_probs=20.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|+|+++|++..         .+++||+|+..-
T Consensus        66 e~~G~v~~~G~~v~---------~~~~Gd~V~~~~   91 (324)
T cd08244          66 EVAGVVDAVGPGVD---------PAWLGRRVVAHT   91 (324)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEcc
Confidence            46799999997653         478999998753


No 121
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking  and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=37.81  E-value=26  Score=26.83  Aligned_cols=25  Identities=32%  Similarity=0.538  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|...
T Consensus        80 e~~G~v~~vG~~v~---------~~~~Gd~V~~~  104 (350)
T cd08248          80 DCSGVVVDIGSGVK---------SFEIGDEVWGA  104 (350)
T ss_pred             eeEEEEEecCCCcc---------cCCCCCEEEEe
Confidence            46799999997653         47899999863


No 122
>PLN03154 putative allyl alcohol dehydrogenase; Provisional
Probab=37.78  E-value=25  Score=27.79  Aligned_cols=24  Identities=17%  Similarity=0.033  Sum_probs=18.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|.+||++..         .+++||+|..
T Consensus        81 ~~~G~v~~vg~~v~---------~~~~Gd~V~~  104 (348)
T PLN03154         81 EGFGVSKVVDSDDP---------NFKPGDLISG  104 (348)
T ss_pred             EeeEEEEEEecCCC---------CCCCCCEEEe
Confidence            34689999998653         4789999973


No 123
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=37.49  E-value=28  Score=26.36  Aligned_cols=25  Identities=32%  Similarity=0.300  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|.--
T Consensus        64 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   88 (331)
T cd08273          64 DLVGRVDALGSGVT---------GFEVGDRVAAL   88 (331)
T ss_pred             ceEEEEEEeCCCCc---------cCCCCCEEEEe
Confidence            45799999997653         47899999864


No 124
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanedi
Probab=37.29  E-value=26  Score=27.88  Aligned_cols=24  Identities=25%  Similarity=0.263  Sum_probs=19.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        94 e~~G~V~~vG~~v~---------~~~~Gd~V~~  117 (384)
T cd08265          94 EFSGVVEKTGKNVK---------NFEKGDPVTA  117 (384)
T ss_pred             ceEEEEEEECCCCC---------CCCCCCEEEE
Confidence            45799999997643         4789999985


No 125
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal
Probab=36.55  E-value=30  Score=26.65  Aligned_cols=24  Identities=33%  Similarity=0.351  Sum_probs=19.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~   84 (333)
T cd08296          61 EVVGRIDAVGEGVS---------RWKVGDRVGV   84 (333)
T ss_pred             ceeEEEEEECCCCc---------cCCCCCEEEe
Confidence            46799999997653         4789999985


No 126
>cd08249 enoyl_reductase_like enoyl_reductase_like. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol de
Probab=35.15  E-value=34  Score=26.49  Aligned_cols=25  Identities=36%  Similarity=0.377  Sum_probs=19.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+--
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   85 (339)
T cd08249          61 DFAGTVVEVGSGVT---------RFKVGDRVAGF   85 (339)
T ss_pred             eeeEEEEEeCCCcC---------cCCCCCEEEEE
Confidence            46799999998653         46899999853


No 127
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.   A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology to GroES.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subu
Probab=35.14  E-value=30  Score=27.09  Aligned_cols=27  Identities=33%  Similarity=0.395  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++.. ..+     ..++||+|+.
T Consensus        60 e~~G~v~~vG~~~~-~~~-----~~~~Gd~V~~   86 (367)
T cd08263          60 EISGEVVEVGPNVE-NPY-----GLSVGDRVVG   86 (367)
T ss_pred             ccceEEEEeCCCCC-CCC-----cCCCCCEEEE
Confidence            46799999998653 111     3789999986


No 128
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts
Probab=34.82  E-value=31  Score=25.42  Aligned_cols=26  Identities=42%  Similarity=0.580  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|.|+++|+...         .+++||+|+...
T Consensus        64 e~~G~v~~~g~~~~---------~~~~Gd~v~~~~   89 (325)
T cd08253          64 DGAGVVEAVGEGVD---------GLKVGDRVWLTN   89 (325)
T ss_pred             ceEEEEEeeCCCCC---------CCCCCCEEEEec
Confidence            45799999997543         478999998653


No 129
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=34.68  E-value=34  Score=25.41  Aligned_cols=25  Identities=40%  Similarity=0.445  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        65 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   89 (319)
T cd08267          65 DFAGEVVAVGSGVT---------RFKVGDEVFGR   89 (319)
T ss_pred             eeeEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            46799999997654         47899999864


No 130
>PF12124 Nsp3_PL2pro:  Coronavirus polyprotein cleavage domain;  InterPro: IPR022733  This domain is found in SARS coronaviruses, and is about 70 amino acids in length. It is found associated with various other coronavirus proteins due to the polyprotein nature of most viral translation. PL2pro is a domain of the non-structural protein nsp3. The domain performs three of the cleavages required to separate the translated polyprotein into its distinct proteins. ; GO: 0004197 cysteine-type endopeptidase activity, 0008242 omega peptidase activity, 0016740 transferase activity, 0016788 hydrolase activity, acting on ester bonds, 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2KAF_A 2KQW_A.
Probab=34.52  E-value=81  Score=19.69  Aligned_cols=25  Identities=20%  Similarity=0.448  Sum_probs=17.4

Q ss_pred             eeeeCCEEEccCCC-ceEEEECCEEE
Q psy12951         71 VVNVGDKVLLPKFG-GTKIEVEGQEL   95 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~-g~~v~~~g~~y   95 (111)
                      .+|.||+++|.--. -.++-++|+-+
T Consensus        31 flkrgdkivyht~~~~iefh~~gevl   56 (66)
T PF12124_consen   31 FLKRGDKIVYHTVENPIEFHMDGEVL   56 (66)
T ss_dssp             EEEETTEEEEE-SSSS--EEETTEEE
T ss_pred             HHhcCCEEEEEecCCceEEEecCcEe
Confidence            68999999998855 47778888754


No 131
>PF08206 OB_RNB:  Ribonuclease B OB domain;  InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies.; PDB: 2ID0_D 2IX1_A 2IX0_A.
Probab=34.14  E-value=66  Score=19.19  Aligned_cols=9  Identities=33%  Similarity=0.335  Sum_probs=4.8

Q ss_pred             CCeEEEEec
Q psy12951         20 LDRILVIKD   28 (111)
Q Consensus        20 gDrVLVk~~   28 (111)
                      +|+|+|+..
T Consensus        35 gD~V~v~i~   43 (58)
T PF08206_consen   35 GDKVLVRIT   43 (58)
T ss_dssp             T-EEEEEEE
T ss_pred             CCEEEEEEe
Confidence            566666654


No 132
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=34.12  E-value=36  Score=25.97  Aligned_cols=25  Identities=24%  Similarity=0.215  Sum_probs=19.4

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         ..++||+|+..
T Consensus        61 e~~G~v~~~g~~~~---------~~~~G~~V~~~   85 (334)
T PRK13771         61 EVVGTVEEVGENVK---------GFKPGDRVASL   85 (334)
T ss_pred             cceEEEEEeCCCCc---------cCCCCCEEEEC
Confidence            46799999997653         36799999864


No 133
>cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone 
Probab=33.64  E-value=35  Score=25.04  Aligned_cols=25  Identities=44%  Similarity=0.635  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        61 e~~G~v~~~g~~~~---------~~~~G~~V~~~   85 (320)
T cd05286          61 EGAGVVEAVGPGVT---------GFKVGDRVAYA   85 (320)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEEe
Confidence            46799999997653         47899999874


No 134
>cd00148 PROF Profilin binds actin monomers, membrane polyphosphoinositides such as PI(4,5)P2, and poly-L-proline. Profilin can inhibit actin polymerization into F-actin by binding to monomeric actin (G-actin) and terminal F-actin subunits, but - as a regulator of the cytoskeleton - it may also promote actin polymerization. It plays a role in the assembly of branched actin filament networks, by activating WASP via binding to WASP's proline rich domain. Profilin may link the cytoskeleton with major signalling pathways by interacting with components of the phosphatidylinositol cycle and Ras pathway.
Probab=33.54  E-value=81  Score=21.76  Aligned_cols=19  Identities=21%  Similarity=0.350  Sum_probs=15.8

Q ss_pred             eEEEECCEEEEEEecCcEE
Q psy12951         86 TKIEVEGQELHLFKEADLL  104 (111)
Q Consensus        86 ~~v~~~g~~y~iv~~~DIl  104 (111)
                      .=+.++|++|+++|.++-.
T Consensus        60 ~Gi~l~G~KY~~l~~d~~~   78 (127)
T cd00148          60 TGLTLGGQKYMVIRADDRS   78 (127)
T ss_pred             CCEEECCeEEEEEecCccE
Confidence            4489999999999988743


No 135
>PRK11171 hypothetical protein; Provisional
Probab=33.39  E-value=1.9e+02  Score=22.45  Aligned_cols=50  Identities=20%  Similarity=0.369  Sum_probs=36.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECC-E--EEEEEe
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEG-Q--ELHLFK   99 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g-~--~y~iv~   99 (111)
                      ..+...|--|.+....+|+..  .|+.||.+.|+.+.-..+..-| +  .|++++
T Consensus       205 ~ee~i~Vl~G~~~~~~~~~~~--~l~~GD~i~~~~~~~h~~~N~g~~~~~yl~~k  257 (266)
T PRK11171        205 MEHGLYVLEGKGVYRLNNDWV--EVEAGDFIWMRAYCPQACYAGGPGPFRYLLYK  257 (266)
T ss_pred             ceEEEEEEeCEEEEEECCEEE--EeCCCCEEEECCCCCEEEECCCCCcEEEEEEc
Confidence            446667777777777677654  6899999999999888887633 3  566554


No 136
>COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]
Probab=33.14  E-value=49  Score=30.54  Aligned_cols=15  Identities=40%  Similarity=0.616  Sum_probs=14.2

Q ss_pred             eeeeCCEEEccCCCc
Q psy12951         71 VVNVGDKVLLPKFGG   85 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g   85 (111)
                      ++|+||+|-++.+.|
T Consensus       660 pvkvGD~It~g~~~G  674 (835)
T COG3264         660 PVKVGDTVTIGTVSG  674 (835)
T ss_pred             CcccCCEEEECCceE
Confidence            799999999999998


No 137
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=33.14  E-value=35  Score=25.31  Aligned_cols=25  Identities=40%  Similarity=0.383  Sum_probs=19.3

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (326)
T cd08272          64 DVAGVVEAVGEGVT---------RFRVGDEVYGC   88 (326)
T ss_pred             ceeEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46799999997653         46899999853


No 138
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=33.07  E-value=36  Score=25.41  Aligned_cols=25  Identities=40%  Similarity=0.438  Sum_probs=19.7

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        63 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   87 (325)
T cd08271          63 DGAGVVVAVGAKVT---------GWKVGDRVAYH   87 (325)
T ss_pred             ceEEEEEEeCCCCC---------cCCCCCEEEec
Confidence            46799999997653         46899999864


No 139
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=33.03  E-value=60  Score=20.05  Aligned_cols=25  Identities=32%  Similarity=0.482  Sum_probs=14.3

