Query         psy12992
Match_columns 319
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 16:21:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12992.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12992hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12273 RCR:  Chitin synthesis  96.0  0.0049 1.1E-07   48.2   2.4   36  153-188     3-38  (130)
  2 PF12273 RCR:  Chitin synthesis  90.4    0.16 3.5E-06   39.7   1.7   27  156-182     3-29  (130)
  3 PHA02909 hypothetical protein;  87.2     1.3 2.7E-05   34.6   4.6   53  117-169    11-70  (72)
  4 PRK13718 conjugal transfer pro  81.0     2.5 5.4E-05   34.1   4.0   32  152-183    46-77  (84)
  5 TIGR01144 ATP_synt_b ATP synth  79.5     2.2 4.8E-05   33.1   3.2   19  141-159     3-21  (147)
  6 PF07219 HemY_N:  HemY protein   74.9      13 0.00028   28.2   6.2   42  130-174     3-44  (108)
  7 TIGR00540 hemY_coli hemY prote  71.9      12 0.00027   33.1   6.2   29  129-157    27-55  (409)
  8 PRK09173 F0F1 ATP synthase sub  69.6       5 0.00011   31.9   3.0    6  173-178    31-36  (159)
  9 PRK10747 putative protoheme IX  68.9      16 0.00035   32.5   6.3   23  129-151    27-49  (398)
 10 PF00430 ATP-synt_B:  ATP synth  67.8       7 0.00015   29.0   3.3   15  154-168     2-16  (132)
 11 PRK07353 F0F1 ATP synthase sub  67.8     6.2 0.00014   30.3   3.1    6  173-178    34-39  (140)
 12 PRK06531 yajC preprotein trans  65.3     2.4 5.2E-05   34.5   0.4   29  161-189     9-37  (113)
 13 MTH00025 ATP8 ATP synthase F0   64.9      10 0.00022   29.0   3.7   27  145-171     5-31  (70)
 14 KOG0860|consensus               64.8     8.3 0.00018   32.2   3.4   21  150-170    94-114 (116)
 15 PF06024 DUF912:  Nucleopolyhed  64.8       3 6.5E-05   32.3   0.8   23  157-179    71-93  (101)
 16 PF11100 TrbE:  Conjugal transf  64.1      13 0.00028   29.0   4.1   31  150-180    36-66  (66)
 17 PF00430 ATP-synt_B:  ATP synth  63.3     5.5 0.00012   29.6   2.0   12  141-152     7-18  (132)
 18 PRK14473 F0F1 ATP synthase sub  61.2     9.6 0.00021   30.4   3.1    6  173-178    37-42  (164)
 19 PRK13453 F0F1 ATP synthase sub  61.2     9.3  0.0002   31.2   3.1    6  173-178    47-52  (173)
 20 PF05393 Hum_adeno_E3A:  Human   60.8     9.7 0.00021   31.3   3.1   25  154-178    37-61  (94)
 21 PRK03598 putative efflux pump   59.8     4.1 8.9E-05   35.1   0.9   24  155-178     9-32  (331)
 22 KOG1326|consensus               59.5      12 0.00026   40.4   4.3   22  150-171  1070-1091(1105)
 23 PRK13461 F0F1 ATP synthase sub  59.2      11 0.00023   30.0   3.1    6  173-178    34-39  (159)
 24 PF12729 4HB_MCP_1:  Four helix  57.6      17 0.00037   25.9   3.7   15  151-165     6-20  (181)
 25 PF04277 OAD_gamma:  Oxaloaceta  56.5      39 0.00084   24.0   5.3   20  145-164     7-26  (79)
 26 PRK09470 cpxA two-component se  56.3      15 0.00033   30.9   3.7   28  149-176     9-36  (461)
 27 PF09680 Tiny_TM_bacill:  Prote  55.1      10 0.00022   24.8   1.9   14  154-167     6-19  (24)
 28 PF02167 Cytochrom_C1:  Cytochr  54.0      24 0.00053   31.3   4.7   29  141-169   176-208 (219)
 29 PRK05886 yajC preprotein trans  54.0     6.2 0.00013   32.0   0.9   23  165-187    15-37  (109)
 30 PF02699 YajC:  Preprotein tran  53.8     9.8 0.00021   28.5   1.9   28  162-189    10-37  (82)
 31 KOG0812|consensus               53.3      14 0.00031   35.2   3.3   16  149-164   291-306 (311)
 32 COG0768 FtsI Cell division pro  53.2      18  0.0004   34.6   4.1   30  148-177    12-41  (599)
 33 PF09451 ATG27:  Autophagy-rela  52.7      13 0.00029   32.4   2.8   13   85-97    154-166 (268)
 34 TIGR03321 alt_F1F0_F0_B altern  52.6      15 0.00032   31.6   3.1    6  173-178    34-39  (246)
 35 PF12297 EVC2_like:  Ellis van   52.5      17 0.00038   35.8   3.8   25  154-178    71-95  (429)
 36 PF04277 OAD_gamma:  Oxaloaceta  52.0      18  0.0004   25.7   3.0   15  159-173    14-28  (79)
 37 PF06480 FtsH_ext:  FtsH Extrac  51.9     4.8  0.0001   27.8   0.0   11  158-168     5-15  (110)
 38 PF10669 Phage_Gp23:  Protein g  51.8      22 0.00047   30.1   3.9   22  148-169    12-33  (121)
 39 PRK14472 F0F1 ATP synthase sub  51.5      17 0.00036   29.5   3.1    6  173-178    47-52  (175)
 40 PF06305 DUF1049:  Protein of u  51.4      11 0.00024   25.7   1.8    9  140-148     8-16  (68)
 41 PF13889 Chromosome_seg:  Chrom  51.0      14 0.00031   27.5   2.4   26  107-135     7-32  (56)
 42 PRK07352 F0F1 ATP synthase sub  49.8      18  0.0004   29.2   3.1    6  173-178    48-53  (174)
 43 PF06459 RR_TM4-6:  Ryanodine R  49.4      26 0.00057   32.0   4.3   31  141-171   163-193 (274)
 44 PRK13460 F0F1 ATP synthase sub  49.3      19 0.00042   29.2   3.1    6  173-178    45-50  (173)
 45 PRK14475 F0F1 ATP synthase sub  48.7      12 0.00025   30.4   1.7    6  173-178    39-44  (167)
 46 PRK14125 cell division suppres  48.4      29 0.00062   27.3   3.9   22  149-170     4-25  (103)
 47 TIGR01732 tiny_TM_bacill conse  48.4      17 0.00037   24.1   2.1   13  154-166     8-20  (26)
 48 TIGR01843 type_I_hlyD type I s  48.2      17 0.00038   31.0   2.8   17  155-171     8-24  (423)
 49 PF10717 ODV-E18:  Occlusion-de  47.5      17 0.00037   29.3   2.5   12  157-168    33-44  (85)
 50 PRK08476 F0F1 ATP synthase sub  47.5      21 0.00046   28.5   3.1    6  173-178    36-41  (141)
 51 PF12459 DUF3687:  D-Ala-teicho  47.4      31 0.00068   24.5   3.5   28  146-175     8-35  (42)
 52 TIGR00739 yajC preprotein tran  47.1     8.1 0.00018   29.4   0.6   24  166-189    15-38  (84)
 53 TIGR02832 spo_yunB sporulation  46.5      16 0.00034   32.0   2.4   22  150-171     3-24  (204)
 54 COG1862 YajC Preprotein transl  46.4      18  0.0004   28.8   2.5   25  156-180    10-35  (97)
 55 PRK09174 F0F1 ATP synthase sub  46.3      22 0.00047   30.6   3.1    6  173-178    82-87  (204)
 56 PF13789 DUF4181:  Domain of un  46.3      35 0.00075   26.4   4.0   46  136-181    35-85  (110)
 57 PF06422 PDR_CDR:  CDR ABC tran  45.4      29 0.00063   26.7   3.4   12  133-147    45-56  (103)
 58 PF11770 GAPT:  GRB2-binding ad  45.2      17 0.00036   32.1   2.3   26  156-181    12-37  (158)
 59 PF13908 Shisa:  Wnt and FGF in  45.2     7.9 0.00017   31.4   0.3   14  162-175    92-107 (179)
 60 PF06678 DUF1179:  Protein of u  44.0      22 0.00047   29.5   2.6   17  163-179    16-32  (103)
 61 MTH00216 ND1 NADH dehydrogenas  43.7      42  0.0009   30.5   4.7    6  145-150     3-8   (327)
 62 PF11772 EpuA:  DNA-directed RN  42.8      11 0.00025   26.9   0.8   14  160-173     3-16  (47)
 63 PRK14401 membrane protein; Pro  42.7      48   0.001   29.5   4.7   55  132-186    83-147 (187)
 64 PRK05585 yajC preprotein trans  42.6      12 0.00026   29.7   0.9   23  167-189    31-53  (106)
 65 COG4395 Uncharacterized protei  42.2      49  0.0011   31.0   4.9   33  148-181    47-82  (281)
 66 PRK13460 F0F1 ATP synthase sub  41.9      28 0.00061   28.3   3.0   10  158-167    23-32  (173)
 67 CHL00019 atpF ATP synthase CF0  41.3      29 0.00062   28.5   3.0    6  173-178    53-58  (184)
 68 PF13584 BatD:  Oxygen toleranc  41.3      35 0.00077   30.9   3.8   21  153-173   427-447 (484)
 69 PF08139 LPAM_1:  Prokaryotic m  40.9      32 0.00068   22.3   2.5   16  148-163     5-20  (25)
 70 PF06679 DUF1180:  Protein of u  40.4      35 0.00077   29.3   3.5   28  150-177    94-121 (163)
 71 PF03935 SKN1:  Beta-glucan syn  39.9      26 0.00056   34.9   2.9   25  149-173    38-62  (504)
 72 PF11395 DUF2873:  Protein of u  39.3      70  0.0015   23.3   4.3   13  153-165    15-27  (43)
 73 PRK06231 F0F1 ATP synthase sub  39.0      33 0.00072   29.2   3.1    6  173-178    77-82  (205)
 74 PF05478 Prominin:  Prominin;    38.8      40 0.00086   33.8   4.1   28  147-174   460-489 (806)
 75 PHA02818 hypothetical protein;  38.7      59  0.0013   26.7   4.3   20  154-174    67-86  (92)
 76 COG5341 Uncharacterized protei  38.6      16 0.00034   31.5   1.1   17  154-170    17-33  (132)
 77 PRK12705 hypothetical protein;  38.5      38 0.00083   33.3   3.8   18  153-170     9-26  (508)
 78 TIGR03142 cytochro_ccmI cytoch  38.5      32 0.00069   26.7   2.7   21  154-174     2-22  (117)
 79 PF15202 Adipogenin:  Adipogeni  37.7      59  0.0013   26.1   4.1   10  140-149     8-17  (81)
 80 PF13129 DUF3953:  Protein of u  36.8      29 0.00063   23.8   2.0   20  161-180     2-21  (42)
 81 PF06366 FlhE:  Flagellar prote  36.8      31 0.00066   28.0   2.4   23   79-101    26-54  (106)
 82 PRK06568 F0F1 ATP synthase sub  36.3      37  0.0008   28.6   2.9    6  173-178    33-38  (154)
 83 PF06084 Cytomega_TRL10:  Cytom  35.9      24 0.00052   30.7   1.8   27  157-183    65-91  (150)
 84 PHA02650 hypothetical protein;  35.7      54  0.0012   26.4   3.6    6  132-137    41-46  (81)
 85 PRK10697 DNA-binding transcrip  35.6      19 0.00042   29.6   1.1    8  136-143    33-40  (118)
 86 PF13131 DUF3951:  Protein of u  35.6      38 0.00083   25.5   2.6   16  158-173     6-21  (53)
 87 PF02932 Neur_chan_memb:  Neuro  35.5      55  0.0012   23.0   3.3   11  155-165   223-233 (237)
 88 PRK13453 F0F1 ATP synthase sub  35.4      41 0.00088   27.5   3.0    6  159-164    26-31  (173)
 89 TIGR00998 8a0101 efflux pump m  35.2      48   0.001   28.0   3.5   14  155-168    10-23  (334)
 90 TIGR01195 oadG_fam sodium pump  35.1      45 0.00098   25.3   3.0   14  160-173    18-31  (82)
 91 PF09988 DUF2227:  Uncharacteri  35.0      68  0.0015   27.5   4.4    7  134-140    80-86  (169)
 92 PRK13454 F0F1 ATP synthase sub  35.0      41 0.00089   27.9   3.0    6  173-178    60-65  (181)
 93 PRK10352 nickel transporter pe  34.8      56  0.0012   29.2   4.0   28  147-174     3-30  (314)
 94 PF09889 DUF2116:  Uncharacteri  34.7      63  0.0014   24.0   3.6   13  152-164    37-49  (59)
 95 PF05781 MRVI1:  MRVI1 protein;  34.4      25 0.00054   35.5   1.9   39  134-173   462-500 (538)
 96 PF07946 DUF1682:  Protein of u  34.2      35 0.00076   30.6   2.6   18  157-174     9-26  (321)
 97 PF12606 RELT:  Tumour necrosis  34.1      42  0.0009   24.4   2.5    9  161-169    10-18  (50)
 98 PRK10476 multidrug resistance   34.1      26 0.00057   30.5   1.8   19  153-171    13-31  (346)
 99 PRK10819 transport protein Ton  33.9      38 0.00082   30.0   2.8   19  145-163     4-22  (246)
100 PRK09471 oppB oligopeptide tra  32.4      67  0.0014   28.1   4.0   26  148-173     4-29  (306)
101 PF14348 DUF4400:  Domain of un  32.2   1E+02  0.0022   25.5   4.9   44  135-178    91-135 (198)
102 PF10947 DUF2628:  Protein of u  32.0 1.2E+02  0.0026   22.7   4.8   25  138-162    35-64  (108)
103 MTH00260 ATP8 ATP synthase F0   31.8      61  0.0013   23.3   3.0   19  154-172    13-31  (53)
104 PRK13428 F0F1 ATP synthase sub  31.4      47   0.001   31.4   3.1    6  173-178    30-35  (445)
105 TIGR02459 CbtB cobalt transpor  31.3      57  0.0012   24.8   2.9   14  162-175    27-40  (60)
106 PF03579 SHP:  Small hydrophobi  31.2      95  0.0021   24.2   4.2   36  128-167     6-41  (64)
107 PF05478 Prominin:  Prominin;    31.1      55  0.0012   32.8   3.7   21  155-175   424-444 (806)
108 smart00831 Cation_ATPase_N Cat  31.0 1.2E+02  0.0027   20.2   4.3   14  159-172    50-63  (64)
109 TIGR01006 polys_exp_MPA1 polys  30.8 1.1E+02  0.0024   25.0   4.9   30  142-171     9-38  (226)
110 COG0795 Predicted permeases [G  30.5      94   0.002   27.1   4.6   30  146-175     5-34  (364)
111 PF01529 zf-DHHC:  DHHC palmito  30.3      68  0.0015   24.6   3.3   12   97-108    53-64  (174)
112 TIGR02789 nickel_nikB nickel A  30.3      74  0.0016   27.7   3.9   26  148-173     4-29  (314)
113 TIGR02876 spore_yqfD sporulati  29.8      75  0.0016   29.5   4.1   24  143-166    76-99  (382)
114 PF06898 YqfD:  Putative stage   29.5      82  0.0018   29.0   4.2   16  149-164    85-100 (385)
115 PRK10914 dipeptide transporter  29.5      75  0.0016   28.6   3.9   27  147-173     3-29  (339)
116 COG3071 HemY Uncharacterized e  29.2 1.2E+02  0.0025   29.9   5.4   15  130-144    28-42  (400)
117 PRK13553 fumarate reductase cy  28.6      58  0.0013   30.0   3.1   30  149-178   210-239 (258)
118 PHA03030 hypothetical protein;  28.3      48   0.001   28.2   2.3    8  167-174    17-24  (122)
119 PHA02689 ORF051 putative membr  28.3      69  0.0015   27.5   3.3   21  156-176    34-54  (128)
120 PF11694 DUF3290:  Protein of u  28.1      73  0.0016   26.7   3.4    9  160-168    52-60  (149)
121 KOG2431|consensus               28.1      63  0.0014   32.8   3.5   23  150-172     8-30  (546)
122 PF06637 PV-1:  PV-1 protein (P  28.1      74  0.0016   31.8   3.9   13  148-160    23-35  (442)
123 MTH00186 ATP8 ATP synthase F0   28.1      79  0.0017   21.6   3.0   14  157-170    16-29  (52)
124 PF10694 DUF2500:  Protein of u  28.0      20 0.00043   27.7   0.0   10  172-181    22-31  (110)
125 PRK15110 antimicrobial peptide  27.7      86  0.0019   27.9   3.9   26  148-173     4-29  (321)
126 PF05656 DUF805:  Protein of un  27.5 1.6E+02  0.0034   21.8   4.7   11  171-181    63-73  (120)
127 MTH00147 ATP8 ATP synthase F0   27.2      84  0.0018   22.2   3.1   17  155-171    14-30  (51)
128 PF14812 PBP1_TM:  Transmembran  27.0     3.9 8.5E-05   32.2  -4.0   13  151-163    65-77  (81)
129 COG4089 Predicted membrane pro  26.8      76  0.0016   29.5   3.5    7  153-159    16-22  (235)
130 PF03739 YjgP_YjgQ:  Predicted   26.6      86  0.0019   26.5   3.6   22  150-171     4-25  (354)
131 PRK15133 microcin C ABC transp  26.6      90   0.002   28.9   4.0   26  148-173     4-29  (364)
132 PF05814 DUF843:  Baculovirus p  26.5      76  0.0016   25.5   3.0   11  143-153    10-20  (83)
133 PF10694 DUF2500:  Protein of u  26.4      22 0.00047   27.4   0.0   24  156-179     3-26  (110)
134 TIGR03794 NHPM_micro_HlyD NHPM  26.4      78  0.0017   28.5   3.5   12  161-172    29-40  (421)
135 TIGR03017 EpsF chain length de  26.2 1.2E+02  0.0026   27.0   4.6   10  147-156     9-18  (444)
136 COG2991 Uncharacterized protei  25.8      65  0.0014   25.8   2.5   26  153-179     3-28  (77)
137 PF03381 CDC50:  LEM3 (ligand-e  25.7 1.4E+02  0.0031   26.5   5.0   21  129-149   229-250 (278)
138 COG2268 Uncharacterized protei  25.4      76  0.0017   32.1   3.5   16  157-172    16-31  (548)
139 PF01062 Bestrophin:  Bestrophi  25.3 1.5E+02  0.0032   24.8   4.8   17  159-175   246-262 (293)
140 PF06682 DUF1183:  Protein of u  25.0      56  0.0012   30.7   2.4   11   44-54     39-49  (318)
141 PF15183 MRAP:  Melanocortin-2   24.8 1.5E+02  0.0032   24.4   4.4   46  132-185    31-77  (90)
142 PF11872 DUF3392:  Protein of u  24.7      83  0.0018   25.8   3.0   17  161-177    89-105 (106)
143 KOG4753|consensus               24.6      76  0.0016   27.2   2.9   22  151-172    53-74  (124)
144 PF06143 Baculo_11_kDa:  Baculo  24.5 1.3E+02  0.0027   24.0   3.9    7  165-171    53-59  (84)
145 COG3166 PilN Tfp pilus assembl  24.1      72  0.0016   28.1   2.8   52  138-189     4-60  (206)
146 PRK06569 F0F1 ATP synthase sub  24.1      81  0.0018   26.9   3.0   14  155-168    14-27  (155)
147 PRK15081 glutathione ABC trans  24.1 1.1E+02  0.0024   27.3   3.9   26  148-173     4-29  (306)
148 PF12158 DUF3592:  Protein of u  24.0      86  0.0019   23.1   2.8   20  154-173     4-23  (148)
149 PF05568 ASFV_J13L:  African sw  24.0 1.1E+02  0.0025   27.5   4.0   22  158-179    36-57  (189)
150 PF12127 YdfA_immunity:  SigmaW  23.9      75  0.0016   30.6   3.0   10  170-179    40-49  (316)
151 PHA02973 hypothetical protein;  23.6      78  0.0017   26.3   2.7   10  178-187    21-30  (102)
152 PF05170 AsmA:  AsmA family;  I  23.5      67  0.0015   29.8   2.6   16  156-171    11-26  (604)
153 PRK09835 sensor kinase CusS; P  23.4 1.6E+02  0.0036   25.1   4.7   39  135-173   163-206 (482)
154 PF05399 EVI2A:  Ectropic viral  23.2      97  0.0021   28.7   3.5   11  128-138   105-115 (227)
155 KOG3927|consensus               23.1 1.3E+02  0.0028   28.3   4.3   28  147-174    47-74  (300)
156 PHA02650 hypothetical protein;  23.0      86  0.0019   25.2   2.8    6  167-172    66-71  (81)
157 TIGR01386 cztS_silS_copS heavy  23.0 1.1E+02  0.0023   25.7   3.5   11  152-162     7-17  (457)
158 KOG4463|consensus               22.9      77  0.0017   30.5   2.9   27  143-169    89-115 (323)
159 KOG3208|consensus               22.7      88  0.0019   29.0   3.1   19  153-171   211-229 (231)
160 PF15168 TRIQK:  Triple QxxK/R   22.6 1.1E+02  0.0023   24.7   3.1   18  156-173    56-73  (79)
161 PF14276 DUF4363:  Domain of un  22.6      94   0.002   23.6   2.8   12  155-166     5-16  (121)
162 PF04530 Viral_Beta_CD:  Viral   22.5      92   0.002   26.4   3.0   27  146-172    45-71  (122)
163 MTH00169 ATP8 ATP synthase F0   22.4 1.5E+02  0.0032   22.2   3.7   19  149-167     9-27  (67)
164 COG0601 DppB ABC-type dipeptid  22.3 1.3E+02  0.0029   27.3   4.2   27  147-173     3-29  (317)
165 PF09726 Macoilin:  Transmembra  22.3 1.1E+02  0.0023   31.2   3.9   10  167-176   129-138 (697)
166 PF14316 DUF4381:  Domain of un  22.2      92   0.002   24.7   2.8   13  167-179    36-48  (146)
167 PHA02967 hypothetical protein;  22.2      88  0.0019   26.8   2.8   34  134-175    17-50  (128)
168 TIGR01478 STEVOR variant surfa  22.2      96  0.0021   29.5   3.3   20  164-183   273-292 (295)
169 PF09972 DUF2207:  Predicted me  22.1   1E+02  0.0023   26.8   3.3   10   90-99    121-130 (511)
170 PF03579 SHP:  Small hydrophobi  22.0      84  0.0018   24.5   2.4   15  157-171    18-32  (64)
171 PRK15120 lipopolysaccharide AB  22.0 1.3E+02  0.0029   26.4   4.0   26  147-172     5-30  (366)
172 PRK15048 methyl-accepting chem  21.9 1.5E+02  0.0032   27.2   4.4   27  145-171   186-212 (553)
173 COG3162 Predicted membrane pro  21.8 1.4E+02  0.0031   24.8   3.9   23  145-167    24-46  (102)
174 PF10808 DUF2542:  Protein of u  21.7      57  0.0012   26.2   1.5   15  156-170     6-20  (79)
175 COG1622 CyoA Heme/copper-type   21.6 1.7E+02  0.0038   26.2   4.7   22  160-181    44-65  (247)
176 PF03176 MMPL:  MMPL family;  I  21.5 1.5E+02  0.0032   25.3   4.1   12  145-156   159-170 (333)
177 TIGR02972 TMAO_torE trimethyla  21.3 1.1E+02  0.0024   22.3   2.8   10  157-166    15-24  (47)
178 PTZ00260 dolichyl-phosphate be  21.1 1.5E+02  0.0032   26.3   4.1   20  142-161     3-22  (333)
179 COG4853 Uncharacterized protei  20.9      69  0.0015   30.2   2.1   17  155-171     8-24  (264)
180 PRK15105 peptidoglycan synthas  20.8 1.1E+02  0.0023   29.7   3.5    7  151-157    21-27  (578)
181 PF06682 DUF1183:  Protein of u  20.8      88  0.0019   29.4   2.8   14  158-171   164-177 (318)
182 PHA03083 poxvirus myristoylpro  20.7      69  0.0015   30.8   2.1   20   97-116   243-262 (334)
183 PF04790 Sarcoglycan_1:  Sarcog  20.6   1E+02  0.0022   27.9   3.1   19  154-172    19-37  (264)
184 PTZ00370 STEVOR; Provisional    20.5   1E+02  0.0022   29.4   3.1   20  164-183   269-288 (296)
185 PF06837 Fijivirus_P9-2:  Fijiv  20.3      99  0.0021   28.4   2.9   17  156-172   125-141 (214)
186 PF05510 Sarcoglycan_2:  Sarcog  20.3 1.2E+02  0.0026   29.4   3.6    6   76-81    184-189 (386)
187 COG5487 Small integral membran  20.3 1.1E+02  0.0025   23.1   2.7   20  151-174    32-51  (54)
188 PF00822 PMP22_Claudin:  PMP-22  20.3 1.5E+02  0.0032   22.4   3.5   32  149-180    71-102 (166)
189 TIGR03747 conj_TIGR03747 integ  20.2   2E+02  0.0044   25.8   4.9   43  136-178   124-167 (233)
190 PTZ00116 signal peptidase; Pro  20.2      69  0.0015   28.4   1.9   15  135-149     2-16  (185)
191 PF04612 T2SM:  Type II secreti  20.1      34 0.00075   26.4   0.0   18  154-171    18-35  (160)
192 PRK10833 putative assembly pro  20.1      75  0.0016   30.2   2.2   16  150-165     1-16  (617)
193 PF14992 TMCO5:  TMCO5 family    20.0 1.8E+02  0.0039   27.3   4.6   27  145-171   212-239 (280)
194 PF06422 PDR_CDR:  CDR ABC tran  20.0 1.4E+02  0.0031   22.9   3.4    9  169-177    66-74  (103)
195 PF07234 DUF1426:  Protein of u  20.0 1.6E+02  0.0036   25.0   3.9   28  141-168     8-36  (117)

