Query         psy13077
Match_columns 630
No_of_seqs    176 out of 714
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:50:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13077.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13077hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK04210 phosphoenolpyruvate c 100.0  6E-215  1E-219 1733.2  55.3  590   27-630     7-600 (601)
  2 PF00821 PEPCK:  Phosphoenolpyr 100.0  2E-215  4E-220 1742.5  42.9  583   35-630     1-586 (586)
  3 KOG3749|consensus              100.0  5E-213  1E-217 1666.1  47.1  614   14-630    25-639 (640)
  4 cd00819 PEPCK_GTP Phosphoenolp 100.0  7E-211  1E-215 1699.2  53.5  575   33-624     1-579 (579)
  5 COG1274 PckA Phosphoenolpyruva 100.0  9E-209  2E-213 1643.2  50.2  599   18-630     5-608 (608)
  6 cd01919 PEPCK Phosphoenolpyruv 100.0  2E-125  5E-130 1035.1  40.7  493   47-609     1-500 (515)
  7 PLN02597 phosphoenolpyruvate c 100.0  5E-106  1E-110  873.9  39.0  489   41-619    27-550 (555)
  8 COG1866 PckA Phosphoenolpyruva 100.0  1E-106  2E-111  857.9  32.3  472   47-609    19-510 (529)
  9 cd00484 PEPCK_ATP Phosphoenolp 100.0  1E-104  2E-109  864.5  39.4  481   48-619     2-506 (508)
 10 PTZ00311 phosphoenolpyruvate c 100.0  4E-104  8E-109  864.1  40.4  488   40-619    36-554 (561)
 11 TIGR00224 pckA phosphoenolpyru 100.0  2E-103  4E-108  853.1  40.4  487   40-619    12-527 (532)
 12 PRK09344 phosphoenolpyruvate c 100.0 1.1E-93 2.3E-98  783.5  37.8  489   40-619    10-521 (526)
 13 PF01293 PEPCK_ATP:  Phosphoeno 100.0 5.4E-90 1.2E-94  749.6  25.8  444   47-581     2-466 (466)
 14 cd00820 PEPCK_HprK Phosphoenol  99.6 5.1E-17 1.1E-21  146.9   2.9   70  266-342     1-70  (107)
 15 cd01918 HprK_C HprK/P, the bif  96.4  0.0019 4.2E-08   62.2   2.5   60  268-336     3-62  (149)
 16 COG3839 MalK ABC-type sugar tr  94.9   0.018 3.9E-07   62.3   3.1   21  280-302    27-47  (338)
 17 COG4136 ABC-type uncharacteriz  94.9   0.014 3.1E-07   57.2   2.0   33  268-302    12-46  (213)
 18 COG3842 PotA ABC-type spermidi  94.8   0.022 4.9E-07   61.9   3.3   37  280-319    29-69  (352)
 19 PF07475 Hpr_kinase_C:  HPr Ser  94.2   0.031 6.8E-07   55.2   2.6   61  268-336     7-67  (171)
 20 COG4619 ABC-type uncharacteriz  93.9    0.05 1.1E-06   54.3   3.3   21  280-302    27-47  (223)
 21 PTZ00301 uridine kinase; Provi  93.8   0.041 8.9E-07   55.6   2.6   17  286-302     5-21  (210)
 22 COG1116 TauB ABC-type nitrate/  93.7   0.038 8.3E-07   57.4   2.4   21  280-302    27-47  (248)
 23 COG4525 TauB ABC-type taurine   93.7   0.038 8.2E-07   56.3   2.2   22  280-303    29-50  (259)
 24 cd02023 UMPK Uridine monophosp  93.5    0.03 6.5E-07   54.7   1.1   33  287-319     2-35  (198)
 25 smart00382 AAA ATPases associa  93.4   0.047   1E-06   47.1   2.0   19  282-302     2-20  (148)
 26 PF13207 AAA_17:  AAA domain; P  93.3   0.044 9.5E-07   48.7   1.7   14  289-302     4-17  (121)
 27 COG1117 PstB ABC-type phosphat  92.9   0.059 1.3E-06   55.5   2.2   20  280-301    31-50  (253)
 28 COG1136 SalX ABC-type antimicr  92.8   0.065 1.4E-06   55.1   2.3   21  280-302    29-49  (226)
 29 TIGR00235 udk uridine kinase.   92.8   0.056 1.2E-06   53.5   1.8   21  280-302     4-24  (207)
 30 COG0572 Udk Uridine kinase [Nu  92.5   0.065 1.4E-06   54.8   1.8   38  282-319     6-44  (218)
 31 COG1126 GlnQ ABC-type polar am  92.4   0.081 1.7E-06   54.5   2.3   21  280-302    26-46  (240)
 32 PF00485 PRK:  Phosphoribulokin  92.3   0.068 1.5E-06   52.4   1.7   16  287-302     2-17  (194)
