Query         psy13053
Match_columns 242
No_of_seqs    222 out of 658
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:15:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13053.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13053hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14955 MRP-S24:  Mitochondria 100.0 1.3E-36 2.8E-41  245.7   1.2  116   19-134     1-130 (136)
  2 KOG1101|consensus               99.9 6.6E-25 1.4E-29  182.2   6.0   80  109-196    14-93  (147)
  3 smart00238 BIR Baculoviral inh  99.9 2.6E-22 5.6E-27  146.3   5.5   69  110-188     2-70  (71)
  4 PF00653 BIR:  Inhibitor of Apo  99.9 1.2E-22 2.6E-27  148.4   2.6   69  113-188     1-70  (70)
  5 cd00022 BIR Baculoviral inhibi  99.9 4.1E-22 8.9E-27  144.5   5.0   68  111-188     1-68  (69)
  6 KOG1101|consensus               99.1   2E-11 4.3E-16  101.7   2.2   67   42-113    11-92  (147)
  7 smart00238 BIR Baculoviral inh  99.1 1.9E-11 4.2E-16   88.8   1.4   57   45-106     1-70  (71)
  8 cd00022 BIR Baculoviral inhibi  99.1 3.1E-11 6.7E-16   87.2   1.5   55   47-106     1-68  (69)
  9 PF00653 BIR:  Inhibitor of Apo  99.0 4.1E-11 8.9E-16   87.4   0.8   52   49-105     1-69  (70)
 10 PF07967 zf-C3HC:  C3HC zinc fi  93.7   0.062 1.3E-06   43.7   3.0   44  112-165     9-54  (133)
 11 PF11682 DUF3279:  Protein of u  81.6    0.86 1.9E-05   37.4   1.6   52  133-193    16-75  (128)
 12 KOG3497|consensus               70.9     1.6 3.4E-05   31.5   0.3   15  154-168     4-19  (69)
 13 PF08600 Rsm1:  Rsm1-like;  Int  53.4     6.4 0.00014   30.1   0.9   50  138-191     4-65  (91)
 14 COG1644 RPB10 DNA-directed RNA  49.5     6.9 0.00015   28.3   0.5   13  154-166     4-16  (63)
 15 KOG4765|consensus               47.8     9.2  0.0002   36.8   1.2   97  102-208    46-159 (419)
 16 PLN00032 DNA-directed RNA poly  47.6     7.6 0.00016   28.8   0.5   13  154-166     4-16  (71)
 17 PRK04016 DNA-directed RNA poly  45.0     9.1  0.0002   27.6   0.5   13  154-166     4-16  (62)
 18 PF01194 RNA_pol_N:  RNA polyme  40.6     7.3 0.00016   27.9  -0.5   12  155-166     5-16  (60)
 19 PF03604 DNA_RNApol_7kD:  DNA d  22.7      24 0.00053   22.0  -0.3   14  151-164    14-27  (32)

No 1  
>PF14955 MRP-S24:  Mitochondrial ribosome subunit S24
Probab=100.00  E-value=1.3e-36  Score=245.75  Aligned_cols=116  Identities=67%  Similarity=1.114  Sum_probs=112.3

Q ss_pred             hhhhcceeEeeccCCCccccccCCCCchhhhhhccccCcCccccCCCCCCccCCCceEE--------------EEEEecc
Q psy13053         19 KHVQAARYKTSKKGDKPLTYEMSGPPHTIAHIKSWNSWNTCNMLDGLRPSETAVEDEFI--------------QIIIKRQ   84 (242)
Q Consensus        19 ~~~~~~~~~~~~~~~~~ltye~a~~~~~i~RlkSF~~Wpt~na~aGF~y~~tg~~D~v~--------------~v~ikr~   84 (242)
                      .||||||||+|++|++|||||||++||+|+++|||+||||+|+++|...+++..+|+|+              +|+|||+
T Consensus         1 qk~~agr~r~t~~~~kplTYE~a~~Ph~Ig~rKsW~S~~T~nL~g~~~~~e~~~eD~fIRkFi~GTf~~~l~sEiiIKRr   80 (136)
T PF14955_consen    1 QKNRAGRYRVTPKGDKPLTYEMANPPHYIGHRKSWNSWHTSNLEGENRASERTVEDVFIRKFIRGTFPGLLASEIIIKRR   80 (136)
T ss_pred             CCcccceEEecCCCCCccchhhcCCCcEEeeeeeeccccccccccCCCCcchhhHHHHHHHhccCCCchhcchhhhhhhc
Confidence            38999999999999999999999999999999999999999999999999999999999              9999999