No 1  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=95.97  E-value=0.0049  Score=48.23  Aligned_cols=36  Identities=28%  Similarity=0.600  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhcccCCccccccc
Q psy12992        153 VFFLFIVIFLLLILLFFFIGLEQRRKNDNKSQMGSG  188 (319)
Q Consensus       153 vfflfiviflllillfffigleqrrkndnksqmgsg  188 (319)
                      |||++|||++||+|++|++--..||+.-..-..|.+
T Consensus         3 ~l~~iii~~i~l~~~~~~~~~rRR~r~G~~P~~gt~   38 (130)
T PF12273_consen    3 VLFAIIIVAILLFLFLFYCHNRRRRRRGLQPIYGTR   38 (130)
T ss_pred             eeHHHHHHHHHHHHHHHHHHHHHHhhcCCCCcCCce
Confidence            444444444443333333323333333344444443


No 2  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=90.43  E-value=0.16  Score=39.74  Aligned_cols=27  Identities=26%  Similarity=0.590  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhcccCCc
Q psy12992        156 LFIVIFLLLILLFFFIGLEQRRKNDNK  182 (319)
Q Consensus       156 lfiviflllillfffigleqrrkndnk  182 (319)
                      +|++||+++||||||+++--+|+...+
T Consensus         3 ~l~~iii~~i~l~~~~~~~~~rRR~r~   29 (130)
T PF12273_consen    3 VLFAIIIVAILLFLFLFYCHNRRRRRR   29 (130)
T ss_pred             eeHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            578888888888888888877776543


No 3  
>PHA02909 hypothetical protein; Provisional
Probab=87.18  E-value=1.3  Score=34.65  Aligned_cols=53  Identities=32%  Similarity=0.681  Sum_probs=35.3

Q ss_pred             CceEEEEEee-eeEEEEeecceEEeehHHHHHHHHHHHH------HHHHHHHHHHHHHHH
Q psy12992        117 SSLVLSIVHT-DIRVVIKSHSWVIRVNFLVFIFLMRRVF------FLFIVIFLLLILLFF  169 (319)
Q Consensus       117 sslvlsivht-dirvvikshswvirvnflvfiflmrrvf------flfiviflllillff  169 (319)
                      .-|.||+-.. .-+|......+.|-|.|+.|..+.-..|      +.+|.|.+-||||||
T Consensus        11 nylmlsvdygngkkvyytentfcimvsfilfviiflsmftilacsyvyiaiiislillff   70 (72)
T PHA02909         11 NYLMLSVDYGNGKKVYYTENTFCIMVSFILFVIIFLSMFTILACSYVYIAIIISLILLFF   70 (72)
T ss_pred             CeEEEEEecCCCeEEEEeccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3456665433 2456667788889999988765544444      356777788888887


No 4  
>PRK13718 conjugal transfer protein TrbE; Provisional
Probab=80.97  E-value=2.5  Score=34.05  Aligned_cols=32  Identities=38%  Similarity=0.665  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhhcccCCcc
Q psy12992        152 RVFFLFIVIFLLLILLFFFIGLEQRRKNDNKS  183 (319)
Q Consensus       152 rvfflfiviflllillfffigleqrrkndnks  183 (319)
                      -+||++..-++++++.|||-.|+..++.|+++
T Consensus        46 a~~iI~~~gv~~~~ly~ffs~Ltkl~~~d~~k   77 (84)
T PRK13718         46 AVFVILYSGVLLFILYFFFSALTKLQKHDERK   77 (84)
T ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHhccccc
Confidence            45555556678888999999999988888754


No 5  
>TIGR01144 ATP_synt_b ATP synthase, F0 subunit b. This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase.
Probab=79.46  E-value=2.2  Score=33.06  Aligned_cols=19  Identities=5%  Similarity=0.453  Sum_probs=13.1

Q ss_pred             ehHHHHHHHHHHHHHHHHH
Q psy12992        141 VNFLVFIFLMRRVFFLFIV  159 (319)
Q Consensus       141 vnflvfiflmrrvfflfiv  159 (319)
                      |||+||+|++.+++|=-|.
T Consensus         3 i~Flil~~il~~~~~~pi~   21 (147)
T TIGR01144         3 ISFILLVWFCMKYVWPPLA   21 (147)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            6888888877776655443


No 6  
>PF07219 HemY_N:  HemY protein N-terminus;  InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins. These are membrane protein involved in a late step of protoheme IX synthesis [].
Probab=74.93  E-value=13  Score=28.21  Aligned_cols=42  Identities=33%  Similarity=0.560  Sum_probs=27.2

Q ss_pred             EEEeecceEEeehHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy12992        130 VVIKSHSWVIRVNFLVFIFLMRRVFFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       130 vvikshswvirvnflvfiflmrrvfflfiviflllillfffigle  174 (319)
                      |.|---.|.|..++.+|+.+.-   ++|+++++++-++.+++++.
T Consensus         3 V~I~~~~~~ie~sl~~~~~~l~---~~~~~l~ll~~ll~~~~~~p   44 (108)
T PF07219_consen    3 VLISWGGYRIETSLWVALILLL---LLFVVLYLLLRLLRRLLSLP   44 (108)
T ss_pred             EEEEECCEEEEeeHHHHHHHHH---HHHHHHHHHHHHHHHHHhCh
Confidence            5666778999999998887653   33444445555555555553


No 7  
>TIGR00540 hemY_coli hemY protein. This is an uncharacterized protein encoded next to a heme-biosynthetic enzyme in two gamma division proteobacteria (E. coli and H. influenzae). It is known in no other species. The gene symbol hemY is unfortunate in that an unrelated protein, protoporphyrinogen oxidase, is designated as HemG in E. coli but as HemY in Bacillus subtilis.
Probab=71.88  E-value=12  Score=33.09  Aligned_cols=29  Identities=10%  Similarity=0.227  Sum_probs=20.8

Q ss_pred             EEEEeecceEEeehHHHHHHHHHHHHHHH
Q psy12992        129 RVVIKSHSWVIRVNFLVFIFLMRRVFFLF  157 (319)
Q Consensus       129 rvvikshswvirvnflvfiflmrrvfflf  157 (319)
                      -|+|---.|.|.+++.+|++++--+||++
T Consensus        27 yv~i~~~~~~ie~s~~~~~~~~~~~~~~~   55 (409)
T TIGR00540        27 YVLIETANRIIEMSITGLAIFFIIALAII   55 (409)
T ss_pred             eEEEEECCEEEEeeHHHHHHHHHHHHHHH
Confidence            56777789999999999887654433333


No 8  
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=69.64  E-value=5  Score=31.86  Aligned_cols=6  Identities=33%  Similarity=0.617  Sum_probs=3.2

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      ++.|+.
T Consensus        31 l~~R~~   36 (159)
T PRK09173         31 LDARAD   36 (159)
T ss_pred             HHHHHH
Confidence            555553


No 9  
>PRK10747 putative protoheme IX biogenesis protein; Provisional
Probab=68.89  E-value=16  Score=32.46  Aligned_cols=23  Identities=13%  Similarity=0.288  Sum_probs=18.7

Q ss_pred             EEEEeecceEEeehHHHHHHHHH
Q psy12992        129 RVVIKSHSWVIRVNFLVFIFLMR  151 (319)
Q Consensus       129 rvvikshswvirvnflvfiflmr  151 (319)
                      -|+|---.|.|.+++.+|+++.-
T Consensus        27 yv~i~~~~~~ie~sl~~~~~~~~   49 (398)
T PRK10747         27 YVLIQTDNYNIETSVTGLAIILI   49 (398)
T ss_pred             eEEEEECCEEEEehHHHHHHHHH
Confidence            57777789999999999887653


No 10 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=67.77  E-value=7  Score=28.99  Aligned_cols=15  Identities=33%  Similarity=0.791  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHHHHH
Q psy12992        154 FFLFIVIFLLLILLF  168 (319)
Q Consensus       154 fflfiviflllillf  168 (319)
                      ||+.+|.|++|++++
T Consensus         2 l~~~~i~Flil~~~l   16 (132)
T PF00430_consen    2 LFWQLINFLILFFLL   16 (132)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHH
Confidence            444445554444433


No 11 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=67.77  E-value=6.2  Score=30.31  Aligned_cols=6  Identities=33%  Similarity=0.706  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|+.
T Consensus        34 l~~R~~   39 (140)
T PRK07353         34 VEERED   39 (140)
T ss_pred             HHHHHH
Confidence            455543


No 12 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=65.30  E-value=2.4  Score=34.52  Aligned_cols=29  Identities=17%  Similarity=0.521  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHhhhhhhcccCCcccccccc
Q psy12992        161 FLLLILLFFFIGLEQRRKNDNKSQMGSGL  189 (319)
Q Consensus       161 flllillfffigleqrrkndnksqmgsgl  189 (319)
                      |++++.+|||+-..|+++....-+|-+.|
T Consensus         9 ~vv~~~i~yf~iRPQkKr~Ke~~em~~sL   37 (113)
T PRK06531          9 FVVMLGLIFFMQRQQKKQAQERQNQLNAI   37 (113)
T ss_pred             HHHHHHHHHheechHHHHHHHHHHHHHhc
Confidence            33444445566556666554444444443


No 13 
>MTH00025 ATP8 ATP synthase F0 subunit 8; Validated
Probab=64.90  E-value=10  Score=28.98  Aligned_cols=27  Identities=33%  Similarity=0.612  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy12992        145 VFIFLMRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       145 vfiflmrrvfflfiviflllillfffi  171 (319)
                      .+.+.+--+|++||++++|++++-.+|
T Consensus         5 d~~~f~nQi~W~~i~f~il~~l~sk~i   31 (70)
T MTH00025          5 DTTTYLTQYRWTLIVLFLLLFFLVFFV   31 (70)
T ss_pred             chhHhHHHHHHHHHHHHHHHHHHHHHH
Confidence            344566888888888887776664443


No 14 
>KOG0860|consensus
Probab=64.78  E-value=8.3  Score=32.17  Aligned_cols=21  Identities=38%  Similarity=0.856  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy12992        150 MRRVFFLFIVIFLLLILLFFF  170 (319)
Q Consensus       150 mrrvfflfiviflllillfff  170 (319)
                      |+-...+.++|+|+.|++|||
T Consensus        94 m~~il~~v~~i~l~iiii~~~  114 (116)
T KOG0860|consen   94 MRIILGLVIIILLVVIIIYIF  114 (116)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            444455556666666666665


No 15 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=64.77  E-value=3  Score=32.32  Aligned_cols=23  Identities=30%  Similarity=0.837  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHhhhhhhccc
Q psy12992        157 FIVIFLLLILLFFFIGLEQRRKN  179 (319)
Q Consensus       157 fiviflllillfffigleqrrkn  179 (319)
                      |++||+||.++++|+-|..|++.
T Consensus        71 ~v~IlVily~IyYFVILRer~~~   93 (101)
T PF06024_consen   71 FVCILVILYAIYYFVILRERQKS   93 (101)
T ss_pred             HHHHHHHHhhheEEEEEeccccc
Confidence            44444444445555555544443


No 16 
>PF11100 TrbE:  Conjugal transfer protein TrbE ;  InterPro: IPR020150 TrbE is encoded by the F-plasmid and is located between traN and traF. The product of trbE is a small, integral, inner membrane protein. Mutation of trbE by insertional mutagenesis suggests that TrbE is not essential for F transfer from Escherichia coli (strain K12) under standard mating conditions [].
Probab=64.05  E-value=13  Score=29.01  Aligned_cols=31  Identities=35%  Similarity=0.673  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhhcccC
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFIGLEQRRKND  180 (319)
Q Consensus       150 mrrvfflfiviflllillfffigleqrrknd  180 (319)
                      +--+||++..-+++.++.+||-.|+.+++.|
T Consensus        36 l~a~~~I~~~g~~~~~~y~ffs~Lt~l~~~d   66 (66)
T PF11100_consen   36 LEAVFFILASGFMLFILYCFFSALTKLLQHD   66 (66)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            3456667777777888888998898877654


No 17 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=63.25  E-value=5.5  Score=29.55  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=5.1

Q ss_pred             ehHHHHHHHHHH
Q psy12992        141 VNFLVFIFLMRR  152 (319)
Q Consensus       141 vnflvfiflmrr  152 (319)
                      |||++|+|++.+
T Consensus         7 i~Flil~~~l~~   18 (132)
T PF00430_consen    7 INFLILFFLLNK   18 (132)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            344444444433