 33 COG1125 OpuBA ABC-type proline  92.3   0.078 1.7E-06   55.9   2.2   21  280-302    25-45  (309)
 34 PRK00300 gmk guanylate kinase;  92.1   0.093   2E-06   51.3   2.3   22  280-303     3-24  (205)
 35 PRK08233 hypothetical protein;  91.9   0.086 1.9E-06   50.0   1.8   18  285-302     4-21  (182)
 36 COG1127 Ttg2A ABC-type transpo  91.8    0.14   3E-06   53.4   3.4   37  280-319    32-72  (263)
 37 cd03238 ABC_UvrA The excision   91.8    0.11 2.3E-06   51.1   2.4   21  280-302    19-39  (176)
 38 PF13671 AAA_33:  AAA domain; P  91.7   0.091   2E-06   47.9   1.7   16  285-302     2-17  (143)
 39 TIGR00679 hpr-ser Hpr(Ser) kin  91.7    0.13 2.8E-06   55.1   3.0   93  230-336   102-195 (304)
 40 TIGR02237 recomb_radB DNA repa  91.7     0.1 2.2E-06   51.2   2.1   21  280-302    10-30  (209)
 41 PRK06696 uridine kinase; Valid  91.6     0.1 2.2E-06   52.4   2.1   21  282-302    20-40  (223)
 42 PRK05480 uridine/cytidine kina  91.6    0.11 2.3E-06   51.4   2.1   19  285-303     7-25  (209)
 43 TIGR02322 phosphon_PhnN phosph  91.6     0.1 2.3E-06   49.9   2.0   18  283-302     2-19  (179)
 44 COG4175 ProV ABC-type proline/  91.5    0.12 2.6E-06   55.9   2.5   63  255-320    22-93  (386)
 45 COG0529 CysC Adenylylsulfate k  91.3    0.11 2.4E-06   52.0   2.0   35  280-316    21-58  (197)
 46 PRK09825 idnK D-gluconate kina  91.2    0.13 2.7E-06   50.4   2.2   20  282-303     3-22  (176)
 47 PRK14738 gmk guanylate kinase;  91.1    0.14 2.9E-06   51.1   2.4   19  282-302    13-31  (206)
 48 PRK00131 aroK shikimate kinase  91.1    0.13 2.9E-06   48.0   2.3   20  281-302     3-22  (175)
 49 PRK08118 topology modulation p  91.1    0.12 2.6E-06   50.0   1.9   17  284-302     3-19  (167)
 50 TIGR03263 guanyl_kin guanylate  91.1    0.13 2.8E-06   49.1   2.0   19  282-302     1-19  (180)
 51 COG4181 Predicted ABC-type tra  91.0    0.15 3.2E-06   51.3   2.4   45  280-329    34-82  (228)
 52 PF13555 AAA_29:  P-loop contai  91.0    0.17 3.6E-06   42.2   2.4   19  280-300    21-39  (62)
 53 COG1124 DppF ABC-type dipeptid  90.8    0.14 3.1E-06   53.3   2.2   23  279-303    30-52  (252)
 54 PRK10078 ribose 1,5-bisphospho  90.7    0.14 3.1E-06   49.8   2.0   20  282-303     2-21  (186)
 55 cd03270 ABC_UvrA_I The excisio  90.7    0.15 3.2E-06   51.5   2.2   22  279-302    18-39  (226)
 56 PRK11607 potG putrescine trans  90.6    0.21 4.5E-06   54.7   3.4   28  280-309    43-74  (377)
 57 PRK05541 adenylylsulfate kinas  90.5    0.17 3.8E-06   48.4   2.4   21  280-302     5-25  (176)
 58 cd01394 radB RadB. The archaea  90.5    0.15 3.3E-06   50.4   2.1   21  280-302    17-37  (218)
 59 PRK07261 topology modulation p  90.5    0.15 3.2E-06   49.4   1.9   17  284-302     2-18  (171)
 60 TIGR02673 FtsE cell division A  90.4    0.24 5.3E-06   48.8   3.4   22  280-303    26-47  (214)
 61 TIGR03864 PQQ_ABC_ATP ABC tran  90.4    0.24 5.1E-06   49.8   3.4   22  280-303    25-46  (236)
 62 cd00009 AAA The AAA+ (ATPases   90.3    0.19   4E-06   44.1   2.3   21  280-302    17-37  (151)
 63 PRK09270 nucleoside triphospha  90.3    0.13 2.8E-06   51.9   1.4   21  282-302    31-51  (229)
 64 PF01583 APS_kinase:  Adenylyls  90.3    0.15 3.3E-06   49.6   1.7   35  282-318     2-39  (156)
 65 cd00227 CPT Chloramphenicol (C  90.2    0.17 3.8E-06   48.6   2.2   19  282-302     2-20  (175)
 66 COG4618 ArpD ABC-type protease  90.0    0.12 2.7E-06   58.6   1.0   70  280-371   360-434 (580)
 67 PRK06547 hypothetical protein;  89.9    0.19 4.1E-06   49.2   2.1   21  282-302    13-33  (172)
