BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12958
         (294 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2JU4|A Chain A, Nmr Structure Of The Gamma Subunit Of Cgmp
           Phosphodiesterase
          Length = 87

 Score = 28.1 bits (61), Expect = 6.1,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%)

Query: 109 PEFNCQNGTKISSHSC--KNEGRDLKFNSTGQCK--PPLVSTEVVASFYPGVEGCG 160
           P+  C++ T++    C  +      K   T QCK  PP    +      PG+EGCG
Sbjct: 6   PKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCG 61


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,605,851
Number of Sequences: 62578
Number of extensions: 339079
Number of successful extensions: 539
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 539
Number of HSP's gapped (non-prelim): 1
length of query: 294
length of database: 14,973,337
effective HSP length: 98
effective length of query: 196
effective length of database: 8,840,693
effective search space: 1732775828
effective search space used: 1732775828
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)