No 18 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=61.24  E-value=9.6  Score=30.41  Aligned_cols=6  Identities=33%  Similarity=0.767  Sum_probs=2.9

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|+.
T Consensus        37 l~~R~~   42 (164)
T PRK14473         37 LNERTR   42 (164)
T ss_pred             HHHHHH
Confidence            455543


No 19 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=61.22  E-value=9.3  Score=31.22  Aligned_cols=6  Identities=17%  Similarity=0.822  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|+.
T Consensus        47 l~~R~~   52 (173)
T PRK13453         47 MDKRER   52 (173)
T ss_pred             HHHHHH
Confidence            455543


No 20 
>PF05393 Hum_adeno_E3A:  Human adenovirus early E3A glycoprotein;  InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2.; GO: 0016021 integral to membrane
Probab=60.82  E-value=9.7  Score=31.27  Aligned_cols=25  Identities=32%  Similarity=0.731  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        154 FFLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       154 fflfiviflllillfffigleqrrk  178 (319)
                      ||..+.||+++||++|..-+..+|.
T Consensus        37 ~lvI~~iFil~VilwfvCC~kRkrs   61 (94)
T PF05393_consen   37 FLVICGIFILLVILWFVCCKKRKRS   61 (94)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            7778889999999998877765543


No 21 
>PRK03598 putative efflux pump membrane fusion protein; Provisional
Probab=59.82  E-value=4.1  Score=35.05  Aligned_cols=24  Identities=8%  Similarity=0.095  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        155 FLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       155 flfiviflllillfffigleqrrk  178 (319)
                      .+||||+|++|+||++.|-.+++.
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~   32 (331)
T PRK03598          9 LAVVVLAAAVAGGWWWYQSRQDNG   32 (331)
T ss_pred             hHHHHHHHHHHHheeEeeecCCcc
Confidence            457788888999999988776544


No 22 
>KOG1326|consensus
Probab=59.48  E-value=12  Score=40.44  Aligned_cols=22  Identities=36%  Similarity=0.795  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       150 mrrvfflfiviflllillfffi  171 (319)
                      .|-...+|++|++||++|+|||
T Consensus      1070 yr~~il~~l~ililll~l~~fl 1091 (1105)
T KOG1326|consen 1070 YRWYILLLLLILILLLLLALFL 1091 (1105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4556667777777777777765


No 23 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=59.20  E-value=11  Score=30.00  Aligned_cols=6  Identities=17%  Similarity=0.667  Sum_probs=2.9

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |+.|+.
T Consensus        34 l~~R~~   39 (159)
T PRK13461         34 IDSRQS   39 (159)
T ss_pred             HHHHHH
Confidence            455543


No 24 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=57.63  E-value=17  Score=25.94  Aligned_cols=15  Identities=33%  Similarity=0.600  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHH
Q psy12992        151 RRVFFLFIVIFLLLI  165 (319)
Q Consensus       151 rrvfflfivifllli  165 (319)
                      .|+++.|++++++++
T Consensus         6 ~KL~~~f~~~~~l~~   20 (181)
T PF12729_consen    6 TKLILGFGLIILLLL   20 (181)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            445555544444333


No 25 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=56.52  E-value=39  Score=23.99  Aligned_cols=20  Identities=30%  Similarity=0.677  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy12992        145 VFIFLMRRVFFLFIVIFLLL  164 (319)
Q Consensus       145 vfiflmrrvfflfiviflll  164 (319)
                      +.++=|--||+.++++++++
T Consensus         7 i~i~Gm~iVF~~L~lL~~~i   26 (79)
T PF04277_consen    7 IMIIGMGIVFLVLILLILVI   26 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34444555554444433333


No 26 
>PRK09470 cpxA two-component sensor protein; Provisional
Probab=56.31  E-value=15  Score=30.95  Aligned_cols=28  Identities=21%  Similarity=0.494  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy12992        149 LMRRVFFLFIVIFLLLILLFFFIGLEQR  176 (319)
Q Consensus       149 lmrrvfflfiviflllillfffigleqr  176 (319)
                      |..|++++|++++++++++++++...++
T Consensus         9 l~~rl~~~~~~~li~~~~i~~~~~~~~~   36 (461)
T PRK09470          9 LTARIFAIFWLTLALVLMLVLMLPKLDS   36 (461)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcccCc
Confidence            4566666666665555555555544443


No 27 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=55.06  E-value=10  Score=24.77  Aligned_cols=14  Identities=50%  Similarity=1.079  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHH
Q psy12992        154 FFLFIVIFLLLILL  167 (319)
Q Consensus       154 fflfiviflllill  167 (319)
                      |-|.+|.|+|||++
T Consensus         6 FalivVLFILLiIv   19 (24)
T PF09680_consen    6 FALIVVLFILLIIV   19 (24)
T ss_pred             chhHHHHHHHHHHh
Confidence            55666777776653


No 28 
>PF02167 Cytochrom_C1:  Cytochrome C1 family;  InterPro: IPR002326 Cytochrome bc1 complex (ubiquinol:ferricytochrome c oxidoreductase) is found in mitochondria, photosynthetic bacteria and other prokaryotes. It is minimally composed of three subunits: cytochrome b, carrying a low- and a high-potential haem group; cytochrome c1 (cyt c1); and a high-potential Rieske iron-sulphur protein. The general function of the complex is electron transfer between two mobile redox carriers, ubiquinol and cytochrome c; the electron transfer is coupled with proton translocation across the membrane, thus generating proton-motive force in the form of an electrochemical potential that can drive ATP synthesis. In its structure and functions, the cytochrome bc1 complex bears extensive analogy to the cytochrome b6f complex of chloroplasts and cyanobacteria; cyt c1 plays an analogous role to cytochrome f, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1P84_D 2IBZ_D 1EZV_D 3CX5_O 3CXH_O 1KB9_D 1KYO_D 1ZRT_Q 2CA4_B 2C9X_B ....
Probab=54.02  E-value=24  Score=31.30  Aligned_cols=29  Identities=31%  Similarity=0.409  Sum_probs=19.6

Q ss_pred             ehHHHHH----HHHHHHHHHHHHHHHHHHHHHH
Q psy12992        141 VNFLVFI----FLMRRVFFLFIVIFLLLILLFF  169 (319)
Q Consensus       141 vnflvfi----flmrrvfflfiviflllillff  169 (319)
                      ||||.+.    ..-|+...+.+++||+++++++
T Consensus       176 v~FL~w~aeP~~~~R~~~G~~vl~fL~il~~l~  208 (219)
T PF02167_consen  176 VNFLAWAAEPEKDERKRMGLKVLGFLLILTVLA  208 (219)
T ss_dssp             HHHHHHHH-TTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCchHHHHHHHHHHHHHHHHHHHHHH
Confidence            6888886    4667777777777775544433


No 29 
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=53.98  E-value=6.2  Score=32.03  Aligned_cols=23  Identities=13%  Similarity=0.198  Sum_probs=11.0

Q ss_pred             HHHHHHhhhhhhcccCCcccccc
Q psy12992        165 ILLFFFIGLEQRRKNDNKSQMGS  187 (319)
Q Consensus       165 illfffigleqrrkndnksqmgs  187 (319)
                      ++++||+--.|+++.....+|-+
T Consensus        15 ~i~yF~~iRPQkKr~K~~~~m~~   37 (109)
T PRK05886         15 GGFMYFASRRQRKAMQATIDLHE   37 (109)
T ss_pred             HHHHHHHccHHHHHHHHHHHHHH
Confidence            33455555566555443333433


No 30 
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=53.79  E-value=9.8  Score=28.52  Aligned_cols=28  Identities=14%  Similarity=0.530  Sum_probs=14.6

Q ss_pred             HHHHHHHHHhhhhhhcccCCcccccccc
Q psy12992        162 LLLILLFFFIGLEQRRKNDNKSQMGSGL  189 (319)
Q Consensus       162 lllillfffigleqrrkndnksqmgsgl  189 (319)
                      +++++++||+-..|+++.....+|-+.|
T Consensus        10 ~~~~i~yf~~~rpqkk~~k~~~~m~~~L   37 (82)
T PF02699_consen   10 IIFVIFYFLMIRPQKKQQKEHQEMLASL   37 (82)
T ss_dssp             HHHHHHHHHTHHHHHHHHHHHTTGGG--
T ss_pred             HHHHHHhhheecHHHHHHHHHHHHHHcC
Confidence            3444455556666666655555554444


No 31 
>KOG0812|consensus
Probab=53.32  E-value=14  Score=35.24  Aligned_cols=16  Identities=44%  Similarity=0.872  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy12992        149 LMRRVFFLFIVIFLLL  164 (319)
Q Consensus       149 lmrrvfflfiviflll  164 (319)
                      ||-++|++.||+||+.
T Consensus       291 LmvkiF~i~ivFflvf  306 (311)
T KOG0812|consen  291 LMVKIFGILIVFFLVF  306 (311)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            6667666665555443


No 32 
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane]
Probab=53.23  E-value=18  Score=34.60  Aligned_cols=30  Identities=37%  Similarity=0.560  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhhhc
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGLEQRR  177 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigleqrr  177 (319)
                      ...+|++++|++||++++++++.+..-|--
T Consensus        12 ~~~~r~~~~~~~i~~~~~~l~~~l~~~qi~   41 (599)
T COG0768          12 LFRRRLNLLFLIIFLLFALLILRLFYLQIV   41 (599)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHheecc
Confidence            445677777777777777776666555433


No 33 
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=52.69  E-value=13  Score=32.41  Aligned_cols=13  Identities=31%  Similarity=0.851  Sum_probs=5.9

Q ss_pred             EEeeeeccccccc
Q psy12992         85 VRWEVNLLGRAWQ   97 (319)
Q Consensus        85 vrwevnllgrawq   97 (319)
                      +.|....|--.|+
T Consensus       154 ~~~~~~~l~l~~~  166 (268)
T PF09451_consen  154 VDWDGCVLRLEWK  166 (268)
T ss_pred             ecCCCcEEEEEEe
Confidence            4444444444443


No 34 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=52.63  E-value=15  Score=31.55  Aligned_cols=6  Identities=33%  Similarity=0.756  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|++
T Consensus        34 l~~R~~   39 (246)
T TIGR03321        34 MDAREK   39 (246)
T ss_pred             HHHHHH
Confidence            455543


No 35 
>PF12297 EVC2_like:  Ellis van Creveld protein 2 like protein;  InterPro: IPR022076  This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism. 
Probab=52.51  E-value=17  Score=35.77  Aligned_cols=25  Identities=28%  Similarity=0.535  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        154 FFLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       154 fflfiviflllillfffigleqrrk  178 (319)
                      |..|+|-++|.++.|||++.-+..+
T Consensus        71 fvaflvslVL~~l~~f~l~r~~~l~   95 (429)
T PF12297_consen   71 FVAFLVSLVLTWLCFFLLARTRCLQ   95 (429)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcccc
Confidence            4456778888899999998877654


No 36 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=52.00  E-value=18  Score=25.67  Aligned_cols=15  Identities=53%  Similarity=1.032  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHhhh
Q psy12992        159 VIFLLLILLFFFIGL  173 (319)
Q Consensus       159 viflllillfffigl  173 (319)
                      +.|+.|++|+|+|.+
T Consensus        14 iVF~~L~lL~~~i~l   28 (79)
T PF04277_consen   14 IVFLVLILLILVISL   28 (79)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444443


No 37 
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=51.94  E-value=4.8  Score=27.81  Aligned_cols=11  Identities=55%  Similarity=1.126  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHH
Q psy12992        158 IVIFLLLILLF  168 (319)
Q Consensus       158 iviflllillf  168 (319)
                      ++|+++++++|
T Consensus         5 ili~~vi~~l~   15 (110)
T PF06480_consen    5 ILIILVILLLF   15 (110)
T ss_dssp             -----------
T ss_pred             ehhHHHHHHHH
Confidence            33333333333


No 38 
>PF10669 Phage_Gp23:  Protein gp23 (Bacteriophage A118);  InterPro: IPR018926  This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli. The function is currently unknown. 
Probab=51.84  E-value=22  Score=30.13  Aligned_cols=22  Identities=36%  Similarity=0.763  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFF  169 (319)
Q Consensus       148 flmrrvfflfiviflllillff  169 (319)
                      .|..-|||.|+.|.+++|||..
T Consensus        12 al~K~~~FA~L~i~~FiILLIi   33 (121)
T PF10669_consen   12 ALTKIMFFAFLFIVVFIILLII   33 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3566677766666666666554


No 39 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=51.49  E-value=17  Score=29.52  Aligned_cols=6  Identities=67%  Similarity=0.977  Sum_probs=3.1

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|+.
T Consensus        47 l~~R~~   52 (175)
T PRK14472         47 LEEREK   52 (175)
T ss_pred             HHHHHH
Confidence            455553


No 40 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=51.41  E-value=11  Score=25.75  Aligned_cols=9  Identities=56%  Similarity=0.667  Sum_probs=3.8

Q ss_pred             eehHHHHHH
Q psy12992        140 RVNFLVFIF  148 (319)
Q Consensus       140 rvnflvfif  148 (319)
                      .|||+.+.+
T Consensus         8 ~v~~~~~~~   16 (68)
T PF06305_consen    8 TVNFLFGQF   16 (68)
T ss_pred             EEEEEeeec
Confidence            344444433


No 41 
>PF13889 Chromosome_seg:  Chromosome segregation during meiosis
Probab=50.96  E-value=14  Score=27.51  Aligned_cols=26  Identities=38%  Similarity=0.464  Sum_probs=18.1

Q ss_pred             cccccCCCCCCceEEEEEeeeeEEEEeec
Q psy12992        107 WHKRDHSSSSSSLVLSIVHTDIRVVIKSH  135 (319)
Q Consensus       107 whkrdhsssssslvlsivhtdirvviksh  135 (319)
                      -|-|-.++++.-+-   +|+|||||+-.+
T Consensus         7 iHLrf~~~~~gr~Y---Lh~dIRvvF~~r   32 (56)
T PF13889_consen    7 IHLRFCCPRSGRFY---LHTDIRVVFARR   32 (56)
T ss_pred             EEEEEecCCCCcEE---EECCeEEEEecc
Confidence            46666666655554   599999998654


No 42 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=49.79  E-value=18  Score=29.25  Aligned_cols=6  Identities=67%  Similarity=1.104  Sum_probs=3.1

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|++
T Consensus        48 l~~R~~   53 (174)
T PRK07352         48 LEERRE   53 (174)
T ss_pred             HHHHHH
Confidence            455554


No 43 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=49.36  E-value=26  Score=31.97  Aligned_cols=31  Identities=32%  Similarity=0.583  Sum_probs=23.2

Q ss_pred             ehHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy12992        141 VNFLVFIFLMRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       141 vnflvfiflmrrvfflfiviflllillfffi  171 (319)
                      +|||.==|.--|...|||..++=+||||+=+
T Consensus       163 lnylARNFYNlr~lALflAFaINFILLFYKV  193 (274)
T PF06459_consen  163 LNYLARNFYNLRFLALFLAFAINFILLFYKV  193 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5666666777778888888888888888744


No 44 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=49.30  E-value=19  Score=29.21  Aligned_cols=6  Identities=33%  Similarity=0.700  Sum_probs=2.8

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|+.
T Consensus        45 l~~R~~   50 (173)
T PRK13460         45 LDERAS   50 (173)
T ss_pred             HHHHHH
Confidence            455543


No 45 
>PRK14475 F0F1 ATP synthase subunit B; Provisional
Probab=48.74  E-value=12  Score=30.42  Aligned_cols=6  Identities=17%  Similarity=0.207  Sum_probs=3.4

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|++
T Consensus        39 le~R~~   44 (167)
T PRK14475         39 LDAYAA   44 (167)
T ss_pred             HHHHHH
Confidence            566654


No 46 
>PRK14125 cell division suppressor protein YneA; Provisional
Probab=48.45  E-value=29  Score=27.30  Aligned_cols=22  Identities=18%  Similarity=0.415  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy12992        149 LMRRVFFLFIVIFLLLILLFFF  170 (319)
Q Consensus       149 lmrrvfflfiviflllillfff  170 (319)
                      +-++.||+.|+++|++.+.+|+
T Consensus         4 ~~~~~~~~ii~~~l~~~~~~~~   25 (103)
T PRK14125          4 KESKIHVSIFFVLTALVLLIFV   25 (103)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3445566555555555555554


No 47 
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=48.40  E-value=17  Score=24.12  Aligned_cols=13  Identities=46%  Similarity=1.093  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHH
Q psy12992        154 FFLFIVIFLLLIL  166 (319)
Q Consensus       154 fflfiviflllil  166 (319)
                      |.+.+|.|+|||+
T Consensus         8 f~livVLFILLII   20 (26)
T TIGR01732         8 FALIVVLFILLVI   20 (26)
T ss_pred             hHHHHHHHHHHHH
Confidence            4555666666654


No 48 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=48.21  E-value=17  Score=31.03  Aligned_cols=17  Identities=12%  Similarity=0.422  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy12992        155 FLFIVIFLLLILLFFFI  171 (319)
Q Consensus       155 flfiviflllillfffi  171 (319)
                      .++|++|++++++|.++
T Consensus         8 ~~~~~~~~~~~~~~~~~   24 (423)
T TIGR01843         8 TWLIAGLVVIFFLWAYF   24 (423)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            33444444444444333


No 49 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=47.50  E-value=17  Score=29.31  Aligned_cols=12  Identities=58%  Similarity=1.107  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHH
Q psy12992        157 FIVIFLLLILLF  168 (319)
Q Consensus       157 fiviflllillf  168 (319)
                      .+||.+|||+||
T Consensus        33 vLVIIiLlImlf   44 (85)
T PF10717_consen   33 VLVIIILLIMLF   44 (85)
T ss_pred             HHHHHHHHHHHH
Confidence            345556666665


No 50 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=47.46  E-value=21  Score=28.49  Aligned_cols=6  Identities=17%  Similarity=0.601  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|+.
T Consensus        36 l~~R~~   41 (141)
T PRK08476         36 MDNRNA   41 (141)
T ss_pred             HHHHHH
Confidence            455543


No 51 
>PF12459 DUF3687:  D-Ala-teichoic acid biosynthesis protein;  InterPro: IPR021008  Proteins in this family are bacterial proteins of approximately 50 amino acids in length. There are two completely conserved residues (L and Y) that may be functionally important. A number of entries are annotated as D-Ala-teichoic acid biosynthesis protein; however there is no direct evidence to support this annotation. 
Probab=47.44  E-value=31  Score=24.53  Aligned_cols=28  Identities=32%  Similarity=0.692  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy12992        146 FIFLMRRVFFLFIVIFLLLILLFFFIGLEQ  175 (319)
Q Consensus       146 fiflmrrvfflfiviflllillfffigleq  175 (319)
                      ..|+.+-+|++  +|+++|+.|+-+-|..|
T Consensus         8 ~~fi~~T~fYf--~Ill~L~ylYgy~g~~~   35 (42)
T PF12459_consen    8 VKFIGKTLFYF--AILLALIYLYGYSGIGQ   35 (42)
T ss_pred             HHHHHHHHHHH--HHHHHHHHHHhcCCCCC
Confidence            45666666554  45566666665555443


No 52 
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=47.06  E-value=8.1  Score=29.41  Aligned_cols=24  Identities=21%  Similarity=0.474  Sum_probs=12.7