Q ss_pred             CCcccchhhhhhccCCCceeecccchHHhhhhhccCCcccccccccccCC
Q psy13053         85 HNIIRIGGIVERAIHPRKIYFLIGYTEELLSFWLQCPVKLELQTVENKCT  134 (242)
Q Consensus        85 gD~~~ia~~~Hrr~sP~C~y~ligytEerLstF~kwPvk~e~q~ve~k~t  134 (242)
                      +|.|+||++..++++|+.+|||+||+|++||.|++||+++++|+++++.+
T Consensus        81 ~N~I~Ia~~~~~~l~~~k~YFL~GYtEelLS~~lkcpVKlelqtv~~k~d  130 (136)
T PF14955_consen   81 HNVIRIAGIVLRRLQPRKIYFLIGYTEELLSHWLKCPVKLELQTVESKKD  130 (136)
T ss_pred             ccEEEEeEeeeccCCceeEEEehhhhHHHHHHHHCCCeEEEEEEcCCCCc
Confidence            99999999999999999999999999999999999999999999987654


No 2  
>KOG1101|consensus
Probab=99.91  E-value=6.6e-25  Score=182.25  Aligned_cols=80  Identities=40%  Similarity=0.808  Sum_probs=72.0

Q ss_pred             chHHhhhhhccCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcccc
Q psy13053        109 YTEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIK  188 (242)
Q Consensus       109 ytEerLstF~kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~fv~  188 (242)
                      ..+.||.||.+||... +    -+++|+.||+|||||+|   ..|.|+||+|+++|.+|+++||||+||++|+|.|.|++
T Consensus        14 ~~~aRl~TF~~Wp~~~-~----~~c~p~~lA~AGFy~~g---~~D~~~Cf~C~~~L~~We~~DDPW~EH~k~~p~C~F~~   85 (147)
T KOG1101|consen   14 REEARLKTFKNWPYSD-M----DKCTPEQLAEAGFYYTG---KQDCVKCFFCSGGLDDWEPGDDPWEEHAKWSPECEFLK   85 (147)
T ss_pred             HHHHHHhhhhcCCCCC-C----CCcCHHHHHhCCceeeC---CCCceECcccCcccccCCCCCCcHHHHHhhCCCCceee
Confidence            4467899999999752 1    16899999999999999   78999999999999999999999999999999999999


Q ss_pred             cccccccc
Q psy13053        189 LNTVEQQW  196 (242)
Q Consensus       189 ~~k~~~~~  196 (242)
                      ..|+.+.+
T Consensus        86 ~~k~~e~~   93 (147)
T KOG1101|consen   86 LKKGREFL   93 (147)
T ss_pred             cccchhhh
Confidence            99997553


No 3  
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=99.86  E-value=2.6e-22  Score=146.26  Aligned_cols=69  Identities=46%  Similarity=0.918  Sum_probs=63.0