 68 cd01123 Rad51_DMC1_radA Rad51_  89.9    0.19 4.1E-06   50.0   2.2   21  280-302    17-37  (235)
 69 PF00005 ABC_tran:  ABC transpo  89.7    0.19 4.1E-06   45.7   1.8   21  280-302     9-29  (137)
 70 PRK05428 HPr kinase/phosphoryl  89.7    0.26 5.6E-06   52.9   3.1   92  229-333   101-192 (308)
 71 COG0396 sufC Cysteine desulfur  89.7    0.23   5E-06   51.5   2.6   30  280-311    28-57  (251)
 72 TIGR03878 thermo_KaiC_2 KaiC d  89.6    0.18 3.9E-06   52.2   1.8   21  280-302    34-54  (259)
 73 PF05496 RuvB_N:  Holliday junc  89.5    0.17 3.7E-06   52.3   1.5   18  284-303    52-69  (233)
 74 cd03258 ABC_MetN_methionine_tr  89.4    0.33 7.2E-06   48.5   3.5   21  280-302    29-49  (233)
 75 cd01393 recA_like RecA is a  b  89.2    0.23 5.1E-06   49.1   2.2   21  280-302    17-37  (226)
 76 PRK10575 iron-hydroxamate tran  89.1    0.34 7.3E-06   49.8   3.4   22  280-303    35-56  (265)
 77 cd03255 ABC_MJ0796_Lo1CDE_FtsE  89.1    0.25 5.4E-06   48.8   2.3   22  280-303    28-49  (218)
 78 cd03256 ABC_PhnC_transporter A  89.1    0.25 5.3E-06   49.5   2.3   22  280-303    25-46  (241)
 79 COG4608 AppF ABC-type oligopep  89.1    0.33 7.1E-06   51.2   3.3   37  280-319    37-77  (268)
 80 PRK11308 dppF dipeptide transp  89.0    0.35 7.5E-06   51.9   3.5   22  280-303    39-60  (327)
 81 TIGR00960 3a0501s02 Type II (G  89.0    0.26 5.6E-06   48.7   2.4   22  280-303    27-48  (216)
 82 cd03226 ABC_cobalt_CbiO_domain  89.0    0.26 5.6E-06   48.4   2.3   22  280-303    24-45  (205)
 83 PRK03846 adenylylsulfate kinas  88.9    0.25 5.4E-06   48.6   2.2   23  279-303    21-43  (198)
 84 TIGR03238 dnd_assoc_3 dnd syst  88.9    0.24 5.3E-06   56.1   2.3   21  280-302    30-50  (504)
 85 PRK08533 flagellar accessory p  88.9    0.25 5.3E-06   50.4   2.2   21  280-302    22-42  (230)
 86 PRK14250 phosphate ABC transpo  88.9    0.37 8.1E-06   48.7   3.4   22  280-303    27-48  (241)
 87 TIGR02315 ABC_phnC phosphonate  88.8    0.27 5.9E-06   49.4   2.4   22  280-303    26-47  (243)
 88 cd03225 ABC_cobalt_CbiO_domain  88.7    0.27 5.7E-06   48.4   2.2   21  280-302    25-45  (211)
 89 COG1123 ATPase components of v  88.7    0.38 8.3E-06   55.1   3.7   36  280-318   315-354 (539)
 90 PF00004 AAA:  ATPase family as  88.7    0.24 5.1E-06   44.0   1.7   15  286-302     2-16  (132)
 91 PRK11545 gntK gluconate kinase  88.6    0.17 3.6E-06   48.7   0.7   12  291-302     2-13  (163)
 92 PRK10895 lipopolysaccharide AB  88.6    0.39 8.5E-06   48.3   3.4   21  280-302    27-47  (241)
 93 PRK08084 DNA replication initi  88.6    0.27 5.8E-06   50.1   2.2   21  280-302    43-63  (235)
 94 cd03298 ABC_ThiQ_thiamine_tran  88.6    0.41   9E-06   47.1   3.5   21  280-302    22-42  (211)
 95 PLN02348 phosphoribulokinase    88.5    0.26 5.7E-06   54.5   2.2   21  282-302    47-67  (395)
 96 TIGR02868 CydC thiol reductant  88.5    0.23   5E-06   55.8   1.9   22  280-303   359-380 (529)
 97 TIGR01313 therm_gnt_kin carboh  88.5    0.19   4E-06   47.4   0.9   13  291-303     5-17  (163)
 98 PRK07667 uridine kinase; Provi  88.4    0.29 6.2E-06   48.2   2.2   21  282-302    15-35  (193)
 99 cd03257 ABC_NikE_OppD_transpor  88.4     0.3 6.4E-06   48.4   2.3   22  280-303    29-50  (228)
100 PF13238 AAA_18:  AAA domain; P  88.4    0.24 5.2E-06   43.8   1.5   13  290-302     4-16  (129)
101 PRK00889 adenylylsulfate kinas  88.4    0.28 6.2E-06   46.9   2.1   37  280-318     2-41  (175)
102 TIGR01166 cbiO cobalt transpor  88.3    0.31 6.7E-06   47.3   2.4   21  280-302    16-36  (190)