Q ss_pred             HHHHHhhhhhhcccCCcccccccc
Q psy12992        166 LLFFFIGLEQRRKNDNKSQMGSGL  189 (319)
Q Consensus       166 llfffigleqrrkndnksqmgsgl  189 (319)
                      +++||+-..|+++.....+|-+.|
T Consensus        15 i~yf~~~rpqkK~~k~~~~m~~~L   38 (84)
T TIGR00739        15 IFYFLIIRPQRKRRKAHKKLIESL   38 (84)
T ss_pred             HHHHheechHHHHHHHHHHHHHhC
Confidence            345555556666655554554443


No 53 
>TIGR02832 spo_yunB sporulation protein YunB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. Mutation of this sigma E-regulated gene, designated yunB, has been shown to cause a sporulation defect.
Probab=46.52  E-value=16  Score=31.99  Aligned_cols=22  Identities=36%  Similarity=1.005  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       150 mrrvfflfiviflllillfffi  171 (319)
                      .|++|.+.+++|+++++.||++
T Consensus         3 ~R~~~l~~~i~~~~~~~~~~~~   24 (204)
T TIGR02832         3 FRRILLISLILFILLLLQFLWI   24 (204)
T ss_pred             eeehHHHHHHHHHHHHHHHHHh
Confidence            3666666666666655554443


No 54 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=46.42  E-value=18  Score=28.83  Aligned_cols=25  Identities=24%  Similarity=0.614  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHH-hhhhhhcccC
Q psy12992        156 LFIVIFLLLILLFFF-IGLEQRRKND  180 (319)
Q Consensus       156 lfiviflllillfff-igleqrrknd  180 (319)
                      .++++|++++++|+| |--.||++..
T Consensus        10 ~~ll~~vl~~~ifyFli~RPQrKr~K   35 (97)
T COG1862          10 VLLLPLVLIFAIFYFLIIRPQRKRMK   35 (97)
T ss_pred             HHHHHHHHHHHHHHHhhcCHHHHHHH
Confidence            344455555555555 4455554433


No 55 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=46.34  E-value=22  Score=30.57  Aligned_cols=6  Identities=50%  Similarity=0.905  Sum_probs=3.1

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |+.|+.
T Consensus        82 Le~R~~   87 (204)
T PRK09174         82 IETRRD   87 (204)
T ss_pred             HHHHHH
Confidence            555543


No 56 
>PF13789 DUF4181:  Domain of unknown function (DUF4181)
Probab=46.31  E-value=35  Score=26.41  Aligned_cols=46  Identities=35%  Similarity=0.860  Sum_probs=28.9

Q ss_pred             ceEEeehHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHhhhhhhcccCC
Q psy12992        136 SWVIRVNFLVFIFLMR-----RVFFLFIVIFLLLILLFFFIGLEQRRKNDN  181 (319)
Q Consensus       136 swvirvnflvfiflmr-----rvfflfiviflllillfffigleqrrkndn  181 (319)
                      .|.+++-+++.++.+.     +.+-..+++|+++++++.|=+..+.+-..+
T Consensus        35 e~~i~i~~ii~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~ra~mEWKy~re   85 (110)
T PF13789_consen   35 EWIIFIIFIILIFIFLFIFIFRFFYPYILIFLFLIILFCFRAFMEWKYDRE   85 (110)
T ss_pred             HHHhhhhHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHhccc
Confidence            3566666666553322     234556777888888888888877654433


No 57 
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=45.44  E-value=29  Score=26.72  Aligned_cols=12  Identities=50%  Similarity=0.933  Sum_probs=7.8

Q ss_pred             eecceEEeehHHHHH
Q psy12992        133 KSHSWVIRVNFLVFI  147 (319)
Q Consensus       133 kshswvirvnflvfi  147 (319)
                      .+|-|.   ||.+.|
T Consensus        45 ~sh~WR---N~GIli   56 (103)
T PF06422_consen   45 YSHRWR---NFGILI   56 (103)
T ss_pred             ccchhh---hHHHHH
Confidence            467775   876544


No 58 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=45.25  E-value=17  Score=32.05  Aligned_cols=26  Identities=38%  Similarity=0.392  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhcccCC
Q psy12992        156 LFIVIFLLLILLFFFIGLEQRRKNDN  181 (319)
Q Consensus       156 lfiviflllillfffigleqrrkndn  181 (319)
                      +.|.|||||+||+.-||+--.-|-.+
T Consensus        12 i~igi~Ll~lLl~cgiGcvwhwkhr~   37 (158)
T PF11770_consen   12 ISIGISLLLLLLLCGIGCVWHWKHRD   37 (158)
T ss_pred             HHHHHHHHHHHHHHhcceEEEeeccC
Confidence            46788888999999999876545433


No 59 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=45.23  E-value=7.9  Score=31.41  Aligned_cols=14  Identities=29%  Similarity=0.406  Sum_probs=6.8

Q ss_pred             HHHHHHHH--Hhhhhh
Q psy12992        162 LLLILLFF--FIGLEQ  175 (319)
Q Consensus       162 lllillff--figleq  175 (319)
                      +++|.+|+  ...++.
T Consensus        92 v~~Iv~~~Cc~c~~~K  107 (179)
T PF13908_consen   92 VVLIVCFCCCCCCLYK  107 (179)
T ss_pred             HHhHhhheeccccccc
Confidence            44444444  456665


No 60 
>PF06678 DUF1179:  Protein of unknown function (DUF1179);  InterPro: IPR009564 This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown.
Probab=43.96  E-value=22  Score=29.49  Aligned_cols=17  Identities=29%  Similarity=0.278  Sum_probs=10.6

Q ss_pred             HHHHHHHHhhhhhhccc
Q psy12992        163 LLILLFFFIGLEQRRKN  179 (319)
Q Consensus       163 llillfffigleqrrkn  179 (319)
                      +.+||++.|-.-|++|+
T Consensus        16 ~~lll~~~iv~C~sKKK   32 (103)
T PF06678_consen   16 PFLLLIVSIVQCQSKKK   32 (103)
T ss_pred             HHHHHHHHHHHhhhccc
Confidence            44555566667777665


No 61 
>MTH00216 ND1 NADH dehydrogenase subunit 1; Provisional
Probab=43.71  E-value=42  Score=30.46  Aligned_cols=6  Identities=50%  Similarity=0.954  Sum_probs=3.2

Q ss_pred             HHHHHH
Q psy12992        145 VFIFLM  150 (319)
Q Consensus       145 vfiflm  150 (319)
                      |||.++
T Consensus         3 ~~~~~~    8 (327)
T MTH00216          3 VFIIFY    8 (327)
T ss_pred             HHHHHH
Confidence            555554


No 62 
>PF11772 EpuA:  DNA-directed RNA polymerase subunit beta;  InterPro: IPR024596 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This entry represents the short 60-residue long bacterial family that is the beta subunit of the DNA-directed RNA polymerase, likely to be 2.7.7.6 from EC It is membrane-bound and is referred to by the name EpuA.
Probab=42.79  E-value=11  Score=26.85  Aligned_cols=14  Identities=50%  Similarity=0.783  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHhhh
Q psy12992        160 IFLLLILLFFFIGL  173 (319)
Q Consensus       160 iflllillfffigl  173 (319)
                      ++++|++++|++|+
T Consensus         3 ~V~lL~~~~l~iGl   16 (47)
T PF11772_consen    3 LVLLLAILALAIGL   16 (47)
T ss_pred             eHHHHHHHHHHHHH
Confidence            34455556666665


No 63 
>PRK14401 membrane protein; Provisional
Probab=42.73  E-value=48  Score=29.47  Aligned_cols=55  Identities=20%  Similarity=0.246  Sum_probs=41.7

Q ss_pred             EeecceEEee----------hHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccCCccccc
Q psy12992        132 IKSHSWVIRV----------NFLVFIFLMRRVFFLFIVIFLLLILLFFFIGLEQRRKNDNKSQMG  186 (319)
Q Consensus       132 ikshswvirv----------nflvfiflmrrvfflfiviflllillfffigleqrrkndnksqmg  186 (319)
                      +-.|.|-+=.          -+-+++.++..++.+.++||+.++-||-+.--.|||+.-|.-..|
T Consensus        83 VlGH~fPifl~FkGGKGVAtslGvll~l~p~~~li~~~ifl~v~~~~~~~~~~~~r~~~~~~p~~  147 (187)
T PRK14401         83 VAGHCWPVFFRFRGGGGIAPTLGFFLVLAPGTTLGTVAFGLAVAGLYRALLWRQRRKGLYPIPFG  147 (187)
T ss_pred             HHccCCchhhCCcCccHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHccccccCCcCCchh
Confidence            3457776533          345778888889999999999999999888888999877765544


No 64 
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=42.65  E-value=12  Score=29.74  Aligned_cols=23  Identities=26%  Similarity=0.483  Sum_probs=11.7

Q ss_pred             HHHHhhhhhhcccCCcccccccc
Q psy12992        167 LFFFIGLEQRRKNDNKSQMGSGL  189 (319)
Q Consensus       167 lfffigleqrrkndnksqmgsgl  189 (319)
                      ++||+-..|+++.....+|-+.|
T Consensus        31 ~yf~~~RpqkK~~k~~~~~~~~L   53 (106)
T PRK05585         31 FYFLIIRPQQKRQKEHKKMLSSL   53 (106)
T ss_pred             HHHHhccHHHHHHHHHHHHHHhc
Confidence            34455456666655444444443


No 65 
>COG4395 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.23  E-value=49  Score=30.98  Aligned_cols=33  Identities=42%  Similarity=0.561  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHH--HHHHHHHH-HHHHhhhhhhcccCC
Q psy12992        148 FLMRRVFFLFI--VIFLLLIL-LFFFIGLEQRRKNDN  181 (319)
Q Consensus       148 flmrrvfflfi--viflllil-lfffigleqrrkndn  181 (319)
                      ++|-..||..+  +|||+||. |-|.|++| .|+.+.
T Consensus        47 ~~~~~~f~gia~~~~~l~l~~lig~~~~~~-~r~f~~   82 (281)
T COG4395          47 MFFGGLFFGIAAFLIFLLLITLIGFVIMLE-MRFFDP   82 (281)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHh-cccccc
Confidence            44455666666  67787774 44555555 455554


No 66 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=41.91  E-value=28  Score=28.26  Aligned_cols=10  Identities=40%  Similarity=0.969  Sum_probs=4.0

Q ss_pred             HHHHHHHHHH
Q psy12992        158 IVIFLLLILL  167 (319)
Q Consensus       158 iviflllill  167 (319)
                      +|.|++|+++
T Consensus        23 ~i~Flil~~i   32 (173)
T PRK13460         23 LVTFLVVVLV   32 (173)
T ss_pred             HHHHHHHHHH
Confidence            3344443333


No 67 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=41.33  E-value=29  Score=28.47  Aligned_cols=6  Identities=33%  Similarity=0.905  Sum_probs=3.2

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|+.
T Consensus        53 l~~R~~   58 (184)
T CHL00019         53 LDNRKQ   58 (184)
T ss_pred             HHHHHH
Confidence            455554


No 68 
>PF13584 BatD:  Oxygen tolerance
Probab=41.32  E-value=35  Score=30.95  Aligned_cols=21  Identities=33%  Similarity=0.714  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q psy12992        153 VFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       153 vfflfiviflllillfffigl  173 (319)
                      +|++++++.++++++++++..
T Consensus       427 ~~~~l~~~~~l~~~~~~~~~~  447 (484)
T PF13584_consen  427 WFWLLLLLPLLLLLLLLILRR  447 (484)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            444444444444444444433


No 69 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=40.86  E-value=32  Score=22.32  Aligned_cols=16  Identities=25%  Similarity=0.854  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy12992        148 FLMRRVFFLFIVIFLL  163 (319)
Q Consensus       148 flmrrvfflfivifll  163 (319)
                      -.|++++|+++++|+|
T Consensus         5 ~mmKkil~~l~a~~~L   20 (25)
T PF08139_consen    5 SMMKKILFPLLALFML   20 (25)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3578999888888765


No 70 
>PF06679 DUF1180:  Protein of unknown function (DUF1180);  InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown.
Probab=40.40  E-value=35  Score=29.32  Aligned_cols=28  Identities=25%  Similarity=0.541  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhhc
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFIGLEQRR  177 (319)
Q Consensus       150 mrrvfflfiviflllillfffigleqrr  177 (319)
                      ..|.|+.|+++..++|+.|.|=.+.-||
T Consensus        94 l~R~~~Vl~g~s~l~i~yfvir~~R~r~  121 (163)
T PF06679_consen   94 LKRALYVLVGLSALAILYFVIRTFRLRR  121 (163)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            3577878888777777777665555444


No 71 
>PF03935 SKN1:  Beta-glucan synthesis-associated protein (SKN1);  InterPro: IPR005629  This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules []. 
Probab=39.94  E-value=26  Score=34.95  Aligned_cols=25  Identities=40%  Similarity=0.510  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        149 LMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       149 lmrrvfflfiviflllillfffigl  173 (319)
                      =.|-+.=++.+++|+|.||++|||+
T Consensus        38 s~RGl~Nlg~LilL~lGLL~LFigy   62 (504)
T PF03935_consen   38 SRRGLLNLGGLILLILGLLMLFIGY   62 (504)
T ss_pred             chhhhhHHHHHHHHHHHHHHHHHHh
Confidence            3444444555555555555566654


No 72 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=39.35  E-value=70  Score=23.26  Aligned_cols=13  Identities=54%  Similarity=1.122  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHH
Q psy12992        153 VFFLFIVIFLLLI  165 (319)
Q Consensus       153 vfflfivifllli  165 (319)
                      .|.||+||..|+|
T Consensus        15 ~~llflv~imlii   27 (43)
T PF11395_consen   15 SFLLFLVIIMLII   27 (43)
T ss_pred             HHHHHHHHHHHHH
Confidence            3555655554444


No 73 
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=38.99  E-value=33  Score=29.23  Aligned_cols=6  Identities=33%  Similarity=0.833  Sum_probs=3.2

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|++
T Consensus        77 L~~R~~   82 (205)
T PRK06231         77 LNKRKE   82 (205)
T ss_pred             HHHHHH
Confidence            555554


No 74 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=38.78  E-value=40  Score=33.80  Aligned_cols=28  Identities=36%  Similarity=0.715  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHH--HHHHHHHHhhhh
Q psy12992        147 IFLMRRVFFLFIVIFL--LLILLFFFIGLE  174 (319)
Q Consensus       147 iflmrrvfflfivifl--llillfffigle  174 (319)
                      .|||--|.|.|++.++  |+.+++|++|.-
T Consensus       460 ~~Lm~gv~~~Flf~~~l~l~~~~~Fl~G~~  489 (806)
T PF05478_consen  460 NFLMAGVGLSFLFSWFLMLLVLFYFLVGGN  489 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            4667777666665544  445566777754


No 75 
>PHA02818 hypothetical protein; Provisional
Probab=38.74  E-value=59  Score=26.68  Aligned_cols=20  Identities=20%  Similarity=0.369  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhhh
Q psy12992        154 FFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       154 fflfiviflllillfffigle  174 (319)
                      +++.+|+||+ +.+||.+-.+
T Consensus        67 y~~L~~~~l~-~~~y~~~~~~   86 (92)
T PHA02818         67 YKILFSILLL-SILYDAFTHS   86 (92)
T ss_pred             HHHHHHHHHH-HHHHHHHHHH
Confidence            4455577776 5555555544


No 76 
>COG5341 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.63  E-value=16  Score=31.51  Aligned_cols=17  Identities=29%  Similarity=0.547  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy12992        154 FFLFIVIFLLLILLFFF  170 (319)
Q Consensus       154 fflfiviflllillfff  170 (319)
                      ++|+|.+|+++++.+++
T Consensus        17 v~LiI~sf~~i~~f~~a   33 (132)
T COG5341          17 VMLIILSFLPILLFSLA   33 (132)
T ss_pred             hHHHHHHHHHHHhheee
Confidence            45666666655544443


No 77 
>PRK12705 hypothetical protein; Provisional
Probab=38.46  E-value=38  Score=33.34  Aligned_cols=18  Identities=17%  Similarity=0.502  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy12992        153 VFFLFIVIFLLLILLFFF  170 (319)
Q Consensus       153 vfflfiviflllillfff  170 (319)
                      +|||||+|++++++.|++
T Consensus         9 ~~~~~~~~~~~~~~~~~~   26 (508)
T PRK12705          9 ILLLLIGLLLGVLVVLLK   26 (508)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            356777777666665554


No 78 
>TIGR03142 cytochro_ccmI cytochrome c-type biogenesis protein CcmI. This TPR repeat-containing protein is the CcmI protein (also called CycH) of c-type cytochrome biogenesis. CcmI is thought to act as an apo-cytochrome c chaperone. This model describes the N-terminal region of the protein, Members of this protein family
Probab=38.46  E-value=32  Score=26.72  Aligned_cols=21  Identities=29%  Similarity=0.678  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhhh
Q psy12992        154 FFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       154 fflfiviflllillfffigle  174 (319)
                      |++++.+++++.++|++.-+-
T Consensus         2 fWl~~a~l~~~a~~~v~~pl~   22 (117)
T TIGR03142         2 FWIVAALLTLVALLFLLLPLL   22 (117)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            445555555555555554443


No 79 
>PF15202 Adipogenin:  Adipogenin
Probab=37.69  E-value=59  Score=26.11  Aligned_cols=10  Identities=60%  Similarity=0.690  Sum_probs=5.5

Q ss_pred             eehHHHHHHH
Q psy12992        140 RVNFLVFIFL  149 (319)
Q Consensus       140 rvnflvfifl  149 (319)
                      -||=|.|-||
T Consensus         8 lvndltfsfl   17 (81)
T PF15202_consen    8 LVNDLTFSFL   17 (81)
T ss_pred             hhchhhHHHH
Confidence            4565555555


No 80 
>PF13129 DUF3953:  Protein of unknown function (DUF3953)
Probab=36.82  E-value=29  Score=23.84  Aligned_cols=20  Identities=40%  Similarity=0.715  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHhhhhhhcccC
Q psy12992        161 FLLLILLFFFIGLEQRRKND  180 (319)
Q Consensus       161 flllillfffigleqrrknd  180 (319)
                      +++|-+++|.+|+|+-+|++
T Consensus         2 ~~lLG~m~~~~Gi~e~kk~~   21 (42)
T PF13129_consen    2 QILLGLMMFIIGIEEIKKER   21 (42)
T ss_pred             hHHHHHHHHHHHHHHHHhcc
Confidence            45667888999999988654


No 81 
>PF06366 FlhE:  Flagellar protein FlhE;  InterPro: IPR009420 This family consists of several Enterobacterial FlhE flagellar proteins. The exact function of this family is unknown [].; GO: 0019861 flagellum
Probab=36.78  E-value=31  Score=27.96  Aligned_cols=23  Identities=30%  Similarity=0.671  Sum_probs=19.3

Q ss_pred             CeeeEEEEeeeeccc------cccccCCc
Q psy12992         79 GKVITKVRWEVNLLG------RAWQCNSP  101 (319)
Q Consensus        79 gkvitkvrwevnllg------rawqcnsp  101 (319)
                      +-+||.|.|..+|++      ++|-|+.-
T Consensus        26 ~~~it~V~WRy~l~~~~P~gL~v~LC~~~   54 (106)
T PF06366_consen   26 SATITRVSWRYQLLSPPPAGLQVRLCSPT   54 (106)
T ss_pred             CCEEEEEEEEEEECCCCCCCeEEEecCCC
Confidence            568999999999998      57888754