Q ss_pred             hHHhhhhhccCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcccc
Q psy13053        110 TEELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIK  188 (242)
Q Consensus       110 tEerLstF~kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~fv~  188 (242)
                      .+.|++||.+||...       ...++.||+|||||+|   .+|.|+|++|+++|.+|+++||||+||++++|+|+||+
T Consensus         2 ~~~R~~sF~~w~~~~-------~~~~~~LA~~Gfyy~~---~~d~v~C~~C~~~l~~w~~~d~p~~~H~~~~p~C~fv~   70 (71)
T smart00238        2 EEARLKTFQNWPYNS-------KLTPEQLAEAGFYYTG---VGDEVKCFFCGGELDNWEPGDDPWEEHKKWSPNCPFVR   70 (71)
T ss_pred             HHHHHHHHHcCCCCc-------cCCHHHHHHcCCeECC---CCCEEEeCCCCCCcCCCCCCCCHHHHHhHhCcCCcCcc
Confidence            367899999999632       3479999999999999   79999999999999999999999999999999999986


No 4  
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=99.86  E-value=1.2e-22  Score=148.37  Aligned_cols=69  Identities=45%  Similarity=0.938  Sum_probs=57.6

Q ss_pred             hhhhhc-cCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcccc
Q psy13053        113 LLSFWL-QCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIK  188 (242)
Q Consensus       113 rLstF~-kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~fv~  188 (242)
                      ||.||. +||.....    ...++++||+|||||+|   .+|+|+|++|++.|.+|+++||||+||++++|+|+|++
T Consensus         1 Rl~SF~~~wp~~~~~----~~~~~~~LA~aGFyy~~---~~d~v~C~~C~~~l~~w~~~Ddp~~~H~~~sp~C~f~k   70 (70)
T PF00653_consen    1 RLKSFRSNWPHSNDH----DPVSPEKLARAGFYYTG---TGDRVRCFYCGLELDNWEPNDDPWEEHKRHSPNCPFVK   70 (70)
T ss_dssp             HHHGGTTGSSTTTTT----SSSHHHHHHHTTEEEES---STTEEEETTTTEEEES-STT--HHHHHHHHSTTBHHHH
T ss_pred             ChhHHCCcccCcccc----CCCCHHHHHHCCCEEcC---CCCEEEEeccCCEEeCCCCCCCHHHHHHHHCcCCeecC
Confidence            689996 59953211    24689999999999999   79999999999999999999999999999999999974


No 5  
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=99.85  E-value=4.1e-22  Score=144.45  Aligned_cols=68  Identities=49%  Similarity=0.957  Sum_probs=62.7

Q ss_pred             HHhhhhhccCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCCccCCCCcHHHHhccCCCCcccc
Q psy13053        111 EELLSFWLQCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDGWESMDDPWEEHKRHQKDCPYIK  188 (242)
Q Consensus       111 EerLstF~kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~DdP~~EH~r~sp~C~fv~  188 (242)
                      +.|++||.+||...       ...+++||+|||||+|   .+|.|+|++|++.|.+|+++|+|++||++++|+|+|++
T Consensus         1 ~~R~~TF~~w~~~~-------~~~~~~La~~Gfyy~~---~~d~v~C~~C~~~~~~w~~~d~p~~~H~~~~p~C~fv~   68 (69)
T cd00022           1 EARLKTFKNWPISL-------KVTPEKLAEAGFYYTG---RGDEVKCFFCGLELKNWEPGDDPWEEHKRWSPNCPFVL   68 (69)
T ss_pred             ChHHHHHHcCCCCc-------cCCHHHHHHcCCeEcC---CCCEEEeCCCCCCccCCCCCCCHHHHHhHhCcCCcCcc
Confidence            46899999999862       3479999999999999   78999999999999999999999999999999999986


No 6  
>KOG1101|consensus
Probab=99.12  E-value=2e-11  Score=101.72  Aligned_cols=67  Identities=12%  Similarity=0.066  Sum_probs=57.2