Q ss_pred             eeeeCCEEEccCCC--ceEEEECCEEE
Q psy12951         71 VVNVGDKVLLPKFG--GTKIEVEGQEL   95 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~--g~~v~~~g~~y   95 (111)
                      .+++||.+.++...  -..+.++|...
T Consensus        28 ~L~~Gdvi~l~~~~~~~v~l~v~g~~~   54 (77)
T PF01052_consen   28 NLKVGDVIPLDKPADEPVELRVNGQPI   54 (77)
T ss_dssp             C--TT-EEEECCESSTEEEEEETTEEE
T ss_pred             cCCCCCEEEeCCCCCCCEEEEECCEEE
Confidence            67788888887763  35556677644


No 140
>PRK10579 hypothetical protein; Provisional
Probab=32.78  E-value=1.3e+02  Score=20.47  Aligned_cols=62  Identities=16%  Similarity=0.122  Sum_probs=28.5

Q ss_pred             cceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCC-ceEEEECCEEEEEEecCcEEE
Q psy12951         35 KGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG-GTKIEVEGQELHLFKEADLLA  105 (111)
Q Consensus        35 ~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~-g~~v~~~g~~y~iv~~~DIla  105 (111)
                      .=||++|....=.....++..|=.|..         .|+.-+.=-+..|. |..+++.+..-+=++.++..+
T Consensus        26 TlGVm~pGey~F~T~~~E~MeivsG~l---------~V~Lpg~~ew~~~~aG~sF~VpanssF~l~v~~~t~   88 (94)
T PRK10579         26 SVGVMAEGEYTFSTAEPEEMTVISGAL---------NVLLPGATDWQVYEAGEVFNVPGHSEFHLQVAEPTS   88 (94)
T ss_pred             EEEEEeeeEEEEcCCCcEEEEEEeeEE---------EEECCCCcccEEeCCCCEEEECCCCeEEEEECccee
Confidence            358899876432333444444444443         23332222233332 455555544444444444443


No 141
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=32.31  E-value=41  Score=26.20  Aligned_cols=23  Identities=13%  Similarity=0.099  Sum_probs=17.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++  +..         .+++||+|.+.
T Consensus        66 E~~G~V~~v--~v~---------~~~vGdrV~~~   88 (343)
T PRK09880         66 EVIGKIVHS--DSS---------GLKEGQTVAIN   88 (343)
T ss_pred             ccEEEEEEe--cCc---------cCCCCCEEEEC
Confidence            467999999  332         48999999875


No 142
>PF00235 Profilin:  Profilin;  InterPro: IPR002097 Profilin is a small eukaryotic protein that binds to monomeric actin (G-actin) in a 1:1 ratio thus preventing the polymerisation of actin into filaments (F-actin). It can also in certain circumstance promote actin polymerisation. Profilin also binds to polyphosphoinositides such as PIP2. Overall sequence similarity among profilin from organisms which belong to different phyla (ranging from fungi to mammals) is low, but the N-terminal region is relatively well conserved. That region is thought to be involved in the binding to actin.   A protein structurally similar to profilin is present in the genome of Variola virus and Vaccinia virus (gene A42R). Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ara t 8, Bet v 2, Cyn d 12, Hel a 2, Mer a 1 and Phl p 11.; GO: 0003779 actin binding, 0007010 cytoskeleton organization, 0015629 actin cytoskeleton; PDB: 1ACF_A 3NEC_C 2V8F_B 2V8C_A 2VK3_A 2JKF_A 2JKG_A 1F2K_B 2ACG_A 1YPR_B ....
Probab=31.75  E-value=44  Score=22.35  Aligned_cols=18  Identities=17%  Similarity=0.422  Sum_probs=14.9

Q ss_pred             ceEEEECCEEEEEEecCc
Q psy12951         85 GTKIEVEGQELHLFKEAD  102 (111)
Q Consensus        85 g~~v~~~g~~y~iv~~~D  102 (111)
                      ..-|.++|++|.++|.+|
T Consensus        58 ~~gi~l~G~kY~~~~~d~   75 (121)
T PF00235_consen   58 SNGITLGGKKYIVLRADD   75 (121)
T ss_dssp             HH-EEETTEEEEEEEEET
T ss_pred             cCCeEEcCcEeEEEecCC
Confidence            356999999999999876


No 143
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=31.74  E-value=64  Score=20.89  Aligned_cols=12  Identities=50%  Similarity=0.592  Sum_probs=9.9

Q ss_pred             eeeeCCEEEccC
Q psy12951         71 VVNVGDKVLLPK   82 (111)
Q Consensus        71 ~vk~GD~Vl~~~   82 (111)
                      ++++||.|+..-
T Consensus        35 ~~~vGD~VLVH~   46 (76)
T TIGR00074        35 EVKVGDYVLVHV   46 (76)
T ss_pred             CCCCCCEEEEec
Confidence            689999999754


No 144
>cd08252 AL_MDR Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, whil
Probab=31.51  E-value=41  Score=25.53  Aligned_cols=25  Identities=36%  Similarity=0.498  Sum_probs=19.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         ..++||+|++-
T Consensus        66 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   90 (336)
T cd08252          66 DASGVVEAVGSEVT---------LFKVGDEVYYA   90 (336)
T ss_pred             ceEEEEEEcCCCCC---------CCCCCCEEEEc
Confidence            46799999998653         46899999974


No 145
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=31.11  E-value=1e+02  Score=21.06  Aligned_cols=22  Identities=23%  Similarity=0.276  Sum_probs=13.3

Q ss_pred             eeeeCCEEEccC-CCceEEEECC
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEG   92 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g   92 (111)
                      .+++||+|+... .-|+-+++++
T Consensus        52 ~Lk~Gd~VvT~gGi~G~Vv~i~~   74 (106)
T PRK05585         52 SLAKGDEVVTNGGIIGKVTKVSE   74 (106)
T ss_pred             hcCCCCEEEECCCeEEEEEEEeC
Confidence            567777776543 4466566655


No 146
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=31.08  E-value=44  Score=25.32  Aligned_cols=26  Identities=38%  Similarity=0.399  Sum_probs=20.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|.|+++|++..         .+++||+|+...
T Consensus        67 e~~G~v~~vG~~v~---------~~~~Gd~V~~~~   92 (329)
T cd08250          67 EGVGEVVAVGEGVT---------DFKVGDAVATMS   92 (329)
T ss_pred             eeEEEEEEECCCCC---------CCCCCCEEEEec
Confidence            46799999997643         468999999753


No 147
>PF11901 DUF3421:  Protein of unknown function (DUF3421);  InterPro: IPR024518 This domain of unknown function is found in the fish toxin Natterin [] and in uncharacterised proteins.
Probab=30.91  E-value=68  Score=22.05  Aligned_cols=49  Identities=24%  Similarity=0.376  Sum_probs=36.1

Q ss_pred             eccCcc--ccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEE
Q psy12951         40 IPEKAQ--QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEV   90 (111)
Q Consensus        40 LP~~~~--~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~   90 (111)
                      +|..+-  .....|..+-||-...  +|...|-.+.++..+.|=.|.|.|+.+
T Consensus        68 iP~~av~~G~~~~Ge~lyIgR~~~--~g~~~~GKv~~s~~~~~ip~gG~E~~~  118 (119)
T PF11901_consen   68 IPPNAVVGGRTEDGEPLYIGRAHY--NGSLIPGKVHPSHKCCYIPYGGKEISF  118 (119)
T ss_pred             cCCCcEEcccccCCCEEEEEEEEE--CCeeEEEEEEcCCCEEEEEECCEEEEc
Confidence            455442  2455678888887665  677777788888889999999888765


No 148
>PF07883 Cupin_2:  Cupin domain;  InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel). ; PDB: 2OPK_C 3BU7_B 2PHD_D 3NVC_A 3NKT_A 3NJZ_A 3NW4_A 3NST_A 3NL1_A 2H0V_A ....
Probab=30.91  E-value=86  Score=18.20  Aligned_cols=40  Identities=20%  Similarity=0.369  Sum_probs=24.6

Q ss_pred             cCceeCCCCeeecceeeeCCEEEccCCCceEEEE-CCEEEEEE
Q psy12951         57 GPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEV-EGQELHLF   98 (111)
Q Consensus        57 G~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~-~g~~y~iv   98 (111)
                      |.+....+|+  ...+++||.++++...--.+.. .++++.++
T Consensus        28 G~~~~~~~~~--~~~l~~Gd~~~i~~~~~H~~~n~~~~~~~~l   68 (71)
T PF07883_consen   28 GEGTLTVDGE--RVELKPGDAIYIPPGVPHQVRNPGDEPARFL   68 (71)
T ss_dssp             SEEEEEETTE--EEEEETTEEEEEETTSEEEEEEESSSEEEEE
T ss_pred             CCEEEEEccE--EeEccCCEEEEECCCCeEEEEECCCCCEEEE
Confidence            4444333444  3579999999999887655544 33444443


No 149
>cd06819 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase. Low specificity D-threonine aldolase (Low specificity D-TA, EC 4.3.1.18), encoded by dtaAS gene from Arthrobacter sp. strain DK-38, is the prototype of this subfamily. Low specificity D-TAs are fold type III PLP-dependent enzymes that catalyze the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Members of this subfamily show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that t
Probab=30.08  E-value=70  Score=25.30  Aligned_cols=37  Identities=11%  Similarity=0.115  Sum_probs=27.5

Q ss_pred             eeeeCCEEEccC-CCceEEEECCEEEEEEecCcEEEEee
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLLAVIE  108 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~~y~iv~~~DIlavi~  108 (111)
                      .+++||+|.|-. |+...+..= ..|++++.+.|...|.
T Consensus       316 ~~~vGd~v~~~p~h~c~t~~~~-~~~~vv~~~~v~~~w~  353 (358)
T cd06819         316 PLKIGDRLELVPGHCDPTVNLH-DWYVGVRGGVVEDVWP  353 (358)
T ss_pred             CCCCCCEEEEECCCcCcccccc-CEEEEEECCEEEEEEE
Confidence            589999999977 766666543 3577888877777764


No 150
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=30.03  E-value=17  Score=23.58  Aligned_cols=28  Identities=21%  Similarity=0.405  Sum_probs=0.0

Q ss_pred             eeeeCCEEEccC-CCceEEEECCEEEEEEe
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQELHLFK   99 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~~y~iv~   99 (111)
                      ++++||+|+... .-|+=+++++ +++.+.
T Consensus        36 ~Lk~Gd~VvT~gGi~G~V~~i~~-~~v~le   64 (82)
T PF02699_consen   36 SLKPGDEVVTIGGIYGTVVEIDD-DTVVLE   64 (82)
T ss_dssp             ------------------------------
T ss_pred             cCCCCCEEEECCcEEEEEEEEeC-CEEEEE
Confidence            688888888765 5576666643 333343


No 151
>cd04456 S1_IF1A_like S1_IF1A_like: Translation initiation factor IF1A-like, S1-like RNA-binding domain. IF1A is also referred to as eIF1A in eukaryotes and aIF1A in archaea. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=29.97  E-value=62  Score=20.91  Aligned_cols=22  Identities=18%  Similarity=0.061  Sum_probs=15.4

Q ss_pred             eeCCeEEEEecCCCCcccceEE
Q psy12951         18 PLLDRILVIKDEPLTKTKGGVL   39 (111)
Q Consensus        18 PlgDrVLVk~~~~e~~T~gGIi   39 (111)
                      =-||+|||+..+..+.+++=|+
T Consensus        40 ~~GD~VlV~~~~~~~~~kg~Iv   61 (78)
T cd04456          40 KRGDFLIVDPIEEGEDVKADII   61 (78)
T ss_pred             cCCCEEEEEecccCCCceEEEE
Confidence            4599999998775455655553


No 152
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding
Probab=29.76  E-value=42  Score=24.64  Aligned_cols=25  Identities=48%  Similarity=0.581  Sum_probs=19.2

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+.+|++..         .+++||+|+.-
T Consensus        64 e~~G~v~~vg~~~~---------~~~~Gd~V~~~   88 (323)
T cd05276          64 EVAGVVVAVGPGVT---------GWKVGDRVCAL   88 (323)
T ss_pred             eeEEEEEeeCCCCC---------CCCCCCEEEEe
Confidence            45799999997653         46889999864


No 153
>TIGR03784 marine_sortase sortase, marine proteobacterial type. Members of this protein family are sortase enzymes, cysteine transpeptidases involved in protein sorting activities. Members of this family tend to be found in proteobacteria, rather than in Gram-positive bacteria where sortases attach proteins to the Gram-positive cell wall or participate in pilin cross-linking. Many species with this sortase appear to contain a signal target sequence, a protein with a Vault protein inter-alpha-trypsin domain (pfam08487) and a von Willebrand factor type A domain (pfam00092), encoded by an adjacent gene. These sortases are designated subfamily 6 according to Comfort and Clubb (2004).
Probab=29.64  E-value=58  Score=24.05  Aligned_cols=32  Identities=16%  Similarity=0.178  Sum_probs=20.9

Q ss_pred             eeeeCCEEEccCCCceEEEECCEEEEEEecCc
Q psy12951         71 VVNVGDKVLLPKFGGTKIEVEGQELHLFKEAD  102 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~v~~~g~~y~iv~~~D  102 (111)
                      .+++||.|.+..-.|+...|.=.+-.+++.+|
T Consensus       108 ~L~~GD~I~v~~~~g~~~~Y~V~~~~iV~~~d  139 (174)
T TIGR03784       108 ELRPGDVIRLQTPDGQWQSYQVTATRVVDESE  139 (174)
T ss_pred             hCCCCCEEEEEECCCeEEEEEEeEEEEECCcc
Confidence            78999999998777765444333334455544


No 154
>cd05281 TDH Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=29.36  E-value=43  Score=25.83  Aligned_cols=24  Identities=42%  Similarity=0.432  Sum_probs=18.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|+...         ..++||+|..
T Consensus        64 e~~G~V~~~G~~v~---------~~~~Gd~V~~   87 (341)
T cd05281          64 EFAGEVVEVGEGVT---------RVKVGDYVSA   87 (341)
T ss_pred             ceEEEEEEECCCCC---------CCCCCCEEEE
Confidence            46899999997542         3689999975


No 155
>smart00392 PROF Profilin. Binds actin monomers, membrane polyphosphoinositides and poly-L-proline.
Probab=29.20  E-value=56  Score=22.58  Aligned_cols=18  Identities=17%  Similarity=0.372  Sum_probs=15.0

Q ss_pred             eEEEECCEEEEEEecCcE
Q psy12951         86 TKIEVEGQELHLFKEADL  103 (111)
Q Consensus        86 ~~v~~~g~~y~iv~~~DI  103 (111)
                      .=+.++|++|+++|.+|.
T Consensus        62 ~Gi~l~G~Ky~~~~~d~~   79 (129)
T smart00392       62 NGLTLGGQKYMVIRADDR   79 (129)
T ss_pred             CCeEECCeEEEEEEecCc
Confidence            458999999999998764


No 156
>PF06560 GPI:  Glucose-6-phosphate isomerase (GPI);  InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5.3.1.9 from EC), which are involved in glycolysis and in gluconeogenesis and catalyse the conversion of D-glucose 6-phosphate to D-fructose 6-phosphate. The deduced amino acid sequence of the first archaeal PGI isolated from Pyrococcus furiosus revealed that it is not related to its eukaryotic and many of its bacterial counterparts. In contrast, this archaeal PGI shares similarity with the cupin superfamily that consists of a variety of proteins that are generally involved in sugar metabolism in both prokaryotes and eukaryotes [].; GO: 0004347 glucose-6-phosphate isomerase activity, 0006094 gluconeogenesis, 0006096 glycolysis, 0005737 cytoplasm; PDB: 1J3Q_B 1J3R_B 1J3P_A 2GC0_A 1X8E_A 1X82_A 1QY4_B 2GC2_B 1QXJ_A 1QXR_B ....
Probab=29.11  E-value=76  Score=23.85  Aligned_cols=50  Identities=24%  Similarity=0.269  Sum_probs=27.2

Q ss_pred             eeeEEEEe--cCceeC---CCC----eeecceeeeCCEEEccCCCc-eEEEECCEEEEEE
Q psy12951         49 NNAVVVAV--GPGART---PNG----EYIKPVVNVGDKVLLPKFGG-TKIEVEGQELHLF   98 (111)
Q Consensus        49 ~~G~VvaV--G~G~~~---~~G----~~~p~~vk~GD~Vl~~~y~g-~~v~~~g~~y~iv   98 (111)
                      ..++|-.+  |.|...   .+|    +.....+++||.|+.|++-+ ..|..+++.+.+.
T Consensus        82 ~~pEvY~vl~G~g~~lLq~~~~~~~~~~~~v~~~~G~~v~IPp~yaH~tIN~g~~~L~~~  141 (182)
T PF06560_consen   82 SYPEVYEVLSGEGLILLQKEEGDDVGDVIAVEAKPGDVVYIPPGYAHRTINTGDEPLVFA  141 (182)
T ss_dssp             T--EEEEEEESSEEEEEE-TTS-----EEEEEE-TTEEEEE-TT-EEEEEE-SSS-EEEE
T ss_pred             CCCcEEEEEeCEEEEEEEecCCCcceeEEEEEeCCCCEEEECCCceEEEEECCCCcEEEE
Confidence            34555444  444432   455    55667899999999999554 7777777666543


No 157
>PRK04190 glucose-6-phosphate isomerase; Provisional
Probab=28.76  E-value=1.1e+02  Score=23.03  Aligned_cols=35  Identities=20%  Similarity=0.254  Sum_probs=24.4

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEEEE-CCEEEEE
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKIEV-EGQELHL   97 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v~~-~g~~y~i   97 (111)
                      .+|+.....+++||.|+++.+..-.+.. +++.+.+
T Consensus       115 ~~G~~~~~~v~pGd~v~IPpg~~H~~iN~G~epl~f  150 (191)
T PRK04190        115 PEGEARWIEMEPGTVVYVPPYWAHRSVNTGDEPLVF  150 (191)
T ss_pred             CCCcEEEEEECCCCEEEECCCCcEEeEECCCCCEEE
Confidence            3455556789999999999988766655 3344443


No 158
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=28.67  E-value=27  Score=24.37  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=10.8

Q ss_pred             eeeeCCEEEccC
Q psy12951         71 VVNVGDKVLLPK   82 (111)
Q Consensus        71 ~vk~GD~Vl~~~   82 (111)
                      .+|+||+++|+.
T Consensus        33 ~ik~GD~IiF~~   44 (111)
T COG4043          33 QIKPGDKIIFNG   44 (111)
T ss_pred             CCCCCCEEEEcC
Confidence            699999999985


No 159
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]
Probab=28.50  E-value=57  Score=29.43  Aligned_cols=31  Identities=29%  Similarity=0.396  Sum_probs=22.3

Q ss_pred             ceeeEEEEecCceeC---CCCeeecceeeeCCEEE
Q psy12951         48 VNNAVVVAVGPGART---PNGEYIKPVVNVGDKVL   79 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~---~~G~~~p~~vk~GD~Vl   79 (111)
                      |.-|+|+. |.+..+   -+||-.|...++||.|+
T Consensus       245 PvDG~V~~-G~s~vDeS~iTGEs~PV~k~~Gd~V~  278 (713)
T COG2217         245 PVDGVVVS-GSSSVDESMLTGESLPVEKKPGDEVF  278 (713)
T ss_pred             cCCeEEEe-CcEEeecchhhCCCCCEecCCCCEEe
Confidence            55566665 333443   36999999999999997


No 160
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=28.46  E-value=31  Score=22.63  Aligned_cols=15  Identities=27%  Similarity=0.310  Sum_probs=12.5

Q ss_pred             ceeeeCCEEEccCCC
Q psy12951         70 PVVNVGDKVLLPKFG   84 (111)
Q Consensus        70 ~~vk~GD~Vl~~~y~   84 (111)
                      +.||.||.|++.+-.
T Consensus         4 L~Vk~Gd~ViV~~~~   18 (75)
T PF11302_consen    4 LSVKPGDTVIVQDEQ   18 (75)
T ss_pred             cccCCCCEEEEecCc
Confidence            379999999998755


No 161
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=28.16  E-value=1.1e+02  Score=21.28  Aligned_cols=34  Identities=21%  Similarity=0.281  Sum_probs=16.1

Q ss_pred             eeeeCCEEEccC-CCceEEEECCE-EEEEEecCcEE
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQ-ELHLFKEADLL  104 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~-~y~iv~~~DIl  104 (111)
                      .+++||.|+-.. .-|+=++++++ .++.+..+.+.
T Consensus        36 sLk~GD~VvT~GGi~G~V~~I~~~~~~v~le~~gv~   71 (113)
T PRK06531         36 AIQKGDEVVTIGGLYGTVDEVDTEAKTIVLDVDGVY   71 (113)
T ss_pred             hcCCCCEEEECCCcEEEEEEEecCCCEEEEEECCEE
Confidence            466666666433 44544444432 34444333333


No 162
>PF01455 HupF_HypC:  HupF/HypC family;  InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HupF/HypC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process []. They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation [, ].; PDB: 3D3R_A 2Z1C_C 2OT2_A.
Probab=28.06  E-value=64  Score=20.31  Aligned_cols=12  Identities=50%  Similarity=0.601  Sum_probs=7.8

Q ss_pred             eeeeCCEEEccC
Q psy12951         71 VVNVGDKVLLPK   82 (111)
Q Consensus        71 ~vk~GD~Vl~~~   82 (111)
                      ++++||.|+..-
T Consensus        37 ~v~~Gd~VLVHa   48 (68)
T PF01455_consen   37 DVKVGDYVLVHA   48 (68)
T ss_dssp             SB-TT-EEEEET
T ss_pred             CCCCCCEEEEec
Confidence            589999999743


No 163
>PRK12278 50S ribosomal protein L21/unknown domain fusion protein; Provisional
Probab=28.00  E-value=2.3e+02  Score=21.99  Aligned_cols=21  Identities=24%  Similarity=0.461  Sum_probs=14.6