No 82 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=36.34  E-value=37  Score=28.60  Aligned_cols=6  Identities=17%  Similarity=0.263  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      |++|.+
T Consensus        33 LeeR~~   38 (154)
T PRK06568         33 LDAKIL   38 (154)
T ss_pred             HHHHHH
Confidence            455543


No 83 
>PF06084 Cytomega_TRL10:  Cytomegalovirus TRL10 protein;  InterPro: IPR009284 This family consists of several Cytomegalovirus TRL10 proteins. TRL10 represents a structural component of the virus particle and like the other HCMV envelope glycoproteins, is present in a disulphide-linked complex [].
Probab=35.86  E-value=24  Score=30.69  Aligned_cols=27  Identities=33%  Similarity=0.714  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHhhhhhhcccCCcc
Q psy12992        157 FIVIFLLLILLFFFIGLEQRRKNDNKS  183 (319)
Q Consensus       157 fiviflllillfffigleqrrkndnks  183 (319)
                      ||...++|+++||.|--..|.+||+..
T Consensus        65 fiatliillviffviy~re~~~~~~gt   91 (150)
T PF06084_consen   65 FIATLIILLVIFFVIYSREEEKNNNGT   91 (150)
T ss_pred             HHHHHHHHHHHhheeEeccccccCCCc
Confidence            444444555667888777788887643


No 84 
>PHA02650 hypothetical protein; Provisional
Probab=35.65  E-value=54  Score=26.38  Aligned_cols=6  Identities=83%  Similarity=1.320  Sum_probs=2.6

Q ss_pred             Eeecce
Q psy12992        132 IKSHSW  137 (319)
Q Consensus       132 ikshsw  137 (319)
                      ||+-.|
T Consensus        41 ~~~~~~   46 (81)
T PHA02650         41 IKSVSW   46 (81)
T ss_pred             ccccCC
Confidence            344444


No 85 
>PRK10697 DNA-binding transcriptional activator PspC; Provisional
Probab=35.64  E-value=19  Score=29.56  Aligned_cols=8  Identities=13%  Similarity=0.231  Sum_probs=4.5

Q ss_pred             ceEEeehH
Q psy12992        136 SWVIRVNF  143 (319)
Q Consensus       136 swvirvnf  143 (319)
                      .|.+|+-|
T Consensus        33 ~~~VRl~~   40 (118)
T PRK10697         33 VKLVRIIV   40 (118)
T ss_pred             HHHHHHHH
Confidence            46667643


No 86 
>PF13131 DUF3951:  Protein of unknown function (DUF3951)
Probab=35.62  E-value=38  Score=25.51  Aligned_cols=16  Identities=50%  Similarity=0.995  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHhhh
Q psy12992        158 IVIFLLLILLFFFIGL  173 (319)
Q Consensus       158 iviflllillfffigl  173 (319)
                      |-||++.+.+||.||+
T Consensus         6 iG~~~~~~~I~~lIgf   21 (53)
T PF13131_consen    6 IGIILFTIFIFFLIGF   21 (53)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3344555555555555


No 87 
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=35.48  E-value=55  Score=22.99  Aligned_cols=11  Identities=36%  Similarity=0.748  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHH
Q psy12992        155 FLFIVIFLLLI  165 (319)
Q Consensus       155 flfivifllli  165 (319)
                      ++|.++|++..
T Consensus       223 ~~F~i~f~~~~  233 (237)
T PF02932_consen  223 ILFPIAFILFN  233 (237)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            33444444333


No 88 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=35.45  E-value=41  Score=27.50  Aligned_cols=6  Identities=33%  Similarity=0.932  Sum_probs=2.2

Q ss_pred             HHHHHH
Q psy12992        159 VIFLLL  164 (319)
Q Consensus       159 viflll  164 (319)
                      +.|++|
T Consensus        26 InFliL   31 (173)
T PRK13453         26 LTFIVL   31 (173)
T ss_pred             HHHHHH
Confidence            333333


No 89 
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A).
Probab=35.20  E-value=48  Score=28.03  Aligned_cols=14  Identities=21%  Similarity=0.342  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHH
Q psy12992        155 FLFIVIFLLLILLF  168 (319)
Q Consensus       155 flfiviflllillf  168 (319)
                      +||+++|+++.++|
T Consensus        10 ~l~~~~~~~~~~~~   23 (334)
T TIGR00998        10 VLLIVVAGAYAIYW   23 (334)
T ss_pred             HHHHHHHHHHHHHH
Confidence            44455555444433


No 90 
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=35.12  E-value=45  Score=25.32  Aligned_cols=14  Identities=36%  Similarity=0.662  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHhhh
Q psy12992        160 IFLLLILLFFFIGL  173 (319)
Q Consensus       160 iflllillfffigl  173 (319)
                      .|+.|++|+|++.+
T Consensus        18 VF~fL~lLi~~i~~   31 (82)
T TIGR01195        18 VFLFLSLLIYAVRG   31 (82)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444445544444


No 91 
>PF09988 DUF2227:  Uncharacterized metal-binding protein (DUF2227);  InterPro: IPR019250  This entry represents hypothetical bacterial proteins that possess metal binding properties; however, their exact function has not yet been determined. 
Probab=35.00  E-value=68  Score=27.50  Aligned_cols=7  Identities=43%  Similarity=0.463  Sum_probs=5.0

Q ss_pred             ecceEEe
Q psy12992        134 SHSWVIR  140 (319)
Q Consensus       134 shswvir  140 (319)
                      ||.|+|=
T Consensus        80 SH~piiG   86 (169)
T PF09988_consen   80 SHGPIIG   86 (169)
T ss_pred             cccchhh
Confidence            6888763


No 92 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=34.98  E-value=41  Score=27.91  Aligned_cols=6  Identities=33%  Similarity=0.601  Sum_probs=2.8

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|+.
T Consensus        60 l~~R~~   65 (181)
T PRK13454         60 LAERQG   65 (181)
T ss_pred             HHHHHH
Confidence            455543


No 93 
>PRK10352 nickel transporter permease NikB; Provisional
Probab=34.85  E-value=56  Score=29.17  Aligned_cols=28  Identities=18%  Similarity=0.620  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy12992        147 IFLMRRVFFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       147 iflmrrvfflfiviflllillfffigle  174 (319)
                      -|+.||.+..++++|++..+.|+++-+-
T Consensus         3 ~~i~~rl~~~~~~l~~v~~~~F~l~~~~   30 (314)
T PRK10352          3 RYILRRLLLLIPMLLAASVIIFLMLRLG   30 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHC
Confidence            3678999888888888887888776553


No 94 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=34.69  E-value=63  Score=23.98  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHHHH
Q psy12992        152 RVFFLFIVIFLLL  164 (319)
Q Consensus       152 rvfflfiviflll  164 (319)
                      +...+|+++|+++
T Consensus        37 ~~~~i~~~~~i~~   49 (59)
T PF09889_consen   37 KTQYIFFGIFILF   49 (59)
T ss_pred             HHHHHHHHHHHHH
Confidence            3344444444443


No 95 
>PF05781 MRVI1:  MRVI1 protein;  InterPro: IPR008677 This family consists of mammalian MRVI1 proteins which are related to the lymphoid-restricted membrane protein (JAW1) and the IP3 receptor associated cGMP kinase substrates A and B (IRAGA and IRAGB). The function of MRVI1 is unknown although mutations in the Mrvi1 gene induces myeloid leukaemia by altering the expression of a gene important for myeloid cell growth and/or differentiation so it has been speculated that Mrvi1 is a tumour suppressor gene []. IRAG is very similar in sequence to MRVI1 and is an essential NO/cGKI-dependent regulator of IP3-induced calcium release. Activation of cGKI decreases IP3-stimulated elevations in intracellular calcium, induces smooth muscle relaxation and contributes to the antiproliferative and pro-apoptotic effects of NO/cGMP []. Jaw1 is a member of a class of proteins with COOH-terminal hydrophobic membrane anchors and is structurally similar to proteins involved in vesicle targeting and fusion. This suggests that the function and/or the structure of the ER in lymphocytes may be modified by lymphoid-restricted resident ER proteins [].
Probab=34.36  E-value=25  Score=35.46  Aligned_cols=39  Identities=26%  Similarity=0.358  Sum_probs=19.4

Q ss_pred             ecceEEeehHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        134 SHSWVIRVNFLVFIFLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       134 shswvirvnflvfiflmrrvfflfiviflllillfffigl  173 (319)
                      -.+|+..+..++== +-|-+++.+++|+||.+|+.|+-|+
T Consensus       462 ves~~~~Lk~s~pK-anK~LWIsvAliVLLAaLlSfLtg~  500 (538)
T PF05781_consen  462 VESWASYLKTSFPK-ANKVLWISVALIVLLAALLSFLTGL  500 (538)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            35566554433321 2233344445555566666666664


No 96 
>PF07946 DUF1682:  Protein of unknown function (DUF1682);  InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function. One member (Q920S6 from SWISSPROT) is described as being an adipocyte-specific protein, but no evidence of this was found. 
Probab=34.25  E-value=35  Score=30.64  Aligned_cols=18  Identities=39%  Similarity=0.789  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHhhhh
Q psy12992        157 FIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       157 fiviflllillfffigle  174 (319)
                      ++++|+++++++||+|--
T Consensus         9 ~~l~~l~~y~~~y~~G~~   26 (321)
T PF07946_consen    9 IFLAFLLLYVVNYFIGKS   26 (321)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455666777788888843


No 97 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=34.12  E-value=42  Score=24.38  Aligned_cols=9  Identities=33%  Similarity=0.545  Sum_probs=3.2

Q ss_pred             HHHHHHHHH
Q psy12992        161 FLLLILLFF  169 (319)
Q Consensus       161 flllillff  169 (319)
                      |+++++|.+
T Consensus        10 ~iv~~lLg~   18 (50)
T PF12606_consen   10 FIVMGLLGL   18 (50)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 98 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=34.10  E-value=26  Score=30.46  Aligned_cols=19  Identities=26%  Similarity=0.364  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy12992        153 VFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       153 vfflfiviflllillfffi  171 (319)
                      ++.++||++++++++||++
T Consensus        13 ~~~~~~~~~~~~~~~~~~~   31 (346)
T PRK10476         13 LPALAIVALAIVALVFVIW   31 (346)
T ss_pred             chhHHHHHHHHHHHHHHhe
Confidence            4455666666666666555


No 99 
>PRK10819 transport protein TonB; Provisional
Probab=33.93  E-value=38  Score=30.03  Aligned_cols=19  Identities=21%  Similarity=0.118  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy12992        145 VFIFLMRRVFFLFIVIFLL  163 (319)
Q Consensus       145 vfiflmrrvfflfivifll  163 (319)
                      ...|++||..+.+|+..+|
T Consensus         4 ~~~~l~rr~~~~li~Sv~l   22 (246)
T PRK10819          4 MTLDLPRRFPWPTLLSVGL   22 (246)
T ss_pred             cccchhhhHHHHHHHHHHH
Confidence            3457788887766654333


No 100
>PRK09471 oppB oligopeptide transporter permease; Reviewed
Probab=32.39  E-value=67  Score=28.10  Aligned_cols=26  Identities=31%  Similarity=0.742  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigl  173 (319)
                      |+.||++..++++|++.++.|+.+-+
T Consensus         4 ~~~~r~~~~~~~l~~~~~~~F~l~~~   29 (306)
T PRK09471          4 FILRRCLEAIPTLFILITISFFMMRL   29 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            67799999888888888888887765


No 101
>PF14348 DUF4400:  Domain of unknown function (DUF4400)
Probab=32.23  E-value=1e+02  Score=25.47  Aligned_cols=44  Identities=25%  Similarity=0.611  Sum_probs=28.3

Q ss_pred             cceEEeehHHHHHHHHHHHH-HHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        135 HSWVIRVNFLVFIFLMRRVF-FLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       135 hswvirvnflvfiflmrrvf-flfiviflllillfffigleqrrk  178 (319)
                      ..|+.-+-++++.|+.|-.. ++.+..|+++++..++=|+-+|+-
T Consensus        91 ~~y~~a~~~~~~~~~~Rl~il~~~lp~~~~~~~~~~vDGl~~R~i  135 (198)
T PF14348_consen   91 RDYLLAAWYVLYVFLIRLAILLLWLPLFLLFALAALVDGLVRRDI  135 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34555556667777777543 334556666677777789988864


No 102
>PF10947 DUF2628:  Protein of unknown function (DUF2628)    ;  InterPro: IPR024399 Some members in this family of proteins have been annotated as YigF. Their function is currently unknown.
Probab=32.01  E-value=1.2e+02  Score=22.69  Aligned_cols=25  Identities=24%  Similarity=0.566  Sum_probs=14.1

Q ss_pred             EEeehHHHHHH-----HHHHHHHHHHHHHH
Q psy12992        138 VIRVNFLVFIF-----LMRRVFFLFIVIFL  162 (319)
Q Consensus       138 virvnflvfif-----lmrrvfflfivifl  162 (319)
                      .+..|+..|+|     +.|+....++++++
T Consensus        35 ~~~fnw~Af~f~~~w~l~r~mw~~~~~~~~   64 (108)
T PF10947_consen   35 KPSFNWWAFFFGPLWLLYRKMWLYAIIFLA   64 (108)
T ss_pred             CccchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            55567776654     56666555544333


No 103
>MTH00260 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=31.79  E-value=61  Score=23.31  Aligned_cols=19  Identities=16%  Similarity=0.466  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q psy12992        154 FFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       154 fflfiviflllillfffig  172 (319)
                      |++|+++|++++.+..|+-
T Consensus        13 ~~~f~~~~~~~~~~~~~~~   31 (53)
T MTH00260         13 MIIFWFILLIFASSMWWSQ   31 (53)
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            3455556666555555553


No 104
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=31.38  E-value=47  Score=31.38  Aligned_cols=6  Identities=17%  Similarity=0.518  Sum_probs=3.0

Q ss_pred             hhhhcc
Q psy12992        173 LEQRRK  178 (319)
Q Consensus       173 leqrrk  178 (319)
                      +++|++
T Consensus        30 l~~R~~   35 (445)
T PRK13428         30 MAARQD   35 (445)
T ss_pred             HHHHHH
Confidence            455554


No 105
>TIGR02459 CbtB cobalt transporter subunit CbtB (proposed). This model represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of a single trans-membrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a protein (CbtA) predicted to have five additional trans-membrane segments.
Probab=31.35  E-value=57  Score=24.78  Aligned_cols=14  Identities=36%  Similarity=0.897  Sum_probs=9.9

Q ss_pred             HHHHHHHHHhhhhh
Q psy12992        162 LLLILLFFFIGLEQ  175 (319)
Q Consensus       162 lllillfffigleq  175 (319)
                      +|.++++||+|.+|
T Consensus        27 ~lgl~~ly~vG~~q   40 (60)
T TIGR02459        27 LLGLFLVYFVGFSH   40 (60)
T ss_pred             HHHHHHHHHHhhcc
Confidence            44455667899988


No 106
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=31.20  E-value=95  Score=24.18  Aligned_cols=36  Identities=28%  Similarity=0.637  Sum_probs=23.2

Q ss_pred             eEEEEeecceEEeehHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12992        128 IRVVIKSHSWVIRVNFLVFIFLMRRVFFLFIVIFLLLILL  167 (319)
Q Consensus       128 irvvikshswvirvnflvfiflmrrvfflfiviflllill  167 (319)
                      +-+..-+.-|-    +...||.|--+.|+|||+-+...+|
T Consensus         6 ~tIEFtskFW~----YFtLi~M~lti~~~~Iv~si~~AIL   41 (64)
T PF03579_consen    6 TTIEFTSKFWT----YFTLIFMMLTIGFFFIVTSIMAAIL   41 (64)
T ss_pred             EEeeeccccch----HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444455553    4566778888888888887766555


No 107
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=31.10  E-value=55  Score=32.83  Aligned_cols=21  Identities=43%  Similarity=0.532  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhhh
Q psy12992        155 FLFIVIFLLLILLFFFIGLEQ  175 (319)
Q Consensus       155 flfiviflllillfffigleq  175 (319)
                      +|+||+|+++-|++-..|+..
T Consensus       424 llLIv~~~~lGLl~G~~G~~~  444 (806)
T PF05478_consen  424 LLLIVLCLLLGLLCGCCGYRR  444 (806)
T ss_pred             HHHHHHHHHHHHHHhhccCCC
Confidence            344444555555555555443


No 108
>smart00831 Cation_ATPase_N Cation transporter/ATPase, N-terminus. This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases PUBMED:12480547, PUBMED:12529322.
Probab=31.04  E-value=1.2e+02  Score=20.16  Aligned_cols=14  Identities=29%  Similarity=0.425  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHHHhh
Q psy12992        159 VIFLLLILLFFFIG  172 (319)
Q Consensus       159 viflllillfffig  172 (319)
                      .|.+++.++.|++|
T Consensus        50 ~iL~~~a~is~~~~   63 (64)
T smart00831       50 YILLAAAVLSALLG   63 (64)
T ss_pred             HHHHHHHHHHHHHc
Confidence            33334444555544


No 109
>TIGR01006 polys_exp_MPA1 polysaccharide export protein, MPA1 family, Gram-positive type. This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides.
Probab=30.79  E-value=1.1e+02  Score=25.03  Aligned_cols=30  Identities=13%  Similarity=0.446  Sum_probs=16.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy12992        142 NFLVFIFLMRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       142 nflvfiflmrrvfflfiviflllillfffi  171 (319)
                      ++.-++..++|-++++++++++..++.+++
T Consensus         9 ~l~~l~~~l~r~~~~ill~~ll~~~~a~~~   38 (226)
T TIGR01006         9 DLLQLLKKLWKRKLLILIVALIFLIISFIY   38 (226)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344555556666666666666555544443


No 110
>COG0795 Predicted permeases [General function prediction only]
Probab=30.51  E-value=94  Score=27.15  Aligned_cols=30  Identities=27%  Similarity=0.539  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy12992        146 FIFLMRRVFFLFIVIFLLLILLFFFIGLEQ  175 (319)
Q Consensus       146 fiflmrrvfflfiviflllillfffigleq  175 (319)
                      .-++.|+++..|+.+++.++.+++++.+-.
T Consensus         5 ~rYl~r~~l~~~l~~ll~l~~i~~~~~~~~   34 (364)
T COG0795           5 DRYLLREYLKTFLAILLVLLAILLIIDLLE   34 (364)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            446778888888888888777766665544


No 111
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=30.33  E-value=68  Score=24.62  Aligned_cols=12  Identities=25%  Similarity=0.349  Sum_probs=6.6

Q ss_pred             ccCCcccccccc
Q psy12992         97 QCNSPKQKWMWH  108 (319)
Q Consensus        97 qcnspkqkwmwh  108 (319)
                      -|+.++..=..|
T Consensus        53 ~C~~~kp~Rs~H   64 (174)
T PF01529_consen   53 TCKIIKPPRSHH   64 (174)
T ss_pred             ccCCcCCCccee
Confidence            366666554444


