BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13018
         (68 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XHL|B Chain B, Structure Of A Functional Derivative Of Clostridium
           Botulinum Neurotoxin Type B
          Length = 433

 Score = 25.0 bits (53), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 4   LEEDVLYRQNVNIYKAGPEIPVDANDINTE 33
           LEE + YR N+   K    I +D NDIN++
Sbjct: 292 LEEIIKYRYNIYSEKEKSNINIDFNDINSK 321


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.307    0.134    0.366 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,286,939
Number of Sequences: 62578
Number of extensions: 84049
Number of successful extensions: 120
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 117
Number of HSP's gapped (non-prelim): 3
length of query: 68
length of database: 14,973,337
effective HSP length: 38
effective length of query: 30
effective length of database: 12,595,373
effective search space: 377861190
effective search space used: 377861190
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 45 (21.9 bits)