Q ss_pred             eeeeCCEEEccCCC---ceEEEEC
Q psy12951         71 VVNVGDKVLLPKFG---GTKIEVE   91 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~---g~~v~~~   91 (111)
                      -|..||.+...+..   |.+|+|+
T Consensus        13 kV~~Gd~i~Vekl~~~~G~~i~~~   36 (221)
T PRK12278         13 KVQAGDLLRVEKLAAEAGETVQFG   36 (221)
T ss_pred             EEeCCCEEEEeccCCCCCCEEEEe
Confidence            57788888877643   5666665


No 164
>TIGR02876 spore_yqfD sporulation protein YqfD. YqfD is part of the sigma-E regulon in the sporulation program of endospore-forming Gram-positive bacteria. Mutation results in a sporulation defect in Bacillus subtilis. Members are found in all currently known endospore-forming bacteria, including the genera Bacillus, Symbiobacterium, Carboxydothermus, Clostridium, and Thermoanaerobacter.
Probab=27.92  E-value=1.9e+02  Score=23.86  Aligned_cols=36  Identities=28%  Similarity=0.411  Sum_probs=21.7

Q ss_pred             eeeeCCEEEccC--CCceEEEECCEEEEEEecCcEEEEe
Q psy12951         71 VVNVGDKVLLPK--FGGTKIEVEGQELHLFKEADLLAVI  107 (111)
Q Consensus        71 ~vk~GD~Vl~~~--y~g~~v~~~g~~y~iv~~~DIlavi  107 (111)
                      .|++||.|-=.+  -+|. +..+|..+++-...||.|..
T Consensus       208 ~Vk~GD~VkkGqvLIsG~-i~~~~~~~~v~A~g~V~a~t  245 (382)
T TIGR02876       208 VVKKGDVVKKGDLLISGI-LGKEGKTYTVHAEGEVFART  245 (382)
T ss_pred             EEccCCEEcCCCEEEEeE-eCCCCceEEEccceEEEEEE
Confidence            577777776544  2343 44455555556677787765


No 165
>PF13856 Gifsy-2:  ATP-binding sugar transporter from pro-phage; PDB: 2PP6_A.
Probab=27.55  E-value=1.2e+02  Score=19.77  Aligned_cols=33  Identities=12%  Similarity=0.090  Sum_probs=17.8

Q ss_pred             eecceeeeCCEEEccCCCceEEEECCEEEEEEecC
Q psy12951         67 YIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEA  101 (111)
Q Consensus        67 ~~p~~vk~GD~Vl~~~y~g~~v~~~g~~y~iv~~~  101 (111)
                      -.-+.|+..|.--  +--|..|.+||+.|.+-+..
T Consensus        53 ~~~L~v~~~d~~~--P~~gd~v~~dG~~y~V~~~~   85 (95)
T PF13856_consen   53 QPTLYVFSSDYPK--PRRGDRVVIDGESYTVTRFQ   85 (95)
T ss_dssp             -EEEEE--SS-------TT-EEEETTEEEEEEEEE
T ss_pred             ceEEEEEcCCCCC--CCCCCEEEECCeEEEEeEEe
Confidence            3445677777322  55578889999999987643


No 166
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family. Members of this family are putative quinone oxidoreductases that belong to the broader superfamily (modeled by Pfam pfam00107) of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxiooreductases. The alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, and members are likely to be quinone oxidoreductases instead. A member of this family in Homo sapiens, PIG3, is induced by p53 but is otherwise uncharacterized.
Probab=27.52  E-value=50  Score=24.38  Aligned_cols=25  Identities=40%  Similarity=0.420  Sum_probs=19.1

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|+...         .+++||+|+--
T Consensus        64 e~~G~v~~vg~~~~---------~~~~Gd~V~~~   88 (325)
T TIGR02824        64 EVAGEVVAVGEGVS---------RWKVGDRVCAL   88 (325)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46799999997543         46899999863


No 167
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=27.45  E-value=51  Score=24.69  Aligned_cols=25  Identities=36%  Similarity=0.457  Sum_probs=19.5

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        63 e~~G~v~~~g~~~~---------~~~~G~~V~~~   87 (337)
T cd08275          63 ECAGTVEAVGEGVK---------DFKVGDRVMGL   87 (337)
T ss_pred             eeEEEEEEECCCCc---------CCCCCCEEEEe
Confidence            46799999997654         46889999864


No 168
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts et
Probab=26.50  E-value=52  Score=24.10  Aligned_cols=26  Identities=46%  Similarity=0.565  Sum_probs=20.0

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      ...|.|+++|++..         .+++||+|....
T Consensus        66 e~~G~v~~~G~~~~---------~~~~G~~V~~~~   91 (309)
T cd05289          66 DVAGVVVAVGPGVT---------GFKVGDEVFGMT   91 (309)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEEcc
Confidence            46799999997653         468899998654


No 169
>PRK10689 transcription-repair coupling factor; Provisional
Probab=25.91  E-value=87  Score=29.78  Aligned_cols=31  Identities=29%  Similarity=0.449  Sum_probs=24.1

Q ss_pred             eeeeCCEEEccCCC-c-----eEEEECC--EEEEEEecC
Q psy12951         71 VVNVGDKVLLPKFG-G-----TKIEVEG--QELHLFKEA  101 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~-g-----~~v~~~g--~~y~iv~~~  101 (111)
                      ++++||.|++.+|+ |     ..++++|  .+|+.+...
T Consensus       476 ~l~~Gd~VVh~~~Gig~~~gi~~~~~~g~~~~~~~l~y~  514 (1147)
T PRK10689        476 ELHPGQPVVHLEHGVGRYAGMTTLEAGGIKGEYLMLTYA  514 (1147)
T ss_pred             hCCCCCEEEecCCCeEEEeeEEEEecCCcceeEEEEEEC
Confidence            89999999999988 3     3456666  688887653


No 170
>PF07378 FlbT:  Flagellar protein FlbT;  InterPro: IPR009967 This family consists of several FlbT proteins. FlbT is a post-transcriptional repressor function in flagellum biogenesis. FlbT is associated with the 5' untranslated region (UTR) of fljK (25 kDa flagellin) mRNA and that this association requires a predicted loop structure in the transcript. Mutations within this loop abolish FlbT association and result in increased mRNA stability. It is therefore thought that FlbT promotes the degradation of flagellin mRNA by associating with the 5' UTR [].; GO: 0048027 mRNA 5'-UTR binding, 0006402 mRNA catabolic process, 0045718 negative regulation of flagellum assembly
Probab=25.69  E-value=57  Score=23.10  Aligned_cols=34  Identities=18%  Similarity=0.440  Sum_probs=22.0

Q ss_pred             ceeeeCCEEEccC------CCceEEEECCEEEEEEecCcEE
Q psy12951         70 PVVNVGDKVLLPK------FGGTKIEVEGQELHLFKEADLL  104 (111)
Q Consensus        70 ~~vk~GD~Vl~~~------y~g~~v~~~g~~y~iv~~~DIl  104 (111)
                      ..+|+|.+++.+.      -.-..+.+.++ --|+|++|||
T Consensus         3 l~LkpgERi~INGAVi~N~drr~~l~i~n~-a~~Lre~dil   42 (126)
T PF07378_consen    3 LSLKPGERIIINGAVIRNGDRRSTLEIEND-APFLREKDIL   42 (126)
T ss_pred             eeecCCCEEEEcCeEEEeCCCceEEEEecC-CceechhccC
Confidence            3577888887754      11245556555 6678888876


No 171
>PRK02268 hypothetical protein; Provisional
Probab=25.39  E-value=34  Score=24.83  Aligned_cols=16  Identities=19%  Similarity=0.297  Sum_probs=11.6

Q ss_pred             Ceeecc-eeeeCCEEEc
Q psy12951         65 GEYIKP-VVNVGDKVLL   80 (111)
Q Consensus        65 G~~~p~-~vk~GD~Vl~   80 (111)
                      |+..|+ -+|+||.++|
T Consensus        28 gK~apl~RmkpGD~ivy   44 (141)
T PRK02268         28 GKAAPLRRMKPGDWIIY   44 (141)
T ss_pred             CccchhhcCCCCCEEEE
Confidence            334444 6899999997


No 172
>cd04451 S1_IF1 S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the formation of the first peptide bond. In Escherichia coli, the initiation mechanism requires, in addition to mRNA, fMet-tRNA, and ribosomal subunits,  the presence of three additional proteins (initiation factors IF1, IF2, and IF3) and at least one GTP molecule. The three initiation factors influence both the kinetics and the stability of ternary complex formation. IF1 is the smallest of the three factors. IF1 enhances the rate of 70S ribosome subunit association and dissociation and the interaction of 30S ribosomal subunit with IF2 and IF3. It stimulates 30S complex formation. In addition, by binding to the A-site of the 30S ribosomal subunit, IF1 may contribute to the fidelity of the selection of the initiation site of th
Probab=24.80  E-value=45  Score=20.15  Aligned_cols=11  Identities=27%  Similarity=0.392  Sum_probs=9.6

Q ss_pred             eeeeCCEEEcc
Q psy12951         71 VVNVGDKVLLP   81 (111)
Q Consensus        71 ~vk~GD~Vl~~   81 (111)
                      .+.+||.|.|.
T Consensus        40 ~~~vGD~V~~~   50 (64)
T cd04451          40 RILPGDRVKVE   50 (64)
T ss_pred             ccCCCCEEEEE
Confidence            47899999988


No 173
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=24.78  E-value=61  Score=24.30  Aligned_cols=25  Identities=40%  Similarity=0.538  Sum_probs=18.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+++|+...         .+++||+|+-.
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (336)
T cd08276          64 DGAGEVVAVGEGVT---------RFKVGDRVVPT   88 (336)
T ss_pred             ceeEEEEEeCCCCc---------CCCCCCEEEEe
Confidence            45799999997543         36789998864


No 174
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=24.44  E-value=21  Score=24.13  Aligned_cols=25  Identities=28%  Similarity=0.349  Sum_probs=13.5

Q ss_pred             EEEEecCceeCCCCeeecceeeeCCEEEccC
Q psy12951         52 VVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        52 ~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      .|+++.+|...      ...+++||+|.|++
T Consensus        84 ~vLE~~aG~~~------~~~i~~Gd~v~~~~  108 (108)
T PF02643_consen   84 YVLELPAGWFE------KLGIKVGDRVRIEP  108 (108)
T ss_dssp             EEEEEETTHHH------HHT--TT-EEE---
T ss_pred             EEEEcCCCchh------hcCCCCCCEEEecC
Confidence            38888877652      33599999998763


No 175
>PF03293 Pox_RNA_pol:  Poxvirus DNA-directed RNA polymerase, 18 kD subunit;  InterPro: IPR004973 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The Poxvirus DNA-directed RNA polymerase (2.7.7.6 from EC) catalyses DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. The enzyme consists of at least eight subunits, this is the 18 kDa subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0019083 viral transcription
Probab=24.42  E-value=1.8e+02  Score=21.54  Aligned_cols=34  Identities=9%  Similarity=0.173  Sum_probs=20.6