No 112
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB. This family consists of the NikB family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikC. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases.
Probab=30.29  E-value=74  Score=27.74  Aligned_cols=26  Identities=31%  Similarity=0.699  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigl  173 (319)
                      |+.||++..++++|++.++.|+.+-+
T Consensus         4 ~~~~r~~~~~~~l~~~~~~~F~l~~~   29 (314)
T TIGR02789         4 YILRRLLLLIPVVLAASLLAFILIHL   29 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            67899988888888777777777654


No 113
>TIGR02876 spore_yqfD sporulation protein YqfD. YqfD is part of the sigma-E regulon in the sporulation program of endospore-forming Gram-positive bacteria. Mutation results in a sporulation defect in Bacillus subtilis. Members are found in all currently known endospore-forming bacteria, including the genera Bacillus, Symbiobacterium, Carboxydothermus, Clostridium, and Thermoanaerobacter.
Probab=29.77  E-value=75  Score=29.52  Aligned_cols=24  Identities=25%  Similarity=0.406  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy12992        143 FLVFIFLMRRVFFLFIVIFLLLIL  166 (319)
Q Consensus       143 flvfiflmrrvfflfiviflllil  166 (319)
                      |+..-+.-|..|++-+++|+++|+
T Consensus        76 F~~~r~~kRk~~~~G~~~f~~ll~   99 (382)
T TIGR02876        76 FLFKRLRKRPGILIGILLFLAIVY   99 (382)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444444445556655666655444


No 114
>PF06898 YqfD:  Putative stage IV sporulation protein YqfD;  InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins. YqfD of Bacillus subtilis (P54469 from SWISSPROT) is known to be essential for efficient sporulation although its exact function is unknown [].
Probab=29.50  E-value=82  Score=29.01  Aligned_cols=16  Identities=44%  Similarity=0.519  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy12992        149 LMRRVFFLFIVIFLLL  164 (319)
Q Consensus       149 lmrrvfflfiviflll  164 (319)
                      .-|+.|++-+++|+++
T Consensus        85 ~~R~~~~~G~~~f~~~  100 (385)
T PF06898_consen   85 RRRKGFVAGIVLFLAL  100 (385)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3344444444444433


No 115
>PRK10914 dipeptide transporter permease DppB; Provisional
Probab=29.46  E-value=75  Score=28.58  Aligned_cols=27  Identities=22%  Similarity=0.491  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        147 IFLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       147 iflmrrvfflfiviflllillfffigl  173 (319)
                      -|+.||++..++++|++.++.|+.+-+
T Consensus         3 ~~i~~Rl~~~~~~l~~v~~~~F~l~~~   29 (339)
T PRK10914          3 QFILRRLGLVIPTFIGITLLTFAFVHM   29 (339)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            367899988888888877777777654


No 116
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]
Probab=29.22  E-value=1.2e+02  Score=29.92  Aligned_cols=15  Identities=20%  Similarity=0.512  Sum_probs=8.0

Q ss_pred             EEEeecceEEeehHH
Q psy12992        130 VVIKSHSWVIRVNFL  144 (319)
Q Consensus       130 vvikshswvirvnfl  144 (319)
                      |+|---+..|.++..
T Consensus        28 VlI~~~~~~ie~Sl~   42 (400)
T COG3071          28 VLIQTDNYNIEMSLT   42 (400)
T ss_pred             eEEEecceeeeeeHH
Confidence            455555556665543


No 117
>PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional
Probab=28.65  E-value=58  Score=30.05  Aligned_cols=30  Identities=23%  Similarity=0.388  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        149 LMRRVFFLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       149 lmrrvfflfiviflllillfffigleqrrk  178 (319)
                      +..-+|.+|+++.++.++-|++||+|+-..
T Consensus       210 v~~~i~v~f~~lGl~sL~af~~ig~~~~~~  239 (258)
T PRK13553        210 VKWALSVFFLVLGLLTLAAYIKIGYENADN  239 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhchhcccC
Confidence            334456677778888888899999986543


No 118
>PHA03030 hypothetical protein; Provisional
Probab=28.30  E-value=48  Score=28.23  Aligned_cols=8  Identities=38%  Similarity=1.040  Sum_probs=4.3

Q ss_pred             HHHHhhhh
Q psy12992        167 LFFFIGLE  174 (319)
Q Consensus       167 lfffigle  174 (319)
                      +||+|-.-
T Consensus        17 iffYI~~I   24 (122)
T PHA03030         17 IFFYIRII   24 (122)
T ss_pred             HHHHheee
Confidence            45666543


No 119
>PHA02689 ORF051 putative membrane protein; Provisional
Probab=28.25  E-value=69  Score=27.49  Aligned_cols=21  Identities=24%  Similarity=0.311  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhhh
Q psy12992        156 LFIVIFLLLILLFFFIGLEQR  176 (319)
Q Consensus       156 lfiviflllillfffigleqr  176 (319)
                      ++.=|++.++|+|+|.+-|-+
T Consensus        34 v~FEi~va~~L~~~FFk~Ei~   54 (128)
T PHA02689         34 AVLELLLALALALVFFRDELG   54 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            333445566677777776643


No 120
>PF11694 DUF3290:  Protein of unknown function (DUF3290);  InterPro: IPR021707  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=28.12  E-value=73  Score=26.71  Aligned_cols=9  Identities=67%  Similarity=0.980  Sum_probs=3.4

Q ss_pred             HHHHHHHHH
Q psy12992        160 IFLLLILLF  168 (319)
Q Consensus       160 iflllillf  168 (319)
                      |++|+++++
T Consensus        52 I~~L~ll~l   60 (149)
T PF11694_consen   52 IALLLLLLL   60 (149)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 121
>KOG2431|consensus
Probab=28.12  E-value=63  Score=32.85  Aligned_cols=23  Identities=48%  Similarity=0.995  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       150 mrrvfflfiviflllillfffig  172 (319)
                      -|..|.|||..|+|+++|.+.+-
T Consensus         8 ~r~w~ilf~~~~~~~v~l~~~~~   30 (546)
T KOG2431|consen    8 RRKWFILFILAFLLFVLLLLYIN   30 (546)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcC
Confidence            46678889999998888888875


No 122
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=28.11  E-value=74  Score=31.75  Aligned_cols=13  Identities=23%  Similarity=0.667  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHHH
Q psy12992        148 FLMRRVFFLFIVI  160 (319)
Q Consensus       148 flmrrvfflfivi  160 (319)
                      |.||-+||+.-+|
T Consensus        23 YYlryfFlF~SLI   35 (442)
T PF06637_consen   23 YYLRYFFLFVSLI   35 (442)
T ss_pred             HHHHHHHHHHHHH
Confidence            4555544443344


No 123
>MTH00186 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=28.08  E-value=79  Score=21.58  Aligned_cols=14  Identities=7%  Similarity=0.425  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHHHHH
Q psy12992        157 FIVIFLLLILLFFF  170 (319)
Q Consensus       157 fiviflllillfff  170 (319)
                      |++++++++..++|
T Consensus        16 ~~~~~~~~~~~~~~   29 (52)
T MTH00186         16 IWLLIFLAMSMTWW   29 (52)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33333333333333


No 124
>PF10694 DUF2500:  Protein of unknown function (DUF2500);  InterPro: IPR019635  This entry represents a group of proteins that is largely confined to the Gammaproteobacteria. The function is not known. ; PDB: 3RD4_D 2L0C_A 3Q6C_N.
Probab=28.03  E-value=20  Score=27.70  Aligned_cols=10  Identities=40%  Similarity=0.524  Sum_probs=0.0

Q ss_pred             hhhhhcccCC
Q psy12992        172 GLEQRRKNDN  181 (319)
Q Consensus       172 gleqrrkndn  181 (319)
                      +.-+-.+|++
T Consensus        22 ~~~~~~~n~~   31 (110)
T PF10694_consen   22 QIRQWAKNNN   31 (110)
T ss_dssp             ----------
T ss_pred             HHHHHHhcCC
Confidence            3444445544


No 125
>PRK15110 antimicrobial peptide ABC transporter permease SapB; Provisional
Probab=27.68  E-value=86  Score=27.86  Aligned_cols=26  Identities=31%  Similarity=0.653  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigl  173 (319)
                      |+.||++..++++|++.++.|+.+-+
T Consensus         4 ~~~~rl~~~~~~l~~v~~~~f~l~~~   29 (321)
T PRK15110          4 FTLRRLLLLIVTLFLLTLVGFSLSYF   29 (321)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            67899988888888877777776654


No 126
>PF05656 DUF805:  Protein of unknown function (DUF805);  InterPro: IPR008523 This entry is represented by Lactobacillus phage LBR48, DUF805. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.; GO: 0016021 integral to membrane
Probab=27.49  E-value=1.6e+02  Score=21.76  Aligned_cols=11  Identities=36%  Similarity=0.489  Sum_probs=8.1

Q ss_pred             hhhhhhcccCC
Q psy12992        171 IGLEQRRKNDN  181 (319)
Q Consensus       171 igleqrrkndn  181 (319)
                      +.+.-||=+|-
T Consensus        63 lal~vRRlhD~   73 (120)
T PF05656_consen   63 LALTVRRLHDI   73 (120)
T ss_pred             HHHHhhhhhcC
Confidence            66778887774


No 127
>MTH00147 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=27.18  E-value=84  Score=22.18  Aligned_cols=17  Identities=12%  Similarity=0.493  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy12992        155 FLFIVIFLLLILLFFFI  171 (319)
Q Consensus       155 flfiviflllillfffi  171 (319)
                      ++|+++++++..+.+|.
T Consensus        14 ~~~~~~~~~~~~~~~~~   30 (51)
T MTH00147         14 ILFWSAVIIVSVIIWWS   30 (51)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            34455555555555554


No 128
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=27.04  E-value=3.9  Score=32.21  Aligned_cols=13  Identities=46%  Similarity=0.930  Sum_probs=3.3

Q ss_pred             HHHHHHHHHHHHH
Q psy12992        151 RRVFFLFIVIFLL  163 (319)
Q Consensus       151 rrvfflfivifll  163 (319)
                      ||+|.|||-|||+
T Consensus        65 rrwlwLlikl~lV   77 (81)
T PF14812_consen   65 RRWLWLLIKLFLV   77 (81)
T ss_dssp             ------TTTTHCC
T ss_pred             chhHHHHHHHHHH
Confidence            3455555544443


No 129
>COG4089 Predicted membrane protein [Function unknown]
Probab=26.84  E-value=76  Score=29.52  Aligned_cols=7  Identities=29%  Similarity=0.520  Sum_probs=2.7

Q ss_pred             HHHHHHH
Q psy12992        153 VFFLFIV  159 (319)
Q Consensus       153 vfflfiv  159 (319)
                      .|+||..
T Consensus        16 ~f~l~l~   22 (235)
T COG4089          16 PFRLLLA   22 (235)
T ss_pred             HHHHHHH
Confidence            3334333


No 130
>PF03739 YjgP_YjgQ:  Predicted permease YjgP/YjgQ family;  InterPro: IPR005495 Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long, contain about 6 transmembrane regions and may be permeases, although there is no verification of this.; GO: 0016021 integral to membrane
Probab=26.65  E-value=86  Score=26.55  Aligned_cols=22  Identities=18%  Similarity=0.543  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Q psy12992        150 MRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       150 mrrvfflfiviflllillfffi  171 (319)
                      .+.++..|++++++++++++++
T Consensus         4 ~~~~l~~f~~~l~~~~~i~~~~   25 (354)
T PF03739_consen    4 LKEFLKTFLLVLLSFTGIFLII   25 (354)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444444444444444443


No 131
>PRK15133 microcin C ABC transporter permease YejB; Provisional
Probab=26.58  E-value=90  Score=28.88  Aligned_cols=26  Identities=19%  Similarity=0.729  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigl  173 (319)
                      |+.||++..++++|++..+.|+.+-+
T Consensus         4 ~i~~Rl~~~i~~l~~v~~i~F~l~~~   29 (364)
T PRK15133          4 YLIRRLLLVIPTLWAIITINFFIVQI   29 (364)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57799888888888877777776644


No 132
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=26.46  E-value=76  Score=25.48  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=5.7

Q ss_pred             HHHHHHHHHHH
Q psy12992        143 FLVFIFLMRRV  153 (319)
Q Consensus       143 flvfiflmrrv  153 (319)
                      +.+|-|++-+-
T Consensus        10 Li~~~fi~~k~   20 (83)
T PF05814_consen   10 LIVLGFIFDKN   20 (83)
T ss_pred             HHHHHHHHccc
Confidence            34555666554


No 133
>PF10694 DUF2500:  Protein of unknown function (DUF2500);  InterPro: IPR019635  This entry represents a group of proteins that is largely confined to the Gammaproteobacteria. The function is not known. ; PDB: 3RD4_D 2L0C_A 3Q6C_N.
Probab=26.45  E-value=22  Score=27.45  Aligned_cols=24  Identities=29%  Similarity=0.694  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhccc
Q psy12992        156 LFIVIFLLLILLFFFIGLEQRRKN  179 (319)
Q Consensus       156 lfiviflllillfffigleqrrkn  179 (319)
                      +|+++|+++|.+++|.-..+++..
T Consensus         3 ~f~i~~~iii~~~~~~~~~~~~~~   26 (110)
T PF10694_consen    3 FFIIVFIIIIGIIIFVFIRQIRQW   26 (110)
T ss_dssp             ------------------------
T ss_pred             EeHHhhhhhhHHHHHHHHHHHHHH
Confidence            445555555656666666555443


No 134
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein. Members of this protein family are homologs of the HlyD membrane fusion protein of type I secretion systems. Their occurrence in prokaryotic genomes is associated with the occurrence of a novel class of microcin (small bacteriocins) with a propeptide region related to nitrile hydratase. We designate the class of bacteriocin as Nitrile Hydratase Propeptide Microcin, or NHPM. This family, therefore, is designated as NHPM bacteriocin system secretion protein. Some but not all NHPM-class putative microcins belong to the TOMM (thiazole/oxazole modified microcin) class as assessed by the presence of the scaffolding protein and/or cyclodehydratase in the same gene clusters.
Probab=26.44  E-value=78  Score=28.50  Aligned_cols=12  Identities=17%  Similarity=0.346  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHhh
Q psy12992        161 FLLLILLFFFIG  172 (319)
Q Consensus       161 flllillfffig  172 (319)
                      |++++++|++++
T Consensus        29 ~~~~~l~~~~~~   40 (421)
T TIGR03794        29 IVVAALAWGIFG   40 (421)
T ss_pred             HHHHHHHHHhhc
Confidence            344444444444


No 135
>TIGR03017 EpsF chain length determinant protein EpsF. Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Probab=26.24  E-value=1.2e+02  Score=26.99  Aligned_cols=10  Identities=30%  Similarity=0.288  Sum_probs=4.0

Q ss_pred             HHHHHHHHHH
Q psy12992        147 IFLMRRVFFL  156 (319)
Q Consensus       147 iflmrrvffl  156 (319)
                      |+.-|+.+++
T Consensus         9 il~rr~~lil   18 (444)
T TIGR03017         9 ILKARYWIVL   18 (444)
T ss_pred             HHHHHHHHHH
Confidence            3444443333


No 136
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.81  E-value=65  Score=25.78  Aligned_cols=26  Identities=42%  Similarity=0.556  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhccc
Q psy12992        153 VFFLFIVIFLLLILLFFFIGLEQRRKN  179 (319)
Q Consensus       153 vfflfiviflllillfffigleqrrkn  179 (319)
                      +|+|-++||||+|++ .-||.--.||.
T Consensus         3 t~lltFg~Fllvi~g-MsiG~I~krk~   28 (77)
T COG2991           3 TFLLTFGIFLLVIAG-MSIGYIFKRKS   28 (77)
T ss_pred             cHHHHHHHHHHHHHH-HhHhhheeccc
Confidence            355556667666654 34565544443


No 137
>PF03381 CDC50:  LEM3 (ligand-effect modulator 3) family / CDC50 family;  InterPro: IPR005045 Members of this family have no known function. They have predicted transmembrane helices.; GO: 0016020 membrane
Probab=25.68  E-value=1.4e+02  Score=26.53  Aligned_cols=21  Identities=33%  Similarity=0.643  Sum_probs=11.5

Q ss_pred             EEEEeecceEEeeh-HHHHHHH
Q psy12992        129 RVVIKSHSWVIRVN-FLVFIFL  149 (319)
Q Consensus       129 rvvikshswvirvn-flvfifl  149 (319)
                      .+||-..+|.=--| ||..+||
T Consensus       229 ~ivlst~s~~Ggkn~~Lgi~yl  250 (278)
T PF03381_consen  229 SIVLSTTSWFGGKNYFLGIAYL  250 (278)
T ss_pred             EEEEEeccccCccccHHHHHHH
Confidence            35667777774444 4444433


No 138
>COG2268 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.39  E-value=76  Score=32.07  Aligned_cols=16  Identities=38%  Similarity=0.972  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy12992        157 FIVIFLLLILLFFFIG  172 (319)
Q Consensus       157 fiviflllillfffig  172 (319)
                      .+|+++++||+++|+|
T Consensus        16 ivvv~i~~ilv~if~~   31 (548)
T COG2268          16 IVVVVILVILVLIFFG   31 (548)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3444555555555554


No 139
>PF01062 Bestrophin:  Bestrophin, RFP-TM, chloride channel;  InterPro: IPR021134 Bestrophin is a 68kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterised by a depressed light peak in the electrooculogram []. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localised to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak []. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties []. This entry also includes a number of hypothetical proteins belonging to protein family UPF0187.
Probab=25.28  E-value=1.5e+02  Score=24.85  Aligned_cols=17  Identities=35%  Similarity=0.770  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHhhhhh
Q psy12992        159 VIFLLLILLFFFIGLEQ  175 (319)
Q Consensus       159 viflllillfffigleq  175 (319)
                      ++.+..+..|+|+|+|.
T Consensus       246 ~~~~~~l~~~~~~gl~~  262 (293)
T PF01062_consen  246 TPPITFLVSFFFLGLEE  262 (293)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34455566778888875


No 140
>PF06682 DUF1183:  Protein of unknown function (DUF1183);  InterPro: IPR009567 This family consists of several eukaryotic proteins of around 360 residues in length. The function of this family is unknown.
Probab=25.04  E-value=56  Score=30.70  Aligned_cols=11  Identities=36%  Similarity=0.425  Sum_probs=5.8

Q ss_pred             cccccCCcccc
Q psy12992         44 QSRRSDNKSQM   54 (319)
Q Consensus        44 qsrrsdnksqm   54 (319)
                      .+||+..-.|+
T Consensus        39 t~RR~~pipQL   49 (318)
T PF06682_consen   39 TSRRVSPIPQL   49 (318)
T ss_pred             ccccCCCCcce
Confidence            35565555553


No 141
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=24.79  E-value=1.5e+02  Score=24.40  Aligned_cols=46  Identities=33%  Similarity=0.624  Sum_probs=21.6