103 cd03260 ABC_PstB_phosphate_tra  88.3    0.31 6.6E-06   48.6   2.4   21  280-302    24-44  (227)
104 cd03235 ABC_Metallic_Cations A  88.3    0.31 6.7E-06   48.1   2.3   22  280-303    23-44  (213)
105 cd02028 UMPK_like Uridine mono  88.3    0.22 4.8E-06   48.6   1.3   16  287-302     2-17  (179)
106 cd00983 recA RecA is a  bacter  88.2    0.27 5.8E-06   53.1   2.0   21  280-302    53-73  (325)
107 PRK06762 hypothetical protein;  88.2    0.27 5.9E-06   46.5   1.8   16  285-302     5-20  (166)
108 TIGR01186 proV glycine betaine  88.2    0.38 8.2E-06   52.6   3.2   21  280-302    17-37  (363)
109 cd03252 ABCC_Hemolysin The ABC  88.2    0.42 9.2E-06   47.9   3.3   21  280-302    26-46  (237)
110 cd03269 ABC_putative_ATPase Th  88.2    0.31 6.8E-06   47.9   2.3   22  280-303    24-45  (210)
111 cd03261 ABC_Org_Solvent_Resist  88.2    0.31 6.7E-06   48.9   2.3   21  280-302    24-44  (235)
112 cd02025 PanK Pantothenate kina  88.2    0.21 4.6E-06   50.5   1.1   16  287-302     2-17  (220)
113 cd03262 ABC_HisP_GlnQ_permease  88.1    0.32   7E-06   47.7   2.4   22  280-303    24-45  (213)
114 PRK11432 fbpC ferric transport  88.0    0.31 6.7E-06   52.9   2.4   21  280-302    30-50  (351)
115 cd03224 ABC_TM1139_LivF_branch  88.0    0.31 6.7E-06   48.2   2.2   22  280-303    24-45  (222)
116 cd02024 NRK1 Nicotinamide ribo  88.0    0.23   5E-06   49.5   1.2   16  287-302     2-17  (187)
117 cd03292 ABC_FtsE_transporter F  87.9    0.33 7.2E-06   47.7   2.3   21  280-302    25-45  (214)
118 TIGR03265 PhnT2 putative 2-ami  87.9    0.32 6.9E-06   52.8   2.3   21  280-302    28-48  (353)
119 PRK10851 sulfate/thiosulfate t  87.9    0.44 9.5E-06   51.7   3.4   21  280-302    26-46  (353)
120 TIGR02012 tigrfam_recA protein  87.9     0.3 6.5E-06   52.7   2.1   21  280-302    53-73  (321)
121 cd01130 VirB11-like_ATPase Typ  87.8    0.23   5E-06   48.5   1.1   37  264-302     6-43  (186)
122 PRK11124 artP arginine transpo  87.8    0.33 7.2E-06   48.9   2.3   22  280-303    26-47  (242)
123 PRK14247 phosphate ABC transpo  87.8    0.34 7.3E-06   49.1   2.3   22  280-303    27-48  (250)
124 TIGR03608 L_ocin_972_ABC putat  87.7    0.34 7.3E-06   47.4   2.2   21  280-302    22-42  (206)
125 PRK09452 potA putrescine/sperm  87.7    0.32   7E-06   53.3   2.3   21  280-302    38-58  (375)
126 PRK09354 recA recombinase A; P  87.7    0.31 6.7E-06   53.2   2.1   21  280-302    58-78  (349)
127 COG0468 RecA RecA/RadA recombi  87.6    0.24 5.1E-06   52.5   1.1   21  280-302    58-78  (279)
128 TIGR01360 aden_kin_iso1 adenyl  87.6     0.3 6.4E-06   46.6   1.7   17  286-302     5-21  (188)
129 TIGR01978 sufC FeS assembly AT  87.6    0.35 7.7E-06   48.5   2.4   21  280-302    24-44  (243)
130 cd03293 ABC_NrtD_SsuB_transpor  87.6    0.34 7.3E-06   48.1   2.1   22  280-303    28-49  (220)
131 cd03268 ABC_BcrA_bacitracin_re  87.6    0.36 7.8E-06   47.4   2.3   21  280-302    24-44  (208)
132 TIGR02236 recomb_radA DNA repa  87.5    0.33 7.2E-06   51.1   2.2   21  280-302    93-113 (310)
133 cd03254 ABCC_Glucan_exporter_l  87.5    0.37 7.9E-06   48.0   2.4   21  280-302    27-47  (229)
134 PRK15079 oligopeptide ABC tran  87.5    0.48   1E-05   50.9   3.4   22  280-303    45-66  (331)
135 TIGR02142 modC_ABC molybdenum   87.5    0.51 1.1E-05   51.0   3.6   21  280-302    21-41  (354)
136 cd02019 NK Nucleoside/nucleoti  87.4     0.3 6.5E-06   40.5   1.4   13  290-302     5-17  (69)
137 cd03219 ABC_Mj1267_LivG_branch  87.4    0.36 7.8E-06   48.3   2.3   22  280-303    24-45  (236)
