Diaphorina citri psyllid: psy12976

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MSFKLTTRVQSLKRSRCAVYTYEKKKDAEASGYGTQNQRVGKDSVKDFDCCCLTLQHSSYLNQVLIFDLLILKHRINLINQFQSQTA
cccEEEEEEEccccccccEEEEEEcccHHHccccccEEECccccccccccCEEcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHc
********VQSLKRSRCAVYTYEKKKDA*********QRVGKDSVKDFDCCCLTLQHSSYLNQVLIFDLLILKHRINLINQF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFKLTTRVQSLKRSRCAVYTYEKKKDAEASGYGTQNQRVGKDSVKDFDCCCLTLQHSSYLNQVLIFDLLILKHRINLINQFQSQTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nitric oxide synthase-interacting protein Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity.confidentQ6P829
Nitric oxide synthase-interacting protein Negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.confidentQ3SWY5
Nitric oxide synthase-interacting protein homolog Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity.confidentQ9VWV8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051001 [BP]negative regulation of nitric-oxide synthase activityprobableGO:0050999, GO:0051341, GO:0050790, GO:0019222, GO:0051354, GO:0032768, GO:0032769, GO:0050789, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0046209 [BP]nitric oxide metabolic processprobableGO:0006807, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted