Diaphorina citri psyllid: psy12961

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
NKGSFHRTKAVYTIEDIKSIIEYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSWGYGNPNLLCKINITIPDLNTTQEYWGPIDPTKSSSYDFVRDLFTEVRSVFHDEFLHTGGDEVDFYCWLNDPNIRQFLADRGWDGQQLQSYYTRRALAIAKQLGFTSIVWQEVYENWRSESRRMDPDTVVQVWYGNRNDLLNRITRDGYTAITSAGWYLDVLDIRDGYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSNI
cccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHcccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccEEEEcccccHHHHHHHHHcccEEEcccccccccccccccccccccHHHHcccccccccccHHHHccEEEEEEEccccccccccccHHHHHHHHHHHHHccccc
****FHRTKAVYTIEDIKSIIEYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSWGYGNPNLLCKINITIPDLNTTQEYWGPIDPTKSSSYDFVRDLFTEVRSVFHDEFLHTGGDEVDFYCWLNDPNIRQFLADRGWDGQQLQSYYTRRALAIAKQLGFTSIVWQEVYENWRSESRRMDPDTVVQVWYGNRNDLLNRITRDGYTAITSAGWYLDVLDIRDGYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSNI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NKGSFHRTKAVYTIEDIKSIIEYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSWGYGNPNLLCKINITIPDLNTTQEYWGPIDPTKSSSYDFVRDLFTEVRSVFHDEFLHTGGDEVDFYCWLNDPNIRQFLADRGWDGQQLQSYYTRRALAIAKQLGFTSIVWQEVYENWRSESRRMDPDTVVQVWYGNRNDLLNRITRDGYTAITSAGWYLDVLDIRDGYGWQQEWQRYYRIDPQEFPGTPEQHSLVLGGEACIWGERVDESNVESRIWPRGAAIAERLWSNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016231 [MF]beta-N-acetylglucosaminidase activityprobableGO:0016787, GO:0016798, GO:0015929, GO:0003824, GO:0004563, GO:0003674, GO:0004553

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GJX, chain A
Confidence level:very confident
Coverage over the Query: 2-48,83-314
View the alignment between query and template
View the model in PyMOL
Template: 3RCN, chain A
Confidence level:confident
Coverage over the Query: 27-84
View the alignment between query and template
View the model in PyMOL