138 PRK11701 phnK phosphonate C-P   87.4    0.54 1.2E-05   48.0   3.6   22  280-303    30-51  (258)
139 TIGR03410 urea_trans_UrtE urea  87.4    0.38 8.1E-06   48.0   2.4   22  280-303    24-45  (230)
140 cd03247 ABCC_cytochrome_bd The  87.4    0.39 8.4E-06   46.3   2.4   22  280-303    26-47  (178)
141 PRK11650 ugpC glycerol-3-phosp  87.3    0.36 7.8E-06   52.4   2.3   21  280-302    28-48  (356)
142 PLN02165 adenylate isopentenyl  87.3    0.41 8.8E-06   52.0   2.7   30  271-302    32-61  (334)
143 cd03216 ABC_Carb_Monos_I This   87.2    0.39 8.4E-06   45.9   2.3   21  280-302    24-44  (163)
144 cd03259 ABC_Carb_Solutes_like   87.2    0.38 8.3E-06   47.4   2.3   21  280-302    24-44  (213)
145 PRK11629 lolD lipoprotein tran  87.2    0.38 8.1E-06   48.3   2.2   21  280-302    33-53  (233)
146 cd03223 ABCD_peroxisomal_ALDP   87.2     0.4 8.7E-06   46.0   2.3   21  280-302    25-45  (166)
147 cd03266 ABC_NatA_sodium_export  87.1     0.4 8.6E-06   47.4   2.3   22  280-303    29-50  (218)
148 PRK09087 hypothetical protein;  87.1    0.29 6.4E-06   49.8   1.5   20  282-303    44-63  (226)
149 PRK15177 Vi polysaccharide exp  87.1    0.39 8.5E-06   47.9   2.3   21  280-302    11-31  (213)
150 TIGR02211 LolD_lipo_ex lipopro  87.0     0.4 8.7E-06   47.5   2.3   22  280-303    29-50  (221)
151 PRK13539 cytochrome c biogenes  87.0    0.41 8.8E-06   47.3   2.3   21  280-302    26-46  (207)
152 cd03265 ABC_DrrA DrrA is the A  87.0    0.41 8.9E-06   47.5   2.4   22  280-303    24-45  (220)
153 PRK10247 putative ABC transpor  87.0    0.41 8.9E-06   47.9   2.4   21  280-302    31-51  (225)
154 cd03246 ABCC_Protease_Secretio  86.9    0.43 9.3E-06   45.8   2.4   21  280-302    26-46  (173)
155 PRK09361 radB DNA repair and r  86.8    0.39 8.5E-06   47.8   2.2   21  280-302    21-41  (225)
156 cd03230 ABC_DR_subfamily_A Thi  86.8    0.42 9.1E-06   45.9   2.3   21  280-302    24-44  (173)
157 TIGR00554 panK_bact pantothena  86.8    0.38 8.2E-06   51.2   2.1   20  283-302    61-80  (290)
158 cd03245 ABCC_bacteriocin_expor  86.7    0.43 9.4E-06   47.2   2.4   21  280-302    28-48  (220)
159 PF00910 RNA_helicase:  RNA hel  86.6    0.33 7.2E-06   43.4   1.4   16  286-303     2-17  (107)
160 KOG0060|consensus               86.6    0.39 8.5E-06   55.4   2.2   21  280-302   459-479 (659)
161 cd03222 ABC_RNaseL_inhibitor T  86.6    0.93   2E-05   44.6   4.6   21  280-302    23-43  (177)
162 cd03250 ABCC_MRP_domain1 Domai  86.6    0.45 9.7E-06   46.7   2.4   22  280-303    29-50  (204)
163 cd03112 CobW_like The function  86.6    0.46 9.9E-06   45.5   2.4   54  285-340     3-61  (158)
164 PRK06217 hypothetical protein;  86.5    0.38 8.2E-06   46.7   1.8   33  285-321     4-37  (183)
165 cd03229 ABC_Class3 This class   86.5    0.46   1E-05   45.8   2.4   21  280-302    24-44  (178)
166 cd03214 ABC_Iron-Siderophores_  86.4    0.47   1E-05   45.8   2.4   21  280-302    23-43  (180)
167 PRK11248 tauB taurine transpor  86.4    0.46 9.9E-06   48.8   2.4   21  280-302    25-45  (255)
168 TIGR02881 spore_V_K stage V sp  86.3    0.45 9.7E-06   49.0   2.3   18  283-302    43-60  (261)
169 cd03221 ABCF_EF-3 ABCF_EF-3  E  86.3    0.48   1E-05   44.5   2.3   21  280-302    24-44  (144)
170 cd03296 ABC_CysA_sulfate_impor  86.3    0.45 9.9E-06   47.9   2.3   22  280-303    26-47  (239)
171 cd03263 ABC_subfamily_A The AB  86.3    0.47   1E-05   47.0   2.3   22  280-303    26-47  (220)
