Diaphorina citri psyllid: psy12965


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
SQPVKVCDIDDDVKEALKKFRFRKAQSNAALILKVDREKQRICIDDLMEDVSLDELRDILPSHQPRYVVYSCRMEHGDGRVSYPMSFIYITPRDAQMALQIMYAGTKLALQQEADLTRVYEVRELEELTEEWLKSCLAG
ccccEEEEccHHHHHHHHHHHHcccccccEEEEEEEcccEEEEEEcccccccHHHHHHHccccccEEEEEEEEEECccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHcc
****KVCDIDDDVKEALKKFRFRKAQSNAALILKVDREKQRICIDDLMEDVSLDELRDILPSHQPRYVVYSCRMEHGDGRVSYPMSFIYITPRDAQMALQIMYAGTKLALQQEADLTRVYEVRELEELTEEWLKSCLAG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SQPVKVCDIDDDVKEALKKFRFRKAQSNAALILKVDREKQRICIDDLMEDVSLDELRDILPSHQPRYVVYSCRMEHGDGRVSYPMSFIYITPRDAQMALQIMYAGTKLALQQEADLTRVYEVRELEELTEEWLKSCLAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glia maturation factor beta This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.confidentQ9CQI3
Glia maturation factor beta This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.confidentQ5R6P6
Glia maturation factor beta This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.confidentP60983

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0008083 [MF]growth factor activityprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0030479 [CC]actin cortical patchprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0030864, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0042063 [BP]gliogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0004860 [MF]protein kinase inhibitor activityprobableGO:0019210, GO:0019207, GO:0019887, GO:0030234, GO:0003674, GO:0004857
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674
GO:0071933 [MF]Arp2/3 complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VKK, chain A
Confidence level:very confident
Coverage over the Query: 5-139
View the alignment between query and template
View the model in PyMOL