Q ss_pred             CCCchhhhhhccccCcCcc---------ccCCCCCCccCCCceEE------EEEEeccCCcccchhhhhhccCCCceeec
Q psy13053         42 GPPHTIAHIKSWNSWNTCN---------MLDGLRPSETAVEDEFI------QIIIKRQHNIIRIGGIVERAIHPRKIYFL  106 (242)
Q Consensus        42 ~~~~~i~RlkSF~~Wpt~n---------a~aGF~y~~tg~~D~v~------~v~ikr~gD~~~ia~~~Hrr~sP~C~y~l  106 (242)
                      .+..+.+||+||.+||.++         |+|||||  +|.+|.|+      ++.-+..+|+|   +.+|.+|+|.|.|++
T Consensus        11 ~~~~~~aRl~TF~~Wp~~~~~~c~p~~lA~AGFy~--~g~~D~~~Cf~C~~~L~~We~~DDP---W~EH~k~~p~C~F~~   85 (147)
T KOG1101|consen   11 KMAREEARLKTFKNWPYSDMDKCTPEQLAEAGFYY--TGKQDCVKCFFCSGGLDDWEPGDDP---WEEHAKWSPECEFLK   85 (147)
T ss_pred             hHHHHHHHHhhhhcCCCCCCCCcCHHHHHhCCcee--eCCCCceECcccCcccccCCCCCCc---HHHHHhhCCCCceee
Confidence            3558899999999999774         9999999  99999999      55555699999   999999999999998


Q ss_pred             ccchHHh
Q psy13053        107 IGYTEEL  113 (242)
Q Consensus       107 igytEer  113 (242)
                      .....+.
T Consensus        86 ~~k~~e~   92 (147)
T KOG1101|consen   86 LKKGREF   92 (147)
T ss_pred             cccchhh
Confidence            6665443


No 7  
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=99.11  E-value=1.9e-11  Score=88.79  Aligned_cols=57  Identities=16%  Similarity=0.143  Sum_probs=48.2

Q ss_pred             chhhhhhccccCcC-cc------ccCCCCCCccCCCceEE----EEEEe--ccCCcccchhhhhhccCCCceeec
Q psy13053         45 HTIAHIKSWNSWNT-CN------MLDGLRPSETAVEDEFI----QIIIK--RQHNIIRIGGIVERAIHPRKIYFL  106 (242)
Q Consensus        45 ~~i~RlkSF~~Wpt-~n------a~aGF~y~~tg~~D~v~----~v~ik--r~gD~~~ia~~~Hrr~sP~C~y~l  106 (242)
                      ++++|++||.+||. ..      |++||||  +|..|.|+    ++.|.  ..+|+|   ..+|.+++|.|+|++
T Consensus         1 ~~~~R~~sF~~w~~~~~~~~~~LA~~Gfyy--~~~~d~v~C~~C~~~l~~w~~~d~p---~~~H~~~~p~C~fv~   70 (71)
T smart00238        1 SEEARLKTFQNWPYNSKLTPEQLAEAGFYY--TGVGDEVKCFFCGGELDNWEPGDDP---WEEHKKWSPNCPFVR   70 (71)
T ss_pred             CHHHHHHHHHcCCCCccCCHHHHHHcCCeE--CCCCCEEEeCCCCCCcCCCCCCCCH---HHHHhHhCcCCcCcc
Confidence            36899999999995 22      9999999  99999999    44444  488888   999999999999984


No 8  
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=99.09  E-value=3.1e-11  Score=87.25  Aligned_cols=55  Identities=18%  Similarity=0.222  Sum_probs=47.3

Q ss_pred             hhhhhccccCcCc-c------ccCCCCCCccCCCceEE----EEEEe--ccCCcccchhhhhhccCCCceeec
Q psy13053         47 IAHIKSWNSWNTC-N------MLDGLRPSETAVEDEFI----QIIIK--RQHNIIRIGGIVERAIHPRKIYFL  106 (242)
Q Consensus        47 i~RlkSF~~Wpt~-n------a~aGF~y~~tg~~D~v~----~v~ik--r~gD~~~ia~~~Hrr~sP~C~y~l  106 (242)
                      ++|++||.+||.+ .      |++||||  +|..|.|+    +++|.  ..+|+|   ..+|++++|+|+|++
T Consensus         1 ~~R~~TF~~w~~~~~~~~~~La~~Gfyy--~~~~d~v~C~~C~~~~~~w~~~d~p---~~~H~~~~p~C~fv~   68 (69)
T cd00022           1 EARLKTFKNWPISLKVTPEKLAEAGFYY--TGRGDEVKCFFCGLELKNWEPGDDP---WEEHKRWSPNCPFVL   68 (69)
T ss_pred             ChHHHHHHcCCCCccCCHHHHHHcCCeE--cCCCCEEEeCCCCCCccCCCCCCCH---HHHHhHhCcCCcCcc
Confidence            4799999999986 2      9999999  99999999    55554  488888   999999999999974