172 PRK09183 transposase/IS protei  86.3    0.41 8.8E-06   49.7   2.0   22  280-303   100-121 (259)
173 PRK04301 radA DNA repair and r  86.2    0.42 9.2E-06   50.7   2.1   21  280-302   100-120 (317)
174 TIGR03881 KaiC_arch_4 KaiC dom  86.2    0.44 9.5E-06   47.5   2.1   21  280-302    18-38  (229)
175 PF10662 PduV-EutP:  Ethanolami  86.2    0.41   9E-06   46.1   1.9   55  284-358     3-57  (143)
176 PRK11247 ssuB aliphatic sulfon  86.2    0.46   1E-05   49.1   2.3   21  280-302    36-56  (257)
177 cd03218 ABC_YhbG The ABC trans  86.2    0.46   1E-05   47.4   2.3   21  280-302    24-44  (232)
178 PRK13540 cytochrome c biogenes  86.2    0.49 1.1E-05   46.5   2.4   21  280-302    25-45  (200)
179 PRK10908 cell division protein  86.1    0.49 1.1E-05   47.1   2.4   21  280-302    26-46  (222)
180 TIGR01188 drrA daunorubicin re  86.1    0.63 1.4E-05   48.9   3.3   21  280-302    17-37  (302)
181 TIGR03877 thermo_KaiC_1 KaiC d  86.1    0.45 9.8E-06   48.3   2.1   21  280-302    19-39  (237)
182 TIGR03005 ectoine_ehuA ectoine  86.0    0.48   1E-05   48.1   2.4   21  280-302    24-44  (252)
183 PRK11144 modC molybdate transp  86.0    0.47   1E-05   51.3   2.4   21  280-302    22-42  (352)
184 PRK14527 adenylate kinase; Pro  85.9    0.49 1.1E-05   46.2   2.2   41  583-623   142-188 (191)
185 cd03301 ABC_MalK_N The N-termi  85.9    0.51 1.1E-05   46.5   2.4   21  280-302    24-44  (213)
186 cd03233 ABC_PDR_domain1 The pl  85.9    0.49 1.1E-05   46.8   2.2   22  280-303    31-52  (202)
187 PRK06620 hypothetical protein;  85.8    0.49 1.1E-05   47.8   2.3   22  280-303    42-63  (214)
188 TIGR00972 3a0107s01c2 phosphat  85.8    0.51 1.1E-05   47.8   2.4   21  280-302    25-45  (247)
189 COG1120 FepC ABC-type cobalami  85.8    0.49 1.1E-05   49.7   2.3   20  280-301    26-45  (258)
190 PRK10584 putative ABC transpor  85.8     0.5 1.1E-05   47.1   2.3   22  280-303    34-55  (228)
191 TIGR00150 HI0065_YjeE ATPase,   85.7    0.53 1.2E-05   44.7   2.3   21  280-302    20-40  (133)
192 TIGR01184 ntrCD nitrate transp  85.7     0.5 1.1E-05   47.6   2.2   21  280-302     9-29  (230)
193 PRK11000 maltose/maltodextrin   85.7    0.49 1.1E-05   51.6   2.3   21  280-302    27-47  (369)
194 PRK14274 phosphate ABC transpo  85.7     0.5 1.1E-05   48.2   2.3   22  280-303    36-57  (259)
195 TIGR02323 CP_lyasePhnK phospho  85.6     0.5 1.1E-05   47.9   2.2   21  280-302    27-47  (253)
196 PRK13538 cytochrome c biogenes  85.6    0.53 1.2E-05   46.3   2.3   21  280-302    25-45  (204)
197 PRK13543 cytochrome c biogenes  85.6    0.53 1.2E-05   46.8   2.3   21  280-302    35-55  (214)
198 cd03248 ABCC_TAP TAP, the Tran  85.6    0.54 1.2E-05   46.8   2.4   21  280-302    38-58  (226)
199 cd03295 ABC_OpuCA_Osmoprotecti  85.6    0.53 1.2E-05   47.5   2.4   21  280-302    25-45  (242)
200 PRK06893 DNA replication initi  85.4    0.41 8.9E-06   48.5   1.5   18  284-303    41-58  (229)
201 PRK14267 phosphate ABC transpo  85.4    0.55 1.2E-05   47.6   2.4   22  280-303    28-49  (253)
202 TIGR03258 PhnT 2-aminoethylpho  85.3    0.53 1.1E-05   51.3   2.4   21  280-302    29-49  (362)
203 PRK13541 cytochrome c biogenes  85.3    0.55 1.2E-05   45.9   2.3   21  280-302    24-44  (195)
204 PF06745 KaiC:  KaiC;  InterPro  85.3    0.44 9.6E-06   47.5   1.6   42  480-522   117-158 (226)
205 cd03228 ABCC_MRP_Like The MRP   85.2    0.59 1.3E-05   44.8   2.4   21  280-302    26-46  (171)
206 PRK11264 putative amino-acid A  85.2    0.55 1.2E-05   47.5   2.3   21  280-302    27-47  (250)