Q ss_pred             eeeeCCEEEccCCCceEEEECCEEEEEEecCcEE
Q psy12951         71 VVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLL  104 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~v~~~g~~y~iv~~~DIl  104 (111)
                      .|.-||.|---.-..-.|.|++.+|.|+|...+.
T Consensus        98 ~V~CgDLiCkl~rdsGtVSf~dsKYCfirNg~vY  131 (160)
T PF03293_consen   98 TVQCGDLICKLSRDSGTVSFNDSKYCFIRNGVVY  131 (160)
T ss_pred             EEEcCcEEEEeeccCCeEEecCceEEEEECCEEe
Confidence            4555666543222223477888888888876543


No 176
>PF12852 Cupin_6:  Cupin
Probab=24.38  E-value=60  Score=23.19  Aligned_cols=25  Identities=28%  Similarity=0.291  Sum_probs=17.4

Q ss_pred             CCeeecceeeeCCEEEccCCCceEE
Q psy12951         64 NGEYIKPVVNVGDKVLLPKFGGTKI   88 (111)
Q Consensus        64 ~G~~~p~~vk~GD~Vl~~~y~g~~v   88 (111)
                      +|...|..+..||.|+++.=..-.+
T Consensus        51 ~~~~~~~~L~~GDivllp~g~~H~l   75 (186)
T PF12852_consen   51 PGGGEPIRLEAGDIVLLPRGTAHVL   75 (186)
T ss_pred             cCCCCeEEecCCCEEEEcCCCCeEe
Confidence            3433677899999999987544333


No 177
>PF11948 DUF3465:  Protein of unknown function (DUF3465);  InterPro: IPR021856  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 131 to 151 amino acids in length. This protein has a conserved HWTH sequence motif. 
Probab=24.37  E-value=1.1e+02  Score=22.11  Aligned_cols=11  Identities=27%  Similarity=0.320  Sum_probs=9.1

Q ss_pred             eeeeCCEEEcc
Q psy12951         71 VVNVGDKVLLP   81 (111)
Q Consensus        71 ~vk~GD~Vl~~   81 (111)
                      .+++||+|-|.
T Consensus        85 ~l~~GD~V~f~   95 (131)
T PF11948_consen   85 WLQKGDQVEFY   95 (131)
T ss_pred             CcCCCCEEEEE
Confidence            58999999874


No 178
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=24.07  E-value=98  Score=28.75  Aligned_cols=32  Identities=31%  Similarity=0.495  Sum_probs=24.1

Q ss_pred             ceeeeCCEEEccCCC-c-----eEEEECC--EEEEEEecC
Q psy12951         70 PVVNVGDKVLLPKFG-G-----TKIEVEG--QELHLFKEA  101 (111)
Q Consensus        70 ~~vk~GD~Vl~~~y~-g-----~~v~~~g--~~y~iv~~~  101 (111)
                      .++++||.|++.+|+ |     ..++++|  .+|+.++..
T Consensus       326 ~~l~~Gd~VVh~~~Gig~~~gi~~~~~~g~~~dy~~l~y~  365 (926)
T TIGR00580       326 NELNPGDYVVHLDHGIGRFLGLETLEVGGIERDYLVLEYA  365 (926)
T ss_pred             hhCCCCCEEEecCCCeEEEeeEEEEecCCcceeEEEEEEC
Confidence            489999999999988 3     3456666  588887643


No 179
>cd06820 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like. This subfamily is composed of uncharacterized bacterial proteins with similarity to low specificity D-threonine aldolase (D-TA), which is a fold type III PLP-dependent enzyme that catalyzes the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Low specificity D-TAs show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exh
Probab=23.99  E-value=1.1e+02  Score=24.27  Aligned_cols=37  Identities=16%  Similarity=0.284  Sum_probs=27.5

Q ss_pred             eeeeCCEEEccC-CCceEEEECCEEEEEEecCcEEEEee
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLLAVIE  108 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~~y~iv~~~DIlavi~  108 (111)
                      .+++||+|.|-. |+..-+..= ..|++++.+.+..+|.
T Consensus       311 ~~~vGd~i~~~p~h~c~t~~~~-~~~~~~~~~~v~~~w~  348 (353)
T cd06820         311 LPRVGDRVRVVPNHACVVVNLV-DEVYLVDGGEVVETWP  348 (353)
T ss_pred             CCCCCCEEEEECCCcCcchhcC-CEEEEEECCEEEEEEE
Confidence            479999999977 766655544 4588888887877764


No 180
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B. aeIF5B is a homologue of prokaryotic Initiation Factor 2 (IF2).  Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of joining of 60S subunits.  The eIF5B consists of three N-terminal domains  (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains of EF1A, eEF1A and aeIF2gamma.
Probab=23.59  E-value=97  Score=21.50  Aligned_cols=19  Identities=26%  Similarity=0.567  Sum_probs=15.0

Q ss_pred             eeeeCCEEEccCCCc---eEEE
Q psy12951         71 VVNVGDKVLLPKFGG---TKIE   89 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g---~~v~   89 (111)
                      .+++||+|++....|   +.|+
T Consensus        26 tL~~GD~Iv~g~~~Gpi~tkVR   47 (110)
T cd03703          26 TLREGDTIVVCGLNGPIVTKVR   47 (110)
T ss_pred             eEecCCEEEEccCCCCceEEEe
Confidence            689999999988776   5554


No 181
>CHL00010 infA translation initiation factor 1
Probab=23.39  E-value=1.2e+02  Score=19.44  Aligned_cols=11  Identities=27%  Similarity=0.392  Sum_probs=9.5

Q ss_pred             eeeeCCEEEcc
Q psy12951         71 VVNVGDKVLLP   81 (111)
Q Consensus        71 ~vk~GD~Vl~~   81 (111)
                      .+.+||.|.|.
T Consensus        46 ~~~vGD~V~ve   56 (78)
T CHL00010         46 RILPGDRVKVE   56 (78)
T ss_pred             ccCCCCEEEEE
Confidence            46789999998


No 182
>KOG3309|consensus
Probab=23.36  E-value=24  Score=26.22  Aligned_cols=22  Identities=41%  Similarity=0.489  Sum_probs=18.8

Q ss_pred             eCCCCeeecceeeeCCEEEccC
Q psy12951         61 RTPNGEYIKPVVNVGDKVLLPK   82 (111)
Q Consensus        61 ~~~~G~~~p~~vk~GD~Vl~~~   82 (111)
                      .+.+|+.++...++||.||+--
T Consensus        49 v~~dG~~~~i~g~vGdtlLd~a   70 (159)
T KOG3309|consen   49 VDPDGEEIKIKGKVGDTLLDAA   70 (159)
T ss_pred             ECCCCCEEEeeeecchHHHHHH
Confidence            4579999999999999999743


No 183
>PF06865 DUF1255:  Protein of unknown function (DUF1255);  InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown; PDB: 2OYZ_A 3HQX_A.
Probab=23.15  E-value=1.6e+02  Score=20.00  Aligned_cols=64  Identities=17%  Similarity=0.176  Sum_probs=26.6

Q ss_pred             cceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCC-ceEEEECCEEEEEEecCcEEEEe
Q psy12951         35 KGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG-GTKIEVEGQELHLFKEADLLAVI  107 (111)
Q Consensus        35 ~gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~-g~~v~~~g~~y~iv~~~DIlavi  107 (111)
                      .-|+++|....=.....++..|=.|..         .|+.-+.=-+..|. |..+++.+..-+-++-.++.+-+
T Consensus        26 TlGVm~pGeY~F~T~~~E~M~vvsG~l---------~V~lpg~~ew~~~~aGesF~VpanssF~v~v~~~~~Y~   90 (94)
T PF06865_consen   26 TLGVMLPGEYTFGTSAPERMEVVSGEL---------EVKLPGEDEWQTYSAGESFEVPANSSFDVKVKEPTAYL   90 (94)
T ss_dssp             EEEEE-SECEEEEESS-EEEEEEESEE---------EEEETT-SS-EEEETT-EEEE-TTEEEEEEESS-EEEE
T ss_pred             eEEEEeeeEEEEcCCCCEEEEEEEeEE---------EEEcCCCcccEEeCCCCeEEECCCCeEEEEECcceeeE
Confidence            358888876432233334444444443         23322222222222 56666655544455555555543


No 184
>PF11549 Sec31:  Protein transport protein SEC31;  InterPro: IPR021614  Sec31 is involved in COPII coat formation as it forms through the sequential binding of three cytoplasmic proteins: Sar1, Sec23/24 and Sec13/31. Sec13/31 is recruited by the pre-budding complex and polymerisation of Sec13/31 occurs to form an octahedral cage that is the outer shell of the COPII coat []. Sec13/31 is a hetero-tetramer which is organised as a linear array of alpha-solenoid and beta-propeller domains to form a rod in which twenty-four copies assemble to form the COPII cub-octahedron []. ; PDB: 2QTV_D.
Probab=22.91  E-value=30  Score=21.08  Aligned_cols=19  Identities=32%  Similarity=0.553  Sum_probs=0.8

Q ss_pred             eccCccccceeeEEEEecC
Q psy12951         40 IPEKAQQEVNNAVVVAVGP   58 (111)
Q Consensus        40 LP~~~~~k~~~G~VvaVG~   58 (111)
                      ||...++|+++++-|+|.|
T Consensus        29 Lpl~vkEKpsRAKavsvap   47 (51)
T PF11549_consen   29 LPLKVKEKPSRAKAVSVAP   47 (51)
T ss_dssp             --S----------------
T ss_pred             cchhhhccccccccccccc
Confidence            6777788999999999886


No 185
>cd05794 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with N-formylmethionyl-tRNA and puromycine in vitro. EF-P binds to both the 30S and 50S ribosomal subunits. EF-P binds near the streptomycine binding site of the 16S rRNA in the 30S subunit. EF-P interacts with domains 2 and 5 of the 23S rRNA. The L16 ribosomal protein of the 50S or its N-terminal fragment are required for EF-P mediated peptide bond synthesis, whereas L11, L15, and L7/L12 are not required in this reaction, suggesting that EF-P may function at a different ribosomal site than most other translation factors. EF-P is essential for cell viability and is required for protein synthesis. EF-P is mainly present in bacteria. The EF-P homologs in archaea and eukaryotes are the initiation factors aIF5A and eIF5A, respectively. EF-P 
Probab=22.88  E-value=56  Score=20.08  Aligned_cols=17  Identities=12%  Similarity=0.251  Sum_probs=12.3

Q ss_pred             ecceeeeCCEEEccCCC
Q psy12951         68 IKPVVNVGDKVLLPKFG   84 (111)
Q Consensus        68 ~p~~vk~GD~Vl~~~y~   84 (111)
                      +|+.++.||+|..+--.
T Consensus        34 VP~FI~~Gd~I~V~T~~   50 (56)
T cd05794          34 VPLFIKEGEKIKVDTRT   50 (56)
T ss_pred             cCCeecCCCEEEEECCC
Confidence            57788888888775433


No 186
>PRK13914 invasion associated secreted endopeptidase; Provisional
Probab=22.78  E-value=61  Score=28.05  Aligned_cols=35  Identities=14%  Similarity=0.255  Sum_probs=21.3

