Diaphorina citri psyllid: psy13041

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MAKDEKNIRSQDYFTVIVMVAGNPKGLPVAWDYVKKNWDYLLKRFGLNHRVFGRIIPSVCGKFTTQERLDEVSEKSLKNLL
ccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccHcccccccccccccHHHHHHHHHHHHHccc
***D*KNIRSQDYFTVIVMVAGNPKGLPVAWDYVKKNWDYLLKRFGLNHRVFGRIIPSVCGKFTTQERLDEVSEKSL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKDEKNIRSQDYFTVIVMVAGNPKGLPVAWDYVKKNWDYLLKRFGLNHRVFGRIIPSVCGKFTTQERLDEVSEKSLKNLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0043227 [CC]membrane-bounded organelleprobableGO:0005575, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0004177 [MF]aminopeptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SE6, chain A
Confidence level:very confident
Coverage over the Query: 3-80
View the alignment between query and template
View the model in PyMOL