207 PF13401 AAA_22:  AAA domain; P  85.2    0.43 9.3E-06   42.7   1.4   19  282-302     4-22  (131)
208 PRK14261 phosphate ABC transpo  85.2    0.55 1.2E-05   47.7   2.3   22  280-303    30-51  (253)
209 PRK11174 cysteine/glutathione   85.1    0.46   1E-05   54.2   1.9   22  280-303   374-395 (588)
210 cd03215 ABC_Carb_Monos_II This  85.0    0.58 1.3E-05   45.3   2.3   22  280-303    24-45  (182)
211 PRK05439 pantothenate kinase;   85.0    0.58 1.3E-05   50.3   2.5   22  281-302    83-104 (311)
212 PLN03046 D-glycerate 3-kinase;  85.0    0.51 1.1E-05   53.0   2.1   50  252-302   177-230 (460)
213 PRK14273 phosphate ABC transpo  85.0    0.58 1.2E-05   47.6   2.3   21  280-302    31-51  (254)
214 PRK10744 pstB phosphate transp  85.0    0.57 1.2E-05   47.9   2.3   22  280-303    37-58  (260)
215 PRK11022 dppD dipeptide transp  85.0    0.55 1.2E-05   50.3   2.3   21  280-302    31-51  (326)
216 CHL00131 ycf16 sulfate ABC tra  85.0    0.57 1.2E-05   47.4   2.3   22  280-303    31-52  (252)
217 PF07724 AAA_2:  AAA domain (Cd  84.9    0.52 1.1E-05   46.1   1.9   17  287-303     6-22  (171)
218 PRK14239 phosphate transporter  84.9    0.58 1.3E-05   47.4   2.3   22  280-303    29-50  (252)
219 cd03271 ABC_UvrA_II The excisi  84.9    0.56 1.2E-05   49.1   2.3   24  277-302    16-39  (261)
220 cd00071 GMPK Guanosine monopho  84.9    0.44 9.5E-06   44.6   1.3   13  290-302     5-17  (137)
221 cd03290 ABCC_SUR1_N The SUR do  84.8    0.61 1.3E-05   46.2   2.4   21  280-302    25-45  (218)
222 PRK14256 phosphate ABC transpo  84.8    0.58 1.3E-05   47.5   2.3   22  280-303    28-49  (252)
223 PLN02318 phosphoribulokinase/u  84.8     0.6 1.3E-05   54.5   2.6   21  283-303    64-84  (656)
224 PRK13648 cbiO cobalt transport  84.8     0.6 1.3E-05   48.1   2.4   22  280-303    33-54  (269)
225 PRK15093 antimicrobial peptide  84.8    0.58 1.2E-05   50.1   2.3   22  280-303    31-52  (330)
226 PRK14737 gmk guanylate kinase;  84.7    0.58 1.3E-05   46.2   2.2   19  282-302     4-22  (186)
227 PRK14241 phosphate transporter  84.7    0.59 1.3E-05   47.7   2.2   22  280-303    28-49  (258)
228 PRK13649 cbiO cobalt transport  84.6     0.6 1.3E-05   48.3   2.3   21  280-302    31-51  (280)
229 PTZ00035 Rad51 protein; Provis  84.6    0.55 1.2E-05   50.8   2.1   21  280-302   116-136 (337)
230 PRK13638 cbiO cobalt transport  84.6    0.61 1.3E-05   48.1   2.3   21  280-302    25-45  (271)
231 PRK10751 molybdopterin-guanine  84.6    0.55 1.2E-05   46.4   1.9   18  285-302     7-24  (173)
232 cd03251 ABCC_MsbA MsbA is an e  84.5    0.64 1.4E-05   46.4   2.4   21  280-302    26-46  (234)
233 PRK09473 oppD oligopeptide tra  84.5    0.58 1.2E-05   50.2   2.2   22  280-303    40-61  (330)
234 PLN02796 D-glycerate 3-kinase   84.5    0.63 1.4E-05   50.8   2.4   19  284-302   100-118 (347)
235 cd03234 ABCG_White The White s  84.5    0.59 1.3E-05   46.7   2.1   22  280-303    31-52  (226)
236 cd03237 ABC_RNaseL_inhibitor_d  84.5    0.64 1.4E-05   47.7   2.4   22  280-303    23-44  (246)
237 PRK14242 phosphate transporter  84.4    0.62 1.3E-05   47.3   2.3   22  280-303    30-51  (253)
238 TIGR02324 CP_lyasePhnL phospho  84.4    0.65 1.4E-05   46.1   2.4   22  280-303    32-53  (224)
239 cd02021 GntK Gluconate kinase   84.4    0.52 1.1E-05   43.7   1.6   14  290-303     5-18  (150)
240 PLN03187 meiotic recombination  84.4    0.56 1.2E-05   51.1   2.0   21  280-302   124-144 (344)
241 PRK14259 phosphate ABC transpo  84.4    0.63 1.4E-05   48.1   2.3   22  280-303    37-58  (269)
