Diaphorina citri psyllid: psy12967

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--

MGVKDLWGILTPICERKPIWELQDKTIAIDLSAWICDSSTIAEHSSQKNMYLRAIMGVKDLWGILTPICERKPIWELQDKTIAIDLSAWICDSSTIAEHSSQKNMYLRNLFFRTSYLLLLGVKPIFVLEGKAPVLKHDTIEKRQQAQGRSAGRNVQAGSRARNLFFRTSYLLLLGVKPIFVLEGKAPVLKHDTIEKRQQAQGRSAGRNVQAGSRARLKGLQT

cccccccccccccccccccccccccEEEEEccEEEEEccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccCEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccHHHcccHHHHHHHHHcccccccccccccccccccccc

MGVKDLWGILTPICERKPIWELQDKTIAIDLSAWICDSSTIAEHSSQKNMYLRAIMGVKDLWGILTPICERKPIWELQDKTIAIDLSAWICDSSTIAEHSSQKNMYLRNLFFRTSYLLLLGVKPIFVLEGKAPVLKH***********************ARNLFFRTSYLLLLGVKPIFVLEGKAPVLKH*******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0035312 [MF]	5'-3' exodeoxyribonuclease activity	probable	GO:0016787, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0008409, GO:0003674, GO:0016895
GO:0000738 [BP]	DNA catabolic process, exonucleolytic	probable	GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0000737 [BP]	DNA catabolic process, endonucleolytic	probable	GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0004520 [MF]	endodeoxyribonuclease activity	probable	GO:0016787, GO:0004536, GO:0004519, GO:0016788, GO:0003824, GO:0003674, GO:0004518
GO:0008310 [MF]	single-stranded DNA specific 3'-5' exodeoxyribonuclease activity	probable	GO:0016787, GO:0008408, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674, GO:0016895, GO:0008297, GO:0008296
GO:0008311 [MF]	double-stranded DNA specific 3'-5' exodeoxyribonuclease activity	probable	GO:0016787, GO:0008408, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674, GO:0016895, GO:0008309, GO:0008296

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ORY, chain A
Confidence level:very confident
Coverage over the Query: 55-221
View the alignment between query and template
View the model in PyMOL

Template: 3ORY, chain A
Confidence level:very confident
Coverage over the Query: 1-42
View the alignment between query and template
View the model in PyMOL