Q ss_pred             ceEEeccCccccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCC
Q psy12951         36 GGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKF   83 (111)
Q Consensus        36 gGIiLP~~~~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y   83 (111)
                      .||.||..+......|      ....       ..++++||.|+|...
T Consensus       404 ~GI~LPR~s~~Q~~~G------~~Vs-------~selqpGDLVFF~~~  438 (481)
T PRK13914        404 AGISLPRTSGAQYAST------TRIS-------ESQAKPGDLVFFDYG  438 (481)
T ss_pred             cCCCCCCChHHHHhcC------cccc-------cccCCCCCEEEeCCC
Confidence            5899998764322222      1111       126889999999743


No 187
>PF00924 MS_channel:  Mechanosensitive ion channel;  InterPro: IPR006685 Mechanosensitive (MS) channels provide protection against hypo-osmotic shock, responding both to stretching of the cell membrane and to membrane depolarisation. They are present in the membranes of organisms from the three domains of life: bacteria, archaea, and eukarya []. There are two families of MS channels: large-conductance MS channels (MscL) and small-conductance MS channels (MscS or YGGB). The pressure threshold for MscS opening is 50% that of MscL []. The MscS family is much larger and more variable in size and sequence than the MscL family. Much of the diversity in MscS proteins occurs in the size of the transmembrane regions, which ranges from three to eleven transmembrane helices, although the three C-terminal helices are conserved. This family contains sequences form the MscS family of proteins. MscS folds as a homo-heptamer with a cylindrical shape, and can be divided into transmembrane and extramembrane regions: an N-terminal periplasmic region, a transmembrane region, and a C-terminal cytoplasmic region (middle and C-terminal domains). The transmembrane region forms a channel through the membrane that opens into a chamber enclosed by the extramembrane portion, the latter connecting to the cytoplasm through distinct portals [].; GO: 0055085 transmembrane transport, 0016020 membrane; PDB: 2OAU_E 2VV5_F.
Probab=22.77  E-value=1.2e+02  Score=21.65  Aligned_cols=21  Identities=24%  Similarity=0.384  Sum_probs=13.6

Q ss_pred             eeeeCCEEEccCCCceEEEEC
Q psy12951         71 VVNVGDKVLLPKFGGTKIEVE   91 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~v~~~   91 (111)
                      ++++||+|.++.+.|.-.+++
T Consensus        60 pf~vGD~I~i~~~~G~V~~I~   80 (206)
T PF00924_consen   60 PFKVGDRIEIGGVEGRVEEIG   80 (206)
T ss_dssp             SS-TT-EEESSS-EEEEEEE-
T ss_pred             CccCCCEEEEEEeehHHHhcC
Confidence            578999999999888665554


No 188
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=22.42  E-value=2.1e+02  Score=19.85  Aligned_cols=8  Identities=25%  Similarity=0.505  Sum_probs=3.8

Q ss_pred             eeEEEEec
Q psy12951         50 NAVVVAVG   57 (111)
Q Consensus        50 ~G~VvaVG   57 (111)
                      .|+|++++
T Consensus        52 ~G~V~~I~   59 (109)
T PRK05886         52 QATIVGIT   59 (109)
T ss_pred             EEEEEEEe
Confidence            44444444


No 189
>PRK12426 elongation factor P; Provisional
Probab=22.41  E-value=1.3e+02  Score=22.67  Aligned_cols=40  Identities=18%  Similarity=0.303  Sum_probs=27.8

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEEEE---CCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKIEV---EGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v~~---~g~~y~iv~~~D  102 (111)
                      .+|..+...++.||++---...-.+.+|   ||+.|.||..++
T Consensus        45 ~tG~~~e~tf~s~ek~e~a~ve~~~~qylY~dg~~~~FMd~et   87 (185)
T PRK12426         45 DSDVVVERNFKAGQEVKEAQFEPRNLEYLYLEGDEYLFLDLGN   87 (185)
T ss_pred             CCCCeEEEEECCCCeEEEeEEEeeEeEEEEECCCeEEEecCCC
Confidence            4566666688889988665555555544   788888887653


No 190
>PHA02951 Hypothetical protein; Provisional
Probab=22.34  E-value=4.6e+02  Score=21.78  Aligned_cols=84  Identities=18%  Similarity=0.176  Sum_probs=49.8

Q ss_pred             ccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCce---eCCCCeeecceeeeCCEEEccCCCceEE-
Q psy12951         13 SQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGA---RTPNGEYIKPVVNVGDKVLLPKFGGTKI-   88 (111)
Q Consensus        13 ~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~---~~~~G~~~p~~vk~GD~Vl~~~y~g~~v-   88 (111)
                      ...+.-..|--||+..--+.-+.+-+++|.++.   ..+++==--.|.   ..++-......+.+||.++++-+-|..+ 
T Consensus        92 ~eg~Fev~d~~lVkLkHGn~f~~~~~~~~~s~g---FvAtICIKNeGiSgl~Vp~t~~LK~ni~~GD~IVsRs~rGv~fL  168 (337)
T PHA02951         92 RDGNFRPADCFLVKLKHGNGFTKGALYLGHSAG---FTATICLKNEGISGLYIPGTSVLKINICQGDTIVSRSSRGVQFL  168 (337)
T ss_pred             ccCceeeeeeEEEEeecCchhhccccccCCccc---eEEEEEEcCCCeeEEEeCCCchheeeeccCcEEEEeccccceec
Confidence            344455677788888877777777777777642   111111111111   1111122233677899999999988877 


Q ss_pred             -EECCE-EEEEEe
Q psy12951         89 -EVEGQ-ELHLFK   99 (111)
Q Consensus        89 -~~~g~-~y~iv~   99 (111)
                       ++.|+ .|++++
T Consensus       169 PQIGGeaiYLIVs  181 (337)
T PHA02951        169 PQIGGEAIYLVVS  181 (337)
T ss_pred             cccCceeEEEEEE
Confidence             67776 677664


No 191
>PF13375 RnfC_N:  RnfC Barrel sandwich hybrid domain
Probab=22.34  E-value=92  Score=21.01  Aligned_cols=11  Identities=73%  Similarity=0.978  Sum_probs=7.0

Q ss_pred             ceeeeCCEEEc
Q psy12951         70 PVVNVGDKVLL   80 (111)
Q Consensus        70 ~~vk~GD~Vl~   80 (111)
                      +.|++||+|.-
T Consensus        44 p~V~~Gd~V~~   54 (101)
T PF13375_consen   44 PVVKVGDKVKK   54 (101)
T ss_pred             EEEcCCCEEcC
Confidence            36677777754


No 192
>PRK12784 hypothetical protein; Provisional
Probab=22.24  E-value=1e+02  Score=20.57  Aligned_cols=23  Identities=35%  Similarity=0.343  Sum_probs=17.8

Q ss_pred             EEEEecCceeCCCCeeecceeeeCCEEE
Q psy12951         52 VVVAVGPGARTPNGEYIKPVVNVGDKVL   79 (111)
Q Consensus        52 ~VvaVG~G~~~~~G~~~p~~vk~GD~Vl   79 (111)
                      +.|++|     -+|.+....|.+||.|.
T Consensus        44 e~v~vG-----iSG~I~~v~Ve~Gq~i~   66 (84)
T PRK12784         44 EKVAVG-----ISGNIRLVNVVVGQQIH   66 (84)
T ss_pred             EEEEEe-----eeeeEEEEEeecCceec
Confidence            456777     26888888999999876


No 193
>PHA02965 hypothetical protein; Provisional
Probab=22.20  E-value=2.6e+02  Score=23.73  Aligned_cols=82  Identities=11%  Similarity=0.027  Sum_probs=51.2

Q ss_pred             cccceeeeCCeEEEEecCCCCcccceEEeccCcccc-----ceeeE-EEEecCceeCCCCeeecceeeeCCEEEccCCCc
Q psy12951         12 LSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQE-----VNNAV-VVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG   85 (111)
Q Consensus        12 ~~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k-----~~~G~-VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g   85 (111)
                      +...+.-..|--||+..--+.-+.+-++.|.++.=-     -+.|. ++.|-      +-.........||.++++.+-|
T Consensus       119 D~ngyFeVsD~~LVKL~HGN~fm~~~~y~~~sagF~AvICIKNeG~S~I~Vn------hc~~kqHsMq~Gd~II~RSsRG  192 (466)
T PHA02965        119 DGNKYFEVKDIKILQLAHGNDLMNIDKYDDGFFDFIAVICIKNSGRSMIMLK------HCNGKQHSMQDGFCLIARSFYG  192 (466)
T ss_pred             cccCceeecceEEEEeeccCcccccccccCCccceEEEEEEccCCceEEEec------ccccceeeeccccEEEEeccch
Confidence            344455567888999888788888888888875311     11121 12221      1111122456999999999988


Q ss_pred             eEE--EECCE-EEEEEe
Q psy12951         86 TKI--EVEGQ-ELHLFK   99 (111)
Q Consensus        86 ~~v--~~~g~-~y~iv~   99 (111)
                      ..+  .+.|+ .|++++
T Consensus       193 I~FLPQIgGeA~YLIVs  209 (466)
T PHA02965        193 INILPQIIGESRYLILK  209 (466)
T ss_pred             hhhhhhhCCceEEEEEE
Confidence            777  56665 788775


No 194
>PRK10861 signal peptidase I; Provisional
Probab=22.03  E-value=3e+02  Score=22.48  Aligned_cols=67  Identities=19%  Similarity=0.097  Sum_probs=33.2

Q ss_pred             eCCeEEEEecCCCCcccceEEeccCc-----cccceeeEEEEecCceeCCCCeeecceeeeCCEEEccCCCceEEEECC
Q psy12951         19 LLDRILVIKDEPLTKTKGGVLIPEKA-----QQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEG   92 (111)
Q Consensus        19 lgDrVLVk~~~~e~~T~gGIiLP~~~-----~~k~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g   92 (111)
                      -||+|||.+..-      |+-+|-..     ...+..|-||-.-.-.....-=....-=.+||+|.|....+ .+.+||
T Consensus        98 ~GD~IlVnK~~y------g~~~p~~~~~~~~~~~p~RGDIVVF~~P~~~~~~yIKRVIGlPGD~I~~~~~~~-~l~iNg  169 (324)
T PRK10861         98 IGDFILVEKFAY------GIKDPITQTTLIETGHPKRGDIVVFKYPEDPKLDYIKRVVGLPGDKVTYDPVSK-EVTIQP  169 (324)
T ss_pred             CCCEEEEEEeec------CccCccccccccccCCCCCCCEEEEecCCCCCCcEEEEeeecCCcEEEEEeCCC-EEEEcC
Confidence            699999999632      22222111     13467787777642110000011222345789988863222 344444


No 195
>COG0261 RplU Ribosomal protein L21 [Translation, ribosomal structure and biogenesis]
Probab=21.86  E-value=2.8e+02  Score=19.17  Aligned_cols=30  Identities=27%  Similarity=0.500  Sum_probs=16.2

Q ss_pred             eeeeCCEEEccCCC---ceEEEECCEEEEEEecCc
Q psy12951         71 VVNVGDKVLLPKFG---GTKIEVEGQELHLFKEAD  102 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~---g~~v~~~g~~y~iv~~~D  102 (111)
                      -|..||.+...+..   |.+|+||  +-+++..++
T Consensus        13 kV~~G~~i~vEkl~~e~g~~v~f~--~VL~v~~~~   45 (103)
T COG0261          13 KVEEGDVIKVEKLDAEPGDKVEFD--EVLMVGGGE   45 (103)
T ss_pred             EEecCCEEEEEEcCCCCCCEEEEE--EEEEEcCCC
Confidence            46677766665533   5666664  334444443