No 9  
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=99.05  E-value=4.1e-11  Score=87.36  Aligned_cols=52  Identities=15%  Similarity=0.224  Sum_probs=42.7

Q ss_pred             hhhccc-cCcCcc----------ccCCCCCCccCCCceEE----EEEEec--cCCcccchhhhhhccCCCceee
Q psy13053         49 HIKSWN-SWNTCN----------MLDGLRPSETAVEDEFI----QIIIKR--QHNIIRIGGIVERAIHPRKIYF  105 (242)
Q Consensus        49 RlkSF~-~Wpt~n----------a~aGF~y~~tg~~D~v~----~v~ikr--~gD~~~ia~~~Hrr~sP~C~y~  105 (242)
                      ||+||. +||+..          |++||||  ++..|.|+    +++|..  .+|+|   +.+|++++|+|+|+
T Consensus         1 Rl~SF~~~wp~~~~~~~~~~~~LA~aGFyy--~~~~d~v~C~~C~~~l~~w~~~Ddp---~~~H~~~sp~C~f~   69 (70)
T PF00653_consen    1 RLKSFRSNWPHSNDHDPVSPEKLARAGFYY--TGTGDRVRCFYCGLELDNWEPNDDP---WEEHKRHSPNCPFV   69 (70)
T ss_dssp             HHHGGTTGSSTTTTTSSSHHHHHHHTTEEE--ESSTTEEEETTTTEEEES-STT--H---HHHHHHHSTTBHHH
T ss_pred             ChhHHCCcccCccccCCCCHHHHHHCCCEE--cCCCCEEEEeccCCEEeCCCCCCCH---HHHHHHHCcCCeec
Confidence            899996 599532          9999999  99999999    555554  88889   99999999999986


No 10 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=93.69  E-value=0.062  Score=43.66  Aligned_cols=44  Identities=23%  Similarity=0.252  Sum_probs=37.0

Q ss_pred             Hhhhhhc--cCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccC
Q psy13053        112 ELLSFWL--QCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELD  165 (242)
Q Consensus       112 erLstF~--kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~  165 (242)
                      +||+||.  +|..++.      ..+|-.+|.-||...+    .|.++|-.|+..|.
T Consensus         9 ~RL~Tf~~~~W~~kp~------~lspl~cA~~GW~~~~----~d~l~C~~C~~~l~   54 (133)
T PF07967_consen    9 RRLETFKSLTWFPKPP------WLSPLECARRGWICVS----KDMLKCESCGARLC   54 (133)
T ss_pred             HHHHHcccccccCCCc------ccCHHHHHHcCCCcCC----CCEEEeCCCCCEEE
Confidence            4789996  5866543      4699999999999987    99999999999776


No 11 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=81.63  E-value=0.86  Score=37.37  Aligned_cols=52  Identities=27%  Similarity=0.496  Sum_probs=39.1