Q ss_pred             EeecceEEeehHHHHHHHHHHHHHHHHHHHHHHHHHHH-HhhhhhhcccCCcccc
Q psy12992        132 IKSHSWVIRVNFLVFIFLMRRVFFLFIVIFLLLILLFF-FIGLEQRRKNDNKSQM  185 (319)
Q Consensus       132 ikshswvirvnflvfiflmrrvfflfiviflllillff-figleqrrkndnksqm  185 (319)
                      +|.|..-|-+-|.|-        ....|+||.+||++. .-|-.|-|.+....++
T Consensus        31 Lka~kysIVI~FWv~--------LA~FV~~lF~iL~~ms~sgspq~~~~~k~~~~   77 (90)
T PF15183_consen   31 LKANKYSIVIAFWVS--------LAAFVVFLFLILLYMSWSGSPQMRNSEKHHPM   77 (90)
T ss_pred             hcccceeeehhHHHH--------HHHHHHHHHHHHHHHhccCCCCcCCccccCCC
Confidence            466666665444432        223345555555544 3344444444443333


No 142
>PF11872 DUF3392:  Protein of unknown function (DUF3392);  InterPro: IPR021813  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length. 
Probab=24.65  E-value=83  Score=25.76  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHhhhhhhc
Q psy12992        161 FLLLILLFFFIGLEQRR  177 (319)
Q Consensus       161 flllillfffigleqrr  177 (319)
                      ++.+++.|++||.-..|
T Consensus        89 ~~~vl~~F~~iG~lAqR  105 (106)
T PF11872_consen   89 APVVLLSFILIGVLAQR  105 (106)
T ss_pred             HHHHHHHHHHHHHHhcc
Confidence            44567788889875444


No 143
>KOG4753|consensus
Probab=24.58  E-value=76  Score=27.16  Aligned_cols=22  Identities=23%  Similarity=0.318  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Q psy12992        151 RRVFFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       151 rrvfflfiviflllillfffig  172 (319)
                      ++|+.+++..+|+++-+|.++|
T Consensus        53 lavvL~~fg~Lli~lg~fl~~~   74 (124)
T KOG4753|consen   53 LAVVLLVFGLLLIGLGFFLAGG   74 (124)
T ss_pred             HHHHHHHHHHHHHHHHHHheec
Confidence            4555555555544444444443


No 144
>PF06143 Baculo_11_kDa:  Baculovirus 11 kDa family;  InterPro: IPR009313 This is a family of uncharacterised Baculovirus proteins that are all about 11 kDa in size.
Probab=24.50  E-value=1.3e+02  Score=24.04  Aligned_cols=7  Identities=57%  Similarity=0.951  Sum_probs=2.8

Q ss_pred             HHHHHHh
Q psy12992        165 ILLFFFI  171 (319)
Q Consensus       165 illfffi  171 (319)
                      |+|.++|
T Consensus        53 i~ll~~i   59 (84)
T PF06143_consen   53 ILLLYNI   59 (84)
T ss_pred             HHHHHHH
Confidence            3333444


No 145
>COG3166 PilN Tfp pilus assembly protein PilN [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=24.15  E-value=72  Score=28.15  Aligned_cols=52  Identities=25%  Similarity=0.190  Sum_probs=33.8

Q ss_pred             EEeehHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHhhhhhhcccCCcccccccc
Q psy12992        138 VIRVNFLVFIFLM-----RRVFFLFIVIFLLLILLFFFIGLEQRRKNDNKSQMGSGL  189 (319)
Q Consensus       138 virvnflvfiflm-----rrvfflfiviflllillfffigleqrrkndnksqmgsgl  189 (319)
                      +.+||+|.+.--+     ++++.+.-+.-++.|+++|.+|+-+.+.-++-.+-+--|
T Consensus         4 l~~vNlLpwr~~r~~~~~~~f~~~~~~~~l~~~~~~~~~~~~~~~~~~~q~~~~~~L   60 (206)
T COG3166           4 LPGVNLLPWRVERRKQARLQFWLLLGGAVLLGIAALALGGLLQDRQIAEQQQRNALL   60 (206)
T ss_pred             cccCCcchhHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhHHhhhhhhhhhHhHHHHH
Confidence            4678988887666     233444455667788888888888776555544444334


No 146
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=24.13  E-value=81  Score=26.90  Aligned_cols=14  Identities=43%  Similarity=0.712  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHHH
Q psy12992        155 FLFIVIFLLLILLF  168 (319)
Q Consensus       155 flfiviflllillf  168 (319)
                      |.++|.|++|.+++
T Consensus        14 fw~iI~FlILy~ll   27 (155)
T PRK06569         14 FWLIVTFGLLYIFV   27 (155)
T ss_pred             HHHHHHHHHHHHHH
Confidence            33444554444443


No 147
>PRK15081 glutathione ABC transporter permease GsiC; Provisional
Probab=24.09  E-value=1.1e+02  Score=27.25  Aligned_cols=26  Identities=23%  Similarity=0.725  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        148 FLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       148 flmrrvfflfiviflllillfffigl  173 (319)
                      |+.||++..++++|++..+.||.+-+
T Consensus         4 ~i~~r~~~~~~~l~~~~~i~F~l~~~   29 (306)
T PRK15081          4 YVIKRLLGLIPTLLIVAVLVFLFVHL   29 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57789888888888777777777654


No 148
>PF12158 DUF3592:  Protein of unknown function (DUF3592);  InterPro: IPR021994  This family of proteins is functionally uncharacterised.This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 150 and 242 amino acids in length. 
Probab=23.96  E-value=86  Score=23.13  Aligned_cols=20  Identities=40%  Similarity=0.776  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhh
Q psy12992        154 FFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       154 fflfiviflllillfffigl  173 (319)
                      .++|.+||+++.+.|++.+.
T Consensus         4 ~~~~~~i~l~~g~~~~~~~~   23 (148)
T PF12158_consen    4 LLLFGIIFLLIGLVLLIGGI   23 (148)
T ss_pred             hHHHHHHHHHHHHHHHHHHH


No 149
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=23.95  E-value=1.1e+02  Score=27.48  Aligned_cols=22  Identities=36%  Similarity=0.594  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHhhhhhhccc
Q psy12992        158 IVIFLLLILLFFFIGLEQRRKN  179 (319)
Q Consensus       158 iviflllillfffigleqrrkn  179 (319)
                      |.|.+|+|.+...|-|-.+||.
T Consensus        36 iaIvVliiiiivli~lcssRKk   57 (189)
T PF05568_consen   36 IAIVVLIIIIIVLIYLCSSRKK   57 (189)
T ss_pred             HHHHHHHHHHHHHHHHHhhhhH
Confidence            3333444444444555566664


No 150
>PF12127 YdfA_immunity:  SigmaW regulon antibacterial;  InterPro: IPR022853 This entry represents the uncharacterised protein family UPF0365. Its function is not known.  The proteins in this family are found in bacteria. They are about 330 amino acids in length and encoded by a gene located in an operon which confers immunity for the host species to a broad range of antibacterial compounds, unlike the specific immunity proteins that are linked to and co-regulated with their antibiotic-synthesis proteins. 
Probab=23.93  E-value=75  Score=30.59  Aligned_cols=10  Identities=30%  Similarity=0.670  Sum_probs=4.5

Q ss_pred             Hhhhhhhccc
Q psy12992        170 FIGLEQRRKN  179 (319)
Q Consensus       170 figleqrrkn  179 (319)
                      +||..-||-+
T Consensus        40 Lv~MrlR~v~   49 (316)
T PF12127_consen   40 LVGMRLRRVP   49 (316)
T ss_pred             hhhhhccCCC
Confidence            4444444443


No 151
>PHA02973 hypothetical protein; Provisional
Probab=23.62  E-value=78  Score=26.31  Aligned_cols=10  Identities=40%  Similarity=0.577  Sum_probs=6.2

Q ss_pred             ccCCcccccc
Q psy12992        178 KNDNKSQMGS  187 (319)
Q Consensus       178 kndnksqmgs  187 (319)
                      +..||-||+-
T Consensus        21 ~pTNKmq~aV   30 (102)
T PHA02973         21 KRTNKMDIGI   30 (102)
T ss_pred             cccchhhhhh
Confidence            4567777763


No 152
>PF05170 AsmA:  AsmA family;  InterPro: IPR007844 The AsmA protein is involved in the assembly of outer membrane proteins in Escherichia coli []. AsmA mutations were isolated as extragenic suppressors of an OmpF assembly mutant []. AsmA may have a role in LPS biogenesis [].
Probab=23.51  E-value=67  Score=29.76  Aligned_cols=16  Identities=31%  Similarity=0.708  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHHHHHHh
Q psy12992        156 LFIVIFLLLILLFFFI  171 (319)
Q Consensus       156 lfiviflllillfffi  171 (319)
                      +|+++.++++++++|+
T Consensus        11 ~l~~lvll~~~~~~~~   26 (604)
T PF05170_consen   11 ILAVLVLLVVALPFLL   26 (604)
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            3333333334444444


No 153
>PRK09835 sensor kinase CusS; Provisional
Probab=23.44  E-value=1.6e+02  Score=25.06  Aligned_cols=39  Identities=10%  Similarity=0.356  Sum_probs=0.0

Q ss_pred             cceEEeehHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        135 HSWVIRVNFLV-----FIFLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       135 hswvirvnflv-----fiflmrrvfflfiviflllillfffigl  173 (319)
                      ..|++.+-..+     ++..+...++++++++++++++++++..
T Consensus       163 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  206 (482)
T PRK09835        163 PIYTLLIALSIDFHLHYINDLKNKLIMTASVISLLIVFIVLLAV  206 (482)
T ss_pred             CcEEEEEEeccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH


No 154
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=23.24  E-value=97  Score=28.68  Aligned_cols=11  Identities=27%  Similarity=0.105  Sum_probs=6.2

Q ss_pred             eEEEEeecceE
Q psy12992        128 IRVVIKSHSWV  138 (319)
Q Consensus       128 irvvikshswv  138 (319)
                      +.--+|+|+=+
T Consensus       105 ~ent~k~~~~~  115 (227)
T PF05399_consen  105 TENTSKSQSEI  115 (227)
T ss_pred             cCcCCCCcccc
Confidence            44456777443


No 155
>KOG3927|consensus
Probab=23.09  E-value=1.3e+02  Score=28.26  Aligned_cols=28  Identities=18%  Similarity=0.396  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy12992        147 IFLMRRVFFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       147 iflmrrvfflfiviflllillfffigle  174 (319)
                      |+|.--||+.|+++|..+.+-|||--|.
T Consensus        47 IllfYivFY~~la~lf~~~~~~~~~tid   74 (300)
T KOG3927|consen   47 ILLFYIVFYGVLAALFAGCMWFMLQTID   74 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            5555567777777777776666665554


No 156
>PHA02650 hypothetical protein; Provisional
Probab=23.01  E-value=86  Score=25.24  Aligned_cols=6  Identities=33%  Similarity=0.661  Sum_probs=2.2

Q ss_pred             HHHHhh
Q psy12992        167 LFFFIG  172 (319)
Q Consensus       167 lfffig  172 (319)
                      +|++.-
T Consensus        66 ~flYLK   71 (81)
T PHA02650         66 SFFVFK   71 (81)
T ss_pred             HHHHHH
Confidence            333333


No 157
>TIGR01386 cztS_silS_copS heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (Pfam:PF00512) and a domain found in bacterial signal proteins (Pfam:PF00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.
Probab=22.98  E-value=1.1e+02  Score=25.67  Aligned_cols=11  Identities=27%  Similarity=0.492  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHH
Q psy12992        152 RVFFLFIVIFL  162 (319)
Q Consensus       152 rvfflfivifl  162 (319)
                      |++++|+++++
T Consensus         7 kL~l~~~~l~~   17 (457)
T TIGR01386         7 RLALLFAAVTA   17 (457)
T ss_pred             hHHHHHHHHHH
Confidence            44444443333


No 158
>KOG4463|consensus
Probab=22.94  E-value=77  Score=30.53  Aligned_cols=27  Identities=33%  Similarity=0.376  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12992        143 FLVFIFLMRRVFFLFIVIFLLLILLFF  169 (319)
Q Consensus       143 flvfiflmrrvfflfiviflllillff  169 (319)
                      |++||.+|--+-.|.++||++|.-+||
T Consensus        89 y~~fiv~s~~~~~l~~~il~~l~~~~~  115 (323)
T KOG4463|consen   89 YSVFIVFSGTVSLLLEVILLSLLKDTT  115 (323)
T ss_pred             ceeehhHHHHHHHHHHHHHHHHHHHHH
Confidence            567888888888888888887765543


No 159
>KOG3208|consensus
Probab=22.70  E-value=88  Score=28.96  Aligned_cols=19  Identities=32%  Similarity=0.520  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy12992        153 VFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       153 vfflfiviflllillfffi  171 (319)
                      -+.|-.||-+++||||||+
T Consensus       211 slILa~Vis~C~llllfy~  229 (231)
T KOG3208|consen  211 SLILAAVISVCTLLLLFYW  229 (231)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            5778888888888877775


No 160
>PF15168 TRIQK:  Triple QxxK/R motif-containing protein family
Probab=22.58  E-value=1.1e+02  Score=24.70  Aligned_cols=18  Identities=33%  Similarity=0.746  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHHhhh
Q psy12992        156 LFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       156 lfiviflllillfffigl  173 (319)
                      .+|+.+|+.+..|||.-|
T Consensus        56 ~ail~lL~a~Ya~fyl~l   73 (79)
T PF15168_consen   56 AAILVLLLAFYAFFYLNL   73 (79)
T ss_pred             HHHHHHHHHHHHHHHHhh
Confidence            445555555566666544


No 161
>PF14276 DUF4363:  Domain of unknown function (DUF4363)
Probab=22.55  E-value=94  Score=23.58  Aligned_cols=12  Identities=42%  Similarity=0.786  Sum_probs=4.5

Q ss_pred             HHHHHHHHHHHH
Q psy12992        155 FLFIVIFLLLIL  166 (319)
Q Consensus       155 flfiviflllil  166 (319)
                      ++|++++++.+.
T Consensus         5 ~i~~lii~~~~~   16 (121)
T PF14276_consen    5 IIFILIIALSIF   16 (121)
T ss_pred             HHHHHHHHHHHH
Confidence            333333333333


No 162
>PF04530 Viral_Beta_CD:  Viral Beta C/D like family;  InterPro: IPR007617 This is a family of ssRNA positive-strand viral proteins. Conserved region is found in the Beta C and Beta D transcripts.
Probab=22.49  E-value=92  Score=26.42  Aligned_cols=27  Identities=22%  Similarity=0.443  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy12992        146 FIFLMRRVFFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       146 fiflmrrvfflfiviflllillfffig  172 (319)
                      -+|.+--++|+..|.+|+++++||+..
T Consensus        45 sv~~~~y~l~~~~v~~L~~~~~y~~~~   71 (122)
T PF04530_consen   45 SVLNDNYVLFVCAVCMLFSILVYLYSS   71 (122)
T ss_pred             hhhhhhHHHHHHHHHHHHHHHHHheec
Confidence            345666666666666666778888763


No 163
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=22.36  E-value=1.5e+02  Score=22.23  Aligned_cols=19  Identities=26%  Similarity=0.691  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy12992        149 LMRRVFFLFIVIFLLLILL  167 (319)
Q Consensus       149 lmrrvfflfiviflllill  167 (319)
                      .+--+|+++|+++++.+++
T Consensus         9 f~sQ~~Wl~i~f~~ly~l~   27 (67)
T MTH00169          9 YLTQYIWTLIILFFLFSLL   27 (67)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3455666666555555544


No 164
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=22.30  E-value=1.3e+02  Score=27.33  Aligned_cols=27  Identities=22%  Similarity=0.621  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12992        147 IFLMRRVFFLFIVIFLLLILLFFFIGL  173 (319)
Q Consensus       147 iflmrrvfflfiviflllillfffigl  173 (319)
                      .|+++|++..++++|++.++.|+..-+
T Consensus         3 ~~i~~R~~~~i~~l~~v~~i~F~l~~~   29 (317)
T COG0601           3 KYIIKRLLQAIPTLFIVSTLTFFLLRL   29 (317)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            455899999998888777777766543


No 165
>PF09726 Macoilin:  Transmembrane protein;  InterPro: IPR019130  This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes. ; GO: 0016021 integral to membrane
Probab=22.25  E-value=1.1e+02  Score=31.22  Aligned_cols=10  Identities=30%  Similarity=0.690  Sum_probs=3.9

Q ss_pred             HHHHhhhhhh
Q psy12992        167 LFFFIGLEQR  176 (319)
Q Consensus       167 lfffigleqr  176 (319)
                      ||+++-...|
T Consensus       129 ~~~~~e~~~~  138 (697)
T PF09726_consen  129 LFVYVEASVR  138 (697)
T ss_pred             HHHHHHHHHh
Confidence            3444433334


No 166
>PF14316 DUF4381:  Domain of unknown function (DUF4381)
Probab=22.23  E-value=92  Score=24.71  Aligned_cols=13  Identities=23%  Similarity=0.401  Sum_probs=5.3

Q ss_pred             HHHHhhhhhhccc
Q psy12992        167 LFFFIGLEQRRKN  179 (319)
Q Consensus       167 lfffigleqrrkn  179 (319)
                      ++++.....+++|
T Consensus        36 ~~~~~~~r~~~~~   48 (146)
T PF14316_consen   36 LLLWRLWRRWRRN   48 (146)
T ss_pred             HHHHHHHHHHHcc
Confidence            3333334444444


No 167
>PHA02967 hypothetical protein; Provisional
Probab=22.19  E-value=88  Score=26.84  Aligned_cols=34  Identities=24%  Similarity=0.505  Sum_probs=16.6

Q ss_pred             ecceEEeehHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy12992        134 SHSWVIRVNFLVFIFLMRRVFFLFIVIFLLLILLFFFIGLEQ  175 (319)
Q Consensus       134 shswvirvnflvfiflmrrvfflfiviflllillfffigleq  175 (319)
                      .||...+.+=..+|.        +.=|++.++|+++|.+-|-
T Consensus        17 kHsllL~~~kY~~Iv--------~FEi~val~L~~~FFk~Ei   50 (128)
T PHA02967         17 KHEFLLSPNKYFYIL--------VFEVIVALIIINFFFKEEI   50 (128)
T ss_pred             ceeEEcccccchhHH--------HHHHHHHHHHHHHHHHHHH
Confidence            477755554333332        2223344555666666553


No 168
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=22.19  E-value=96  Score=29.52  Aligned_cols=20  Identities=35%  Similarity=0.599  Sum_probs=14.4

Q ss_pred             HHHHHHHhhhhhhcccCCcc
Q psy12992        164 LILLFFFIGLEQRRKNDNKS  183 (319)
Q Consensus       164 lillfffigleqrrkndnks  183 (319)
                      ++|++++|-|-.||||.-|.
T Consensus       273 vvliiLYiWlyrrRK~swkh  292 (295)
T TIGR01478       273 VVLIILYIWLYRRRKKSWKH  292 (295)
T ss_pred             HHHHHHHHHHHHhhcccccc
Confidence            34455677889999997664


No 169
>PF09972 DUF2207:  Predicted membrane protein (DUF2207);  InterPro: IPR018702 This domain has no known function.
Probab=22.14  E-value=1e+02  Score=26.77  Aligned_cols=10  Identities=30%  Similarity=0.989  Sum_probs=6.0

Q ss_pred             eccccccccC
Q psy12992         90 NLLGRAWQCN   99 (319)
Q Consensus        90 nllgrawqcn   99 (319)
                      |++|..|...
T Consensus       121 ~~~g~~~~~~  130 (511)
T PF09972_consen  121 NFIGSGWDVP  130 (511)
T ss_pred             EEecCCCCCc
Confidence            3467777653