No 196
>PRK11507 ribosome-associated protein; Provisional
Probab=21.66  E-value=2.3e+02  Score=18.14  Aligned_cols=28  Identities=21%  Similarity=0.372  Sum_probs=14.9

Q ss_pred             eeeeCCEEEccC----CCceEEEECCEEEEEE
Q psy12951         71 VVNVGDKVLLPK----FGGTKIEVEGQELHLF   98 (111)
Q Consensus        71 ~vk~GD~Vl~~~----y~g~~v~~~g~~y~iv   98 (111)
                      .|+++..|-..+    |.|..|+++|+.|.+.
T Consensus        38 ~V~VNGeve~rRgkKl~~GD~V~~~g~~~~v~   69 (70)
T PRK11507         38 QVKVDGAVETRKRCKIVAGQTVSFAGHSVQVV   69 (70)
T ss_pred             ceEECCEEecccCCCCCCCCEEEECCEEEEEe
Confidence            344444444433    5566666666666543


No 197
>PRK00276 infA translation initiation factor IF-1; Validated
Probab=21.56  E-value=57  Score=20.44  Aligned_cols=11  Identities=36%  Similarity=0.431  Sum_probs=9.6

Q ss_pred             eeeeCCEEEcc
Q psy12951         71 VVNVGDKVLLP   81 (111)
Q Consensus        71 ~vk~GD~Vl~~   81 (111)
                      .+.+||.|.|.
T Consensus        46 ~i~vGD~V~ve   56 (72)
T PRK00276         46 RILPGDKVTVE   56 (72)
T ss_pred             ccCCCCEEEEE
Confidence            47899999998


No 198
>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible mem
Probab=21.54  E-value=1.2e+02  Score=24.12  Aligned_cols=37  Identities=8%  Similarity=0.204  Sum_probs=26.6

Q ss_pred             eeeeCCEEEccC-CCceEEEECCEEEEEEecCcEE-EEee
Q psy12951         71 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLL-AVIE  108 (111)
Q Consensus        71 ~vk~GD~Vl~~~-y~g~~v~~~g~~y~iv~~~DIl-avi~  108 (111)
                      .+++||+|.|-. |+..-+..- ..|++++.+.+. .+|.
T Consensus       331 ~~~vGd~v~~~p~H~c~t~~~~-~~~~~v~~~~~~~~~w~  369 (374)
T cd06812         331 DLPIGTRLRILPNHACATAAQH-DHYHVLDGEGVVQATWS  369 (374)
T ss_pred             CCCCCCEEEEeCCccCcchhcC-CEEEEEeCCCEEEEEec
Confidence            589999997755 766555543 468888887777 6664


No 199
>cd07557 trimeric_dUTPase Trimeric dUTP diphosphatases. Trimeric dUTP diphosphatases, or dUTPases, are the most common family of dUTPase, found in bacteria, eukaryotes, and archaea. They catalyze the hydrolysis of the dUTP-Mg complex (dUTP-Mg) into dUMP and pyrophosphate. This reaction is crucial for the preservation of chromosomal integrity as it removes dUTP and therefore reduces the cellular dUTP/dTTP ratio, and prevents dUTP from being incorporated into DNA.  It also provides dUMP as the precursor for dTTP synthesis via the thymidylate synthase pathway. dUTPases are homotrimeric, except some monomeric viral dUTPases, which have been shown to mimic a trimer. Active sites are located at the subunit interface.
Probab=21.50  E-value=1.4e+02  Score=18.80  Aligned_cols=35  Identities=17%  Similarity=0.268  Sum_probs=18.9

Q ss_pred             CCeEEEEecCCCCc--ccceEEeccCccccceeeEEEEe
Q psy12951         20 LDRILVIKDEPLTK--TKGGVLIPEKAQQEVNNAVVVAV   56 (111)
Q Consensus        20 gDrVLVk~~~~e~~--T~gGIiLP~~~~~k~~~G~VvaV   56 (111)
                      ++.++|...+.-..  .-.|.+.|.|...+  .|..+..
T Consensus        19 ~~~~~v~t~~~i~~p~~~~~~i~~RSs~~~--~Gi~v~~   55 (92)
T cd07557          19 GETVLVPTGEAIELPEGYVGLVFPRSSLAR--KGITVHN   55 (92)
T ss_pred             CCEEEEEEeEEEEcCCCeEEEEEcCchhhc--CCEEecC
Confidence            46666655532211  23467777765433  6666665


No 200
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=21.33  E-value=1.3e+02  Score=18.86  Aligned_cols=26  Identities=27%  Similarity=0.410  Sum_probs=16.7

Q ss_pred             eeeeCCEEEccCCCc--eEEEECCEEEE
Q psy12951         71 VVNVGDKVLLPKFGG--TKIEVEGQELH   96 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g--~~v~~~g~~y~   96 (111)
                      .+++||.+.++....  .++..+|....
T Consensus        28 ~L~~Gdvi~L~~~~~~~v~l~v~g~~~~   55 (77)
T TIGR02480        28 KLGEGSVIELDKLAGEPLDILVNGRLIA   55 (77)
T ss_pred             cCCCCCEEEcCCCCCCcEEEEECCEEEE
Confidence            677888888876443  55566775443


No 201
>PF09285 Elong-fact-P_C:  Elongation factor P, C-terminal;  InterPro: IPR015365 These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology []. ; GO: 0043043 peptide biosynthetic process, 0005737 cytoplasm; PDB: 1YBY_A 3OYY_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H.
Probab=21.29  E-value=88  Score=19.18  Aligned_cols=18  Identities=22%  Similarity=0.420  Sum_probs=11.0

Q ss_pred             ecceeeeCCEEEccCCCc
Q psy12951         68 IKPVVNVGDKVLLPKFGG   85 (111)
Q Consensus        68 ~p~~vk~GD~Vl~~~y~g   85 (111)
                      +|..++.||+|..+--.|
T Consensus        34 VP~FI~~Gd~I~VdT~~g   51 (56)
T PF09285_consen   34 VPLFIEEGDKIKVDTRDG   51 (56)
T ss_dssp             EETT--TT-EEEEETTTT
T ss_pred             ccceecCCCEEEEECCCC
Confidence            577889999988776554


No 202
>PF07591 PT-HINT:  Pretoxin HINT domain;  InterPro: IPR011451 This entry represents a cluster of homologous proteins identified in Leptospira interrogans. One member (Q8EZX6 from SWISSPROT) has been predicted to be a phenazine biosynthesis family protein.; PDB: 2JNQ_A 2JMZ_A.
Probab=21.23  E-value=32  Score=24.03  Aligned_cols=19  Identities=32%  Similarity=0.389  Sum_probs=0.0

Q ss_pred             CCCeeecc-eeeeCCEEEccC
Q psy12951         63 PNGEYIKP-VVNVGDKVLLPK   82 (111)
Q Consensus        63 ~~G~~~p~-~vk~GD~Vl~~~   82 (111)
                      .+|. .|. ++++||+|+=.+
T Consensus         5 ~~G~-k~Ie~I~~GD~Vls~d   24 (130)
T PF07591_consen    5 ADGL-KPIEDIKVGDRVLSYD   24 (130)
T ss_dssp             ---------------------
T ss_pred             cccc-cccccccccccccccc
Confidence            3453 344 899999999654


No 203
>PF06236 MelC1:  Tyrosinase co-factor MelC1;  InterPro: IPR010928 This family consists of several tyrosinase co-factor MELC1 proteins from a number of Streptomyces species. The melanin operon (melC) of Streptomyces antibioticus contains two genes, melC1 and melC2 (apotyrosinase). It is thought that MelC1 forms a transient binary complex with the downstream apotyrosinase MelC2 to facilitate the incorporation of copper ion and the secretion of tyrosinase indicating that MelC1 is a chaperone for the apotyrosinase MelC2 [].; GO: 0005507 copper ion binding, 0042438 melanin biosynthetic process; PDB: 1WX4_B 2ZWD_B 2ZMZ_B 1WX2_B 1WX5_D 3AWX_B 3AWS_B 2ZMY_B 3AX0_B 2ZWG_B ....
Probab=21.13  E-value=1.2e+02  Score=21.62  Aligned_cols=18  Identities=33%  Similarity=0.850  Sum_probs=14.3

Q ss_pred             ceEEEECCEEEEEEecCc
Q psy12951         85 GTKIEVEGQELHLFKEAD  102 (111)
Q Consensus        85 g~~v~~~g~~y~iv~~~D  102 (111)
                      +.+|.+||.++.+||..|
T Consensus        70 ~~~V~IDGr~LhvMr~AD   87 (125)
T PF06236_consen   70 GYEVTIDGRPLHVMRRAD   87 (125)
T ss_dssp             SEEEEETTEEE-EEE-TT
T ss_pred             ceEEEECCeEeeeEEcCC
Confidence            578999999999999876


No 204
>PRK04542 elongation factor P; Provisional
Probab=21.13  E-value=1.4e+02  Score=22.53  Aligned_cols=40  Identities=13%  Similarity=0.188  Sum_probs=28.6

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEEEE---CCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKIEV---EGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v~~---~g~~y~iv~~~D  102 (111)
                      .+|..+...++.||+|---...-.+.+|   ||+.|+||..++
T Consensus        47 ~tG~~~e~tfrs~ekve~a~~~~~~~qylY~dg~~~~FMd~et   89 (189)
T PRK04542         47 RTGLKVEERFKGDDILDTVDLTRRPVTFSYIDGDEYVFMDNED   89 (189)
T ss_pred             CCCCeEEEEECCCCeEEEEEEEEeEeEEEEeCCCEEEEecCCC
Confidence            4666666788899988776665555544   778888887753


No 205
>TIGR00061 L21 ribosomal protein L21. Eubacterial and chloroplast.
Probab=21.05  E-value=2.8e+02  Score=18.80  Aligned_cols=21  Identities=29%  Similarity=0.529  Sum_probs=12.9

Q ss_pred             eeeeCCEEEccCCC---ceEEEEC
Q psy12951         71 VVNVGDKVLLPKFG---GTKIEVE   91 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~---g~~v~~~   91 (111)
                      -|.+||.+..+...   |..++++
T Consensus        12 kV~~Gd~i~Ve~l~~~~G~~i~l~   35 (101)
T TIGR00061        12 KVEEGQTVRIEKLDAAPGDTVEFD   35 (101)
T ss_pred             EEeCCCEEEEcccCCCCCCEEEEE
Confidence            56777777766542   5556554


No 206
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=21.01  E-value=68  Score=18.55  Aligned_cols=9  Identities=44%  Similarity=0.608  Sum_probs=4.3

Q ss_pred             eeeeCCEEE
Q psy12951         71 VVNVGDKVL   79 (111)
Q Consensus        71 ~vk~GD~Vl   79 (111)
                      .||.||..+
T Consensus        23 ~VkkGd~L~   31 (50)
T PF13533_consen   23 QVKKGDVLL   31 (50)
T ss_pred             EEcCCCEEE
Confidence            355555443