Q ss_pred             CChhhhhhcCceecCCCCCCCcEEEeecCCccCCc--cCCCCcHHHHhccC------CCCccccccccc
Q psy13053        133 CTPENMATAGFYSISKLRNDTSVKCFCCLKELDGW--ESMDDPWEEHKRHQ------KDCPYIKLNTVE  193 (242)
Q Consensus       133 ~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~W--e~~DdP~~EH~r~s------p~C~fv~~~k~~  193 (242)
                      .++.+.+.+         +.|...|.+||..|.-=  .....||-||...+      -.|+|+.-.+.+
T Consensus        16 v~A~~a~~~---------~~~~~tC~~Cg~~L~lh~~~~~~~pWFEH~~~~~~~~~l~~C~yl~pe~k~   75 (128)
T PF11682_consen   16 VGARTAASA---------PYDHWTCHSCGCPLILHPGTDTEPPWFEHDQHSLAENGLMQCPYLDPEEKE   75 (128)
T ss_pred             EehhhhhhC---------CCCeEEEecCCceEEEecCCcCCCCccccCccccChhhcccCceECcccch
Confidence            356666666         68999999999988732  45678999999765      249999876654


No 12 
>KOG3497|consensus
Probab=70.87  E-value=1.6  Score=31.53  Aligned_cols=15  Identities=40%  Similarity=1.185  Sum_probs=12.1

Q ss_pred             cEEEeecCCccCC-cc
Q psy13053        154 SVKCFCCLKELDG-WE  168 (242)
Q Consensus       154 ~v~Cf~C~~~l~~-We  168 (242)
                      .++||.||+.+.+ |+
T Consensus         4 PiRCFtCGKvig~KWe   19 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDKWE   19 (69)
T ss_pred             eeEeeeccccccccHH
Confidence            3799999999974 54


No 13 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=53.44  E-value=6.4  Score=30.07  Aligned_cols=50  Identities=30%  Similarity=0.607  Sum_probs=32.9

Q ss_pred             hhhcCceecCCCCCCCcEEEeecCCccCCccCC------------CCcHHHHhccCCCCccccccc
Q psy13053        138 MATAGFYSISKLRNDTSVKCFCCLKELDGWESM------------DDPWEEHKRHQKDCPYIKLNT  191 (242)
Q Consensus       138 LA~AGFyytg~~~~~D~v~Cf~C~~~l~~We~~------------DdP~~EH~r~sp~C~fv~~~k  191 (242)
                      ||--|+=... ......+.|-+|...|.=|.--            =||.+||+.+   ||++....
T Consensus         4 lAl~GW~~~~-~~~~~~~~C~~C~Rr~GLW~f~~~~ss~~~~~~~~d~~~eHr~~---CPwv~~~~   65 (91)
T PF08600_consen    4 LALCGWQGLS-DSRLGLLSCSYCFRRLGLWMFKSKESSDSDPMSPFDPLEEHREY---CPWVNPST   65 (91)
T ss_pred             EEEeCCCCCC-CCCcCeEEccccCcEeeeeecccCccCCCCcCCCCCCccccccc---CCccCCcc
Confidence            4555662222 1122489999999998877321            3788899876   88887654


No 14 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=49.45  E-value=6.9  Score=28.26  Aligned_cols=13  Identities=38%  Similarity=0.897  Sum_probs=11.1

Q ss_pred             cEEEeecCCccCC
Q psy13053        154 SVKCFCCLKELDG  166 (242)
Q Consensus       154 ~v~Cf~C~~~l~~  166 (242)
                      .|+||.||..|.+
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            3899999999973


No 15 
>KOG4765|consensus
Probab=47.85  E-value=9.2  Score=36.84  Aligned_cols=97  Identities=21%  Similarity=0.136  Sum_probs=60.0

Q ss_pred             ceeecccchHHhhhhhc--cCCcccccccccccCChhhhhhcCceecCCCCCCCcEEEeecCCccCC------ccCC---
Q psy13053        102 KIYFLIGYTEELLSFWL--QCPVKLELQTVENKCTPENMATAGFYSISKLRNDTSVKCFCCLKELDG------WESM---  170 (242)
Q Consensus       102 C~y~ligytEerLstF~--kwPvk~e~q~ve~k~t~~~LA~AGFyytg~~~~~D~v~Cf~C~~~l~~------We~~---  170 (242)
                      |.++-.+.--.||.||.  +|-.++.      ..++-..|..|+....    .|.++|-+|+.-|.-      |+.+   
T Consensus        46 ~k~wdred~lrRl~Tfks~tWygkp~------~iS~lnCA~~GWv~vd----~D~lkCe~C~a~L~~s~pq~s~s~d~~n  115 (419)
T KOG4765|consen   46 CKPWDREDLLRRLATFKSRTWYGKPF------EISPLNCAKYGWVCVD----CDMLKCESCGAFLCASLPQQSFSFDRYN  115 (419)
T ss_pred             cCcccHHHHHHHHHhccCchhccCCc------ccchHHHhhcCeeecc----CCeeehhhhhhHHhccCCccccChHHHH
Confidence            44443333345689986  7777653      3589999999999987    999999999997752      3322   