No 170
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=22.03  E-value=84  Score=24.47  Aligned_cols=15  Identities=53%  Similarity=1.145  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHHh
Q psy12992        157 FIVIFLLLILLFFFI  171 (319)
Q Consensus       157 fiviflllillfffi  171 (319)
                      |-+||..|.+.||||
T Consensus        18 FtLi~M~lti~~~~I   32 (64)
T PF03579_consen   18 FTLIFMMLTIGFFFI   32 (64)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444555555555554


No 171
>PRK15120 lipopolysaccharide ABC transporter permease LptF; Provisional
Probab=21.99  E-value=1.3e+02  Score=26.43  Aligned_cols=26  Identities=27%  Similarity=0.576  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy12992        147 IFLMRRVFFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       147 iflmrrvfflfiviflllillfffig  172 (319)
                      -++.|.++..|+++++.++++|++.-
T Consensus         5 RYi~re~l~~~~~~l~~l~~i~~~~~   30 (366)
T PRK15120          5 RYLVRETLKSQLAILFILLLIFFCQK   30 (366)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35566666666665555555554443


No 172
>PRK15048 methyl-accepting chemotaxis protein II; Provisional
Probab=21.88  E-value=1.5e+02  Score=27.22  Aligned_cols=27  Identities=19%  Similarity=0.442  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy12992        145 VFIFLMRRVFFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       145 vfiflmrrvfflfiviflllillfffi  171 (319)
                      .+-+...-++++++++++++++++|+|
T Consensus       186 ~~~~~~~~~~i~~~~~~~~~~~~~~~i  212 (553)
T PRK15048        186 DYRFAQWQLAVIALVVVLILLVAWYGI  212 (553)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH


No 173
>COG3162 Predicted membrane protein [Function unknown]
Probab=21.79  E-value=1.4e+02  Score=24.78  Aligned_cols=23  Identities=26%  Similarity=0.492  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy12992        145 VFIFLMRRVFFLFIVIFLLLILL  167 (319)
Q Consensus       145 vfiflmrrvfflfiviflllill  167 (319)
                      .|+++|--.||++-+.|.|||-.
T Consensus        24 ~Fa~~ltl~flv~Y~~filLiaf   46 (102)
T COG3162          24 RFAVPLTLIFLVVYFGFILLIAF   46 (102)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            46777776666666666666543


No 174
>PF10808 DUF2542:  Protein of unknown function (DUF2542) ;  InterPro: IPR020155 This entry represents transmembrane proteins with no known function.; GO: 0016021 integral to membrane
Probab=21.75  E-value=57  Score=26.20  Aligned_cols=15  Identities=53%  Similarity=1.014  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHH
Q psy12992        156 LFIVIFLLLILLFFF  170 (319)
Q Consensus       156 lfiviflllillfff  170 (319)
                      +||||-.|+|.+|.|
T Consensus         6 ~Fvv~~~lmi~~f~f   20 (79)
T PF10808_consen    6 IFVVIAFLMIPLFCF   20 (79)
T ss_pred             eehHHHHHHHHHHHH
Confidence            688888888888877


No 175
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion]
Probab=21.59  E-value=1.7e+02  Score=26.19  Aligned_cols=22  Identities=27%  Similarity=0.528  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHhhhhhhcccCC
Q psy12992        160 IFLLLILLFFFIGLEQRRKNDN  181 (319)
Q Consensus       160 iflllillfffigleqrrkndn  181 (319)
                      |+++++.+++++-..-|+++.+
T Consensus        44 I~~~V~~~~~~~~~k~R~~~~~   65 (247)
T COG1622          44 IVLPVIVLLVYFAWKYRASNNA   65 (247)
T ss_pred             HHHHHHHHHHHHHhhhhhcCCC
Confidence            4444444444444444544433


No 176
>PF03176 MMPL:  MMPL family;  InterPro: IPR004869 Proteins of this entry are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport [].; GO: 0016020 membrane
Probab=21.51  E-value=1.5e+02  Score=25.26  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=5.5

Q ss_pred             HHHHHHHHHHHH
Q psy12992        145 VFIFLMRRVFFL  156 (319)
Q Consensus       145 vfiflmrrvffl  156 (319)
                      +.++.+|++...
T Consensus       159 vl~~~fRs~~~~  170 (333)
T PF03176_consen  159 VLLLVFRSVRAA  170 (333)
T ss_pred             hhhhHHHHHHHH
Confidence            334445554433


No 177
>TIGR02972 TMAO_torE trimethylamine N-oxide reductase system, TorE protein. Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA.
Probab=21.29  E-value=1.1e+02  Score=22.34  Aligned_cols=10  Identities=50%  Similarity=0.966  Sum_probs=3.6

Q ss_pred             HHHHHHHHHH
Q psy12992        157 FIVIFLLLIL  166 (319)
Q Consensus       157 fiviflllil  166 (319)
                      ||+.+|.-||
T Consensus        15 fl~v~l~PiL   24 (47)
T TIGR02972        15 FIIVVLFPIL   24 (47)
T ss_pred             HHHHHHHHHH
Confidence            3333333333


No 178
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional
Probab=21.09  E-value=1.5e+02  Score=26.31  Aligned_cols=20  Identities=30%  Similarity=0.316  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q psy12992        142 NFLVFIFLMRRVFFLFIVIF  161 (319)
Q Consensus       142 nflvfiflmrrvfflfivif  161 (319)
                      |..-|++..+-+||+|+++.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~   22 (333)
T PTZ00260          3 NIWKVIFKHRMLIVLGLVVG   22 (333)
T ss_pred             chhhhhhHHHHHHHHHHHHH
Confidence            33445555555666655443


No 179
>COG4853 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.88  E-value=69  Score=30.19  Aligned_cols=17  Identities=47%  Similarity=0.819  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy12992        155 FLFIVIFLLLILLFFFI  171 (319)
Q Consensus       155 flfiviflllillfffi  171 (319)
                      -+|||+||||=+++..|
T Consensus         8 sIFIv~fLllnifL~~i   24 (264)
T COG4853           8 SIFIVVFLLLNIFLVSI   24 (264)
T ss_pred             eeehhHHHHHHHHHHHH
Confidence            35677777664443333


No 180
>PRK15105 peptidoglycan synthase FtsI; Provisional
Probab=20.83  E-value=1.1e+02  Score=29.65  Aligned_cols=7  Identities=29%  Similarity=0.292  Sum_probs=3.0

Q ss_pred             HHHHHHH
Q psy12992        151 RRVFFLF  157 (319)
Q Consensus       151 rrvfflf  157 (319)
                      +|+.+++
T Consensus        21 ~R~~~~~   27 (578)
T PRK15105         21 WRFALLC   27 (578)
T ss_pred             HHHHHHH
Confidence            4444433


No 181
>PF06682 DUF1183:  Protein of unknown function (DUF1183);  InterPro: IPR009567 This family consists of several eukaryotic proteins of around 360 residues in length. The function of this family is unknown.
Probab=20.80  E-value=88  Score=29.41  Aligned_cols=14  Identities=21%  Similarity=0.603  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHHHHh
Q psy12992        158 IVIFLLLILLFFFI  171 (319)
Q Consensus       158 iviflllillfffi  171 (319)
                      ++++|.+|+.-+|.
T Consensus       164 ~l~vla~ivY~~~~  177 (318)
T PF06682_consen  164 FLLVLAFIVYSLFL  177 (318)
T ss_pred             HHHHHHHHHHHHHh
Confidence            33334444444444


No 182
>PHA03083 poxvirus myristoylprotein; Provisional
Probab=20.71  E-value=69  Score=30.79  Aligned_cols=20  Identities=5%  Similarity=0.255  Sum_probs=13.3

Q ss_pred             ccCCcccccccccccCCCCC
Q psy12992         97 QCNSPKQKWMWHKRDHSSSS  116 (319)
Q Consensus        97 qcnspkqkwmwhkrdhssss  116 (319)
                      .|..--+||+--.-++--+-
T Consensus       243 ECt~~n~~fLLtdny~nl~~  262 (334)
T PHA03083        243 ECANSNVNFLLTENYTNLGL  262 (334)
T ss_pred             hhcCCCccEeeehhhhhhcC
Confidence            46666788887777665443


No 183
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=20.61  E-value=1e+02  Score=27.88  Aligned_cols=19  Identities=26%  Similarity=0.597  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q psy12992        154 FFLFIVIFLLLILLFFFIG  172 (319)
Q Consensus       154 fflfiviflllillfffig  172 (319)
                      ++|||++.+-|+|..+.+.
T Consensus        19 llL~il~iiNL~LTiwIl~   37 (264)
T PF04790_consen   19 LLLFILAIINLALTIWILK   37 (264)
T ss_pred             HHHHHHHHHHHHHHhhhhe
Confidence            4455555555555444443


No 184
>PTZ00370 STEVOR; Provisional
Probab=20.51  E-value=1e+02  Score=29.38  Aligned_cols=20  Identities=40%  Similarity=0.649  Sum_probs=14.4

Q ss_pred             HHHHHHHhhhhhhcccCCcc
Q psy12992        164 LILLFFFIGLEQRRKNDNKS  183 (319)
Q Consensus       164 lillfffigleqrrkndnks  183 (319)
                      ++|++++|-|-.||||.-|.
T Consensus       269 vvliilYiwlyrrRK~swkh  288 (296)
T PTZ00370        269 VVLIILYIWLYRRRKNSWKH  288 (296)
T ss_pred             HHHHHHHHHHHHhhcchhHH
Confidence            34455677889999997664


No 185
>PF06837 Fijivirus_P9-2:  Fijivirus P9-2 protein;  InterPro: IPR009650 This family consists of several Fijivirus specific P9-2 proteins from Rice black streaked dwarf virus (RBSDV) and Fiji disease virus. The function of this family is unknown.
Probab=20.34  E-value=99  Score=28.44  Aligned_cols=17  Identities=29%  Similarity=1.026  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHhh
Q psy12992        156 LFIVIFLLLILLFFFIG  172 (319)
Q Consensus       156 lfiviflllillfffig  172 (319)
                      ++++||.++.|+++|.|
T Consensus       125 fy~~~~V~iyLv~~ffg  141 (214)
T PF06837_consen  125 FYTLLFVSIYLVYFFFG  141 (214)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            44566677777888877


No 186
>PF05510 Sarcoglycan_2:  Sarcoglycan alpha/epsilon;  InterPro: IPR008908 Sarcoglycans are a subcomplex of transmembrane proteins which are part of the dystrophin-glycoprotein complex. They are expressed in the skeletal, cardiac and smooth muscle. Although numerous studies have been conducted on the sarcoglycan subcomplex in skeletal and cardiac muscle, the manner of the distribution and localisation of these proteins along the nonjunctional sarcolemma is not clear []. This family contains alpha and epsilon members.; GO: 0016012 sarcoglycan complex
Probab=20.32  E-value=1.2e+02  Score=29.36  Aligned_cols=6  Identities=50%  Similarity=0.711  Sum_probs=2.7

Q ss_pred             hccCee
Q psy12992         76 QREGKV   81 (319)
Q Consensus        76 qregkv   81 (319)
                      ++||-+
T Consensus       184 ~~EGV~  189 (386)
T PF05510_consen  184 QKEGVY  189 (386)
T ss_pred             ccceEE
Confidence            445533


No 187
>COG5487 Small integral membrane protein [Function unknown]
Probab=20.28  E-value=1.1e+02  Score=23.14  Aligned_cols=20  Identities=45%  Similarity=1.080  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhh
Q psy12992        151 RRVFFLFIVIFLLLILLFFFIGLE  174 (319)
Q Consensus       151 rrvfflfiviflllillfffigle  174 (319)
                      +-+||+|+|+|    +.++|.|+.
T Consensus        32 kIlF~i~~vlf----~vsL~~g~~   51 (54)
T COG5487          32 KILFFIFLVLF----LVSLFAGLK   51 (54)
T ss_pred             HHHHHHHHHHH----HHHHHHHHh
Confidence            34555555544    345555653


No 188
>PF00822 PMP22_Claudin:  PMP-22/EMP/MP20/Claudin family;  InterPro: IPR004031 Several vertebrate small integral membrane glycoproteins are evolutionary related [, , ], including eye lens specific membrane protein 20 (MP20 or MP19); epithelial membrane protein-1 (EMP-1), which is also known as tumor-associated membrane protein (TMP) or as squamous cell-specific protein Cl-20; epithelial membrane protein-2 (EMP-2), which is also known as XMP; epithelial membrane protein-3 (EMP-3), also known as YMP; and peripheral myelin protein 22 (PMP-22), which is expressed in many tissues but mainly by Schwann cells as a component of myelin of the peripheral nervous system (PNS). PMP-22 probably plays a role both in myelinization and in cell proliferation. Mutations affecting PMP-22 are associated with hereditary motor and sensory neuropathies such as Charcot-Marie-Tooth disease type 1A (CMT-1A) in human or the trembler phenotype in mice. The proteins of this family are about 160 to 173 amino acid residues in size, and contain four transmembrane segments. PMP-22, EMP-1, -2 and -3 are highly similar, while MP20 is more distantly related. This family also includes the claudins, which are components of tight junctions.; GO: 0016020 membrane
Probab=20.27  E-value=1.5e+02  Score=22.42  Aligned_cols=32  Identities=19%  Similarity=0.358  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhhcccC
Q psy12992        149 LMRRVFFLFIVIFLLLILLFFFIGLEQRRKND  180 (319)
Q Consensus       149 lmrrvfflfiviflllillfffigleqrrknd  180 (319)
                      -.-|.+++.-+++.++-++.+++|++..++.+
T Consensus        71 ~a~r~l~i~s~il~~l~~~l~~~g~~~~~~~~  102 (166)
T PF00822_consen   71 QAARALMILSIILGFLGLILALFGLCCTKRGP  102 (166)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHhcccccccCC
Confidence            33466666666666677777888888755443


No 189
>TIGR03747 conj_TIGR03747 integrating conjugative element membrane protein, PFL_4697 family. Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=20.25  E-value=2e+02  Score=25.83  Aligned_cols=43  Identities=28%  Similarity=0.522  Sum_probs=28.9

Q ss_pred             ceEEeehHHHHHHHHHHHH-HHHHHHHHHHHHHHHHhhhhhhcc
Q psy12992        136 SWVIRVNFLVFIFLMRRVF-FLFIVIFLLLILLFFFIGLEQRRK  178 (319)
Q Consensus       136 swvirvnflvfiflmrrvf-flfiviflllillfffigleqrrk  178 (319)
                      .+..-..+.+++|+.|-.. ++-+.+|++.++.-++=||-+|.-
T Consensus       124 ~yl~a~~~~~~~f~iRL~IL~~~lPlfll~~~~glvDGLvrRdi  167 (233)
T TIGR03747       124 DYLLAAVYVTLVFLVRLVILVLAIPLFLLAAFVGLVDGLVRRDL  167 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444556667778777543 344567777777778888888854


No 190
>PTZ00116 signal peptidase; Provisional
Probab=20.23  E-value=69  Score=28.39  Aligned_cols=15  Identities=20%  Similarity=0.330  Sum_probs=12.2

Q ss_pred             cceEEeehHHHHHHH
Q psy12992        135 HSWVIRVNFLVFIFL  149 (319)
Q Consensus       135 hswvirvnflvfifl  149 (319)
                      |||..|.|-+++..+
T Consensus         2 hS~~~R~Nal~~f~~   16 (185)
T PTZ00116          2 DNVLNRLNVLSYSMA   16 (185)
T ss_pred             ccHHHHHHHHHHHHH
Confidence            899999999886444


No 191
>PF04612 T2SM:  Type II secretion system (T2SS), protein M;  InterPro: IPR007690 General secretion pathway (GSP) protein M is a membrane protein involved in the export of proteins in bacteria. It consists of a short cytosolic N-terminal domain, a transmembrane domain, and a C-terminal periplasmic domain. The precise function of this protein is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers [],; GO: 0006858 extracellular transport; PDB: 1UV7_A.
Probab=20.14  E-value=34  Score=26.39  Aligned_cols=18  Identities=33%  Similarity=0.776  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q psy12992        154 FFLFIVIFLLLILLFFFI  171 (319)
Q Consensus       154 fflfiviflllillfffi  171 (319)
                      ++++.+++++++++++++
T Consensus        18 ll~~~~~~l~~~l~~~~~   35 (160)
T PF04612_consen   18 LLLVLGVVLLLALLYLLL   35 (160)
T ss_dssp             ------------------
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            334444444444444443


No 192
>PRK10833 putative assembly protein; Provisional
Probab=20.14  E-value=75  Score=30.25  Aligned_cols=16  Identities=25%  Similarity=0.737  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy12992        150 MRRVFFLFIVIFLLLI  165 (319)
Q Consensus       150 mrrvfflfivifllli  165 (319)
                      |+|.++.++++++|++
T Consensus         1 mkrll~~l~~l~~l~v   16 (617)
T PRK10833          1 MRRFLTTLMILLVVLV   16 (617)
T ss_pred             CcchHHHHHHHHHHHH
Confidence            4565555555444443


No 193
>PF14992 TMCO5:  TMCO5 family
Probab=20.04  E-value=1.8e+02  Score=27.31  Aligned_cols=27  Identities=33%  Similarity=0.656  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHh
Q psy12992        145 VFIFLMRRVFFLFIVIFL-LLILLFFFI  171 (319)
Q Consensus       145 vfiflmrrvfflfivifl-llillfffi  171 (319)
                      .|++-+-|.+|..|++|. ||..+||||
T Consensus       212 ~~wkr~lr~l~f~vL~f~~LL~y~~f~~  239 (280)
T PF14992_consen  212 TFWKRALRLLFFMVLFFTRLLGYLLFYI  239 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444444444333333332 333344443


No 194
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=20.03  E-value=1.4e+02  Score=22.93  Aligned_cols=9  Identities=11%  Similarity=0.117  Sum_probs=3.7

Q ss_pred             HHhhhhhhc
Q psy12992        169 FFIGLEQRR  177 (319)
Q Consensus       169 ffigleqrr  177 (319)
                      .++++|-.+
T Consensus        66 ~~~~~e~~~   74 (103)
T PF06422_consen   66 TLLATEFIK   74 (103)
T ss_pred             HHHHHHHhc
Confidence            334444433


No 195
>PF07234 DUF1426:  Protein of unknown function (DUF1426);  InterPro: IPR009871 This family consists of several Banana bunchy top virus proteins of around 120 residues in length. Q9IGU4 from SWISSPROT is annotated a movement protein whereas most other family members are hypothetical. The function of this family is unknown.
Probab=20.02  E-value=1.6e+02  Score=24.95  Aligned_cols=28  Identities=36%  Similarity=0.673  Sum_probs=10.9

Q ss_pred             ehHHHHHHHHHHHHHHHHH-HHHHHHHHH
Q psy12992        141 VNFLVFIFLMRRVFFLFIV-IFLLLILLF  168 (319)
Q Consensus       141 vnflvfiflmrrvfflfiv-iflllillf  168 (319)
                      |-.+.=+||+--..|+.|. +++||.|||
T Consensus         8 VKlfFEwFLF~~AIFiAItIlYILLalL~   36 (117)
T PF07234_consen    8 VKLFFEWFLFFGAIFIAITILYILLALLF   36 (117)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3333334444333333333 334444443


Done!