No 207
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-termi
Probab=20.98  E-value=91  Score=24.06  Aligned_cols=25  Identities=32%  Similarity=0.376  Sum_probs=18.8

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   80 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~   80 (111)
                      ...|+|+++|++...        .+++||+|+-
T Consensus        65 e~~G~V~~vG~~v~~--------~~~~Gd~V~~   89 (352)
T cd08247          65 DYSGVIVKVGSNVAS--------EWKVGDEVCG   89 (352)
T ss_pred             eeEEEEEEeCccccc--------CCCCCCEEEE
Confidence            568999999976520        3678999974


No 208
>COG0231 Efp Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) [Translation, ribosomal structure and biogenesis]
Probab=20.75  E-value=1.5e+02  Score=20.95  Aligned_cols=40  Identities=13%  Similarity=0.174  Sum_probs=27.8

Q ss_pred             CCCeeecceeeeCCEEEccCCCc---eEEEECCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGG---TKIEVEGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g---~~v~~~g~~y~iv~~~D  102 (111)
                      .+|.......+.+|+|--....-   +=+..+|+.|.|+..++
T Consensus        47 ~tG~~~e~~f~~~~kve~a~ie~~~~q~lY~dg~~~~FMD~et   89 (131)
T COG0231          47 FTGKKVEKTFKADDKVEVAIVERKTAQYLYIDGDFYVFMDLET   89 (131)
T ss_pred             cCCCEEEEEEcCCCEEEEeEEeeeeEEEEEcCCCeEEEccCCC
Confidence            46777777888888886655443   44455889999988553


No 209
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=20.74  E-value=94  Score=18.15  Aligned_cols=12  Identities=17%  Similarity=0.393  Sum_probs=8.5

Q ss_pred             eeeeCCEEEccC
Q psy12951         71 VVNVGDKVLLPK   82 (111)
Q Consensus        71 ~vk~GD~Vl~~~   82 (111)
                      ..++||.|.|+.
T Consensus        25 ~~~vG~eI~~~~   36 (56)
T PF12791_consen   25 GMEVGQEIEFDE   36 (56)
T ss_pred             CCcccCEEEEec
Confidence            467777777765


No 210
>PRK14578 elongation factor P; Provisional
Probab=20.74  E-value=1.4e+02  Score=22.42  Aligned_cols=40  Identities=20%  Similarity=0.270  Sum_probs=27.0

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEEEE---CCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKIEV---EGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v~~---~g~~y~iv~~~D  102 (111)
                      .+|..+....+.||+|--....-.+.++   ||+.|.||..++
T Consensus        47 ~tG~~~e~tf~s~d~ve~a~ve~~~~qylY~dg~~~~FMD~et   89 (187)
T PRK14578         47 LTGQVLEKTFRSGDKVEEADFERHKGQFLYADGDRGVFMDLET   89 (187)
T ss_pred             CCCCEEEEEECCCCEEEEeEEEEeEeEEEEeCCCEEEEecCCC
Confidence            4566666678888887666554444433   788888887653


No 211
>PF13403 Hint_2:  Hint domain
Probab=20.69  E-value=2e+02  Score=20.43  Aligned_cols=34  Identities=26%  Similarity=0.295  Sum_probs=22.6

Q ss_pred             CCCCeeecceeeeCCEEEccCCCceEEEECCEEE
Q psy12951         62 TPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQEL   95 (111)
Q Consensus        62 ~~~G~~~p~~vk~GD~Vl~~~y~g~~v~~~g~~y   95 (111)
                      +.+|.+.--++++||+|+=.+-+-++|..=+...
T Consensus        11 T~~G~~~Ve~L~~GD~V~T~dgg~~~V~wig~~~   44 (147)
T PF13403_consen   11 TPDGPRPVEDLRPGDRVLTRDGGFQPVRWIGRRT   44 (147)
T ss_pred             cCCcCeEeeccCCCCEEEecCCCEEEEEEEEEEE
Confidence            3455444448999999998776667776644443


No 212
>PRK06033 hypothetical protein; Validated
Probab=20.52  E-value=1.4e+02  Score=19.45  Aligned_cols=25  Identities=12%  Similarity=0.088  Sum_probs=14.8

Q ss_pred             eeeeCCEEEccCCCc--eEEEECCEEE
Q psy12951         71 VVNVGDKVLLPKFGG--TKIEVEGQEL   95 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g--~~v~~~g~~y   95 (111)
                      .+++||.+.++....  .++.++|...
T Consensus        27 ~L~~GDVI~L~~~~~~~v~v~V~~~~~   53 (83)
T PRK06033         27 RMGRGAVIPLDATEADEVWILANNHPI   53 (83)
T ss_pred             CCCCCCEEEeCCCCCCcEEEEECCEEE
Confidence            567777777766433  4445566543


No 213
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=20.43  E-value=71  Score=26.49  Aligned_cols=22  Identities=18%  Similarity=0.034  Sum_probs=16.9

Q ss_pred             CeeecceeeeCCEEEccCCCce
Q psy12951         65 GEYIKPVVNVGDKVLLPKFGGT   86 (111)
Q Consensus        65 G~~~p~~vk~GD~Vl~~~y~g~   86 (111)
                      ....|..+++||.|+..+-.|.
T Consensus       154 ~~v~~~~~~~GD~vI~tg~~g~  175 (339)
T COG0309         154 ILVSPSGARPGDAVIVTGTIGI  175 (339)
T ss_pred             cccccCCCCCCCEEEEcCChhH
Confidence            3345667999999999987764


No 214
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=20.20  E-value=85  Score=23.26  Aligned_cols=23  Identities=13%  Similarity=0.029  Sum_probs=17.6

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|+|+++|.  .         .+++||+|+..
T Consensus        63 e~~G~v~~vG~--~---------~~~~Gd~V~~~   85 (320)
T cd08243          63 EAVGEVEEAPG--G---------TFTPGQRVATA   85 (320)
T ss_pred             eeEEEEEEecC--C---------CCCCCCEEEEe
Confidence            46799999993  1         36899999854


No 215
>PF04943 Pox_F11:  Poxvirus F11 protein;  InterPro: IPR007027 These proteins belong to the poxvirus F11 family. They are early virus proteins.
Probab=20.08  E-value=5.3e+02  Score=21.68  Aligned_cols=86  Identities=19%  Similarity=0.240  Sum_probs=53.4

Q ss_pred             hcccceeeeCCeEEEEecCCCCcccceEEeccCccccceeeEEEEecCce---eCCCCeeecceeeeCCEEEccCCCceE
Q psy12951         11 TLSQKFRPLLDRILVIKDEPLTKTKGGVLIPEKAQQEVNNAVVVAVGPGA---RTPNGEYIKPVVNVGDKVLLPKFGGTK   87 (111)
Q Consensus        11 ~~~~~i~PlgDrVLVk~~~~e~~T~gGIiLP~~~~~k~~~G~VvaVG~G~---~~~~G~~~p~~vk~GD~Vl~~~y~g~~   87 (111)
                      .+...+.-..|--||+..--+.-..+-++.|.++.   ..+++===-.|.   .-.+-......+..||.++++-+-|..
T Consensus        82 ~D~eg~Fev~d~~lvkL~HGn~f~~~~~~~~~s~g---f~a~ICikN~GiSgi~V~~t~~lk~nm~~Gd~ivsrs~rgi~  158 (366)
T PF04943_consen   82 LDNEGFFEVSDCFLVKLKHGNGFMKGAIYVGNSAG---FVATICIKNEGISGIYVPNTNFLKHNMEEGDYIVSRSSRGIN  158 (366)
T ss_pred             hcccCcEeeeeeEEEEEecCchhhcCccccCCccc---eEEEEEEcCCCeeEEEeCCCcceEeeeeeCCEEEEecccccc
Confidence            34455666788889999877777777787887642   111111111111   112222244578999999999998988


Q ss_pred             E--EECCE-EEEEEe
Q psy12951         88 I--EVEGQ-ELHLFK   99 (111)
Q Consensus        88 v--~~~g~-~y~iv~   99 (111)
                      +  +++|+ .|+++.
T Consensus       159 fLPQIgG~a~YLIv~  173 (366)
T PF04943_consen  159 FLPQIGGEAIYLIVS  173 (366)
T ss_pred             cccccCceeEEEEEE
Confidence            7  67776 676654


No 216
>PRK10334 mechanosensitive channel MscS; Provisional
Probab=20.08  E-value=1.3e+02  Score=23.86  Aligned_cols=18  Identities=28%  Similarity=0.324  Sum_probs=13.8

Q ss_pred             eeeeCCEEEccCCCceEE
Q psy12951         71 VVNVGDKVLLPKFGGTKI   88 (111)
Q Consensus        71 ~vk~GD~Vl~~~y~g~~v   88 (111)
                      ++++||.|.++++.|+-.
T Consensus       129 pf~vGD~I~i~~~~G~V~  146 (286)
T PRK10334        129 PFRAGEYVDLGGVAGTVL  146 (286)
T ss_pred             CCCCCCEEEECCEEEEEE
Confidence            578888888888877443


No 217
>cd08241 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic
Probab=20.08  E-value=88  Score=22.96  Aligned_cols=25  Identities=40%  Similarity=0.482  Sum_probs=18.9

Q ss_pred             ceeeEEEEecCceeCCCCeeecceeeeCCEEEcc
Q psy12951         48 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   81 (111)
Q Consensus        48 ~~~G~VvaVG~G~~~~~G~~~p~~vk~GD~Vl~~   81 (111)
                      ...|.|+.+|++..         ..++||+|+--
T Consensus        64 e~~G~v~~~g~~~~---------~~~~G~~V~~~   88 (323)
T cd08241          64 EVAGVVEAVGEGVT---------GFKVGDRVVAL   88 (323)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            46799999997543         36789999864


No 218
>TIGR02178 yeiP elongation factor P-like protein YeiP. This model represents the family of Escherichia coli protein YeiP, a close homolog of elongation factor P (TIGR00038) and probably itself a translation factor. Member of this family are found only in some Gammaproteobacteria, including E. coli and Vibrio cholerae.
Probab=20.02  E-value=1.3e+02  Score=22.63  Aligned_cols=40  Identities=18%  Similarity=0.310  Sum_probs=27.6

Q ss_pred             CCCeeecceeeeCCEEEccCCCceEEEE---CCEEEEEEecCc
Q psy12951         63 PNGEYIKPVVNVGDKVLLPKFGGTKIEV---EGQELHLFKEAD  102 (111)
Q Consensus        63 ~~G~~~p~~vk~GD~Vl~~~y~g~~v~~---~g~~y~iv~~~D  102 (111)
                      .+|..+.-.++.||+|---...-.+.+|   ||+.|+||..++
T Consensus        45 ~tG~~~e~tf~s~e~ve~a~le~~~~qylY~dg~~~~FMD~et   87 (186)
T TIGR02178        45 PTGSKVEERFKADDMLDTVELLRREASFSYKDGEEYVFMDEED   87 (186)
T ss_pred             CCCCeEEEEECCCCeEEEEEEEEeEeEEEEeCCCeEEEccCCC
Confidence            4566666678888888766655555544   778888887654


Done!