Q ss_pred             CCcHHHHhc----cCCCCccccccccc--ccccHHHHHHHHHHH
Q psy13053        171 DDPWEEHKR----HQKDCPYIKLNTVE--QQWTLEEWIDLQQAM  208 (242)
Q Consensus       171 DdP~~EH~r----~sp~C~fv~~~k~~--~~~~~~~~~~l~~~~  208 (242)
                      .-+-.-|++    |...|++....-++  -++++.+=++|++..
T Consensus       116 ~~~ek~~kkLetaHe~~C~W~~~s~pe~i~e~p~~~p~~lV~r~  159 (419)
T KOG4765|consen  116 QRCEKFKKKLETAHEKFCPWRDSSCPERIVELPLDEPADLVGRR  159 (419)
T ss_pred             hHHHHHHHHHHHHHhhcCcCCCCCCchhhccCCCccHHHHHHHH
Confidence            112222332    34567776554443  345555555555433


No 16 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=47.60  E-value=7.6  Score=28.77  Aligned_cols=13  Identities=38%  Similarity=0.928  Sum_probs=11.2

Q ss_pred             cEEEeecCCccCC
Q psy13053        154 SVKCFCCLKELDG  166 (242)
Q Consensus       154 ~v~Cf~C~~~l~~  166 (242)
                      -|+||.||+.+.+
T Consensus         4 PVRCFTCGkvig~   16 (71)
T PLN00032          4 PVRCFTCGKVIGN   16 (71)
T ss_pred             ceeecCCCCCcHH
Confidence            3899999999973


No 17 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=45.04  E-value=9.1  Score=27.64  Aligned_cols=13  Identities=38%  Similarity=0.887  Sum_probs=11.4

Q ss_pred             cEEEeecCCccCC
Q psy13053        154 SVKCFCCLKELDG  166 (242)
Q Consensus       154 ~v~Cf~C~~~l~~  166 (242)
                      .|+||.||+.+.+
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            4899999999984


No 18 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=40.64  E-value=7.3  Score=27.94  Aligned_cols=12  Identities=42%  Similarity=0.994  Sum_probs=9.6

Q ss_pred             EEEeecCCccCC
Q psy13053        155 VKCFCCLKELDG  166 (242)
Q Consensus       155 v~Cf~C~~~l~~  166 (242)
                      |+||.||..+.+
T Consensus         5 VRCFTCGkvi~~   16 (60)
T PF01194_consen    5 VRCFTCGKVIGN   16 (60)
T ss_dssp             SS-STTTSBTCG
T ss_pred             eecCCCCCChhH
Confidence            789999999983


No 19 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=22.67  E-value=24  Score=21.99  Aligned_cols=14  Identities=14%  Similarity=0.501  Sum_probs=11.0

Q ss_pred             CCCcEEEeecCCcc
Q psy13053        151 NDTSVKCFCCLKEL  164 (242)
Q Consensus       151 ~~D~v~Cf~C~~~l  164 (242)
                      ..|.++|.+||-.+
T Consensus        14 ~~~~irC~~CG~RI   27 (32)
T PF03604_consen   14 PGDPIRCPECGHRI   27 (32)
T ss_dssp             TSSTSSBSSSS-SE
T ss_pred             CCCcEECCcCCCeE
Confidence            67899999999754


Done!