242 cd03369 ABCC_NFT1 Domain 2 of   84.4    0.66 1.4E-05   45.6   2.4   22  280-303    32-53  (207)
243 TIGR01189 ccmA heme ABC export  84.4    0.65 1.4E-05   45.4   2.3   21  280-302    24-44  (198)
244 PRK14240 phosphate transporter  84.4    0.64 1.4E-05   47.0   2.3   22  280-303    27-48  (250)
245 PRK09493 glnQ glutamine ABC tr  84.4    0.65 1.4E-05   46.7   2.3   22  280-303    25-46  (240)
246 cd03249 ABC_MTABC3_MDL1_MDL2 M  84.4    0.62 1.4E-05   46.7   2.2   22  280-303    27-48  (238)
247 PRK11831 putative ABC transpor  84.3    0.65 1.4E-05   47.9   2.3   22  280-303    31-52  (269)
248 cd00464 SK Shikimate kinase (S  84.2     0.5 1.1E-05   43.5   1.4   17  285-303     2-18  (154)
249 PRK14244 phosphate ABC transpo  84.1    0.66 1.4E-05   47.1   2.3   22  280-303    29-50  (251)
250 PRK10418 nikD nickel transport  84.1    0.66 1.4E-05   47.3   2.3   22  280-303    27-48  (254)
251 PRK10771 thiQ thiamine transpo  84.0    0.68 1.5E-05   46.4   2.3   21  280-302    23-43  (232)
252 PRK15112 antimicrobial peptide  84.0    0.66 1.4E-05   47.8   2.3   21  280-302    37-57  (267)
253 PRK14262 phosphate ABC transpo  84.0    0.68 1.5E-05   46.9   2.3   22  280-303    27-48  (250)
254 cd03283 ABC_MutS-like MutS-lik  84.0    0.68 1.5E-05   46.1   2.3   20  281-302    24-43  (199)
255 PRK13645 cbiO cobalt transport  84.0    0.65 1.4E-05   48.4   2.2   22  280-303    35-56  (289)
256 TIGR02655 circ_KaiC circadian   84.0    0.61 1.3E-05   52.6   2.1   21  280-302    19-39  (484)
257 PRK13632 cbiO cobalt transport  83.9    0.68 1.5E-05   47.8   2.4   21  280-302    33-53  (271)
258 PF13191 AAA_16:  AAA ATPase do  83.9    0.55 1.2E-05   44.2   1.5   20  281-302    23-42  (185)
259 cd02020 CMPK Cytidine monophos  83.8    0.52 1.1E-05   42.9   1.3   15  288-302     3-17  (147)
260 cd03264 ABC_drug_resistance_li  83.8    0.64 1.4E-05   45.8   2.0   19  281-302    25-43  (211)
261 PRK13548 hmuV hemin importer A  83.8    0.69 1.5E-05   47.4   2.3   21  280-302    26-46  (258)
262 cd03232 ABC_PDR_domain2 The pl  83.8    0.68 1.5E-05   45.3   2.1   22  280-303    31-52  (192)
263 PRK09984 phosphonate/organopho  83.7     0.7 1.5E-05   47.3   2.3   22  280-303    28-49  (262)
264 cd03294 ABC_Pro_Gly_Bertaine T  83.7    0.71 1.5E-05   47.7   2.4   21  280-302    48-68  (269)
265 cd03244 ABCC_MRP_domain2 Domai  83.7    0.73 1.6E-05   45.6   2.4   21  280-302    28-48  (221)
266 PRK13547 hmuV hemin importer A  83.6    0.71 1.5E-05   48.1   2.3   22  280-303    25-46  (272)
267 PRK14237 phosphate transporter  83.6    0.72 1.6E-05   47.5   2.4   21  280-302    44-64  (267)
268 PRK11300 livG leucine/isoleuci  83.6    0.69 1.5E-05   46.9   2.2   22  280-303    29-50  (255)
269 TIGR03771 anch_rpt_ABC anchore  83.6    0.73 1.6E-05   46.2   2.3   22  280-303     4-25  (223)
270 PRK11176 lipid transporter ATP  83.6    0.67 1.5E-05   52.7   2.3   22  280-303   367-388 (582)
271 PRK10619 histidine/lysine/argi  83.5    0.71 1.5E-05   47.1   2.3   21  280-302    29-49  (257)
272 cd01128 rho_factor Transcripti  83.5    0.69 1.5E-05   48.1   2.2   20  281-302    15-34  (249)
273 PRK09580 sufC cysteine desulfu  83.5    0.73 1.6E-05   46.4   2.3   22  280-303    25-46  (248)
274 cd01120 RecA-like_NTPases RecA  83.5    0.55 1.2E-05   42.6   1.3   15  286-302     3-17  (165)
275 TIGR02238 recomb_DMC1 meiotic   83.5    0.63 1.4E-05   49.9   1.9   21  280-302    94-114 (313)
276 PRK10253 iron-enterobactin tra  83.5    0.74 1.6E-05   47.3   2.4   22  280-303    31-52  (265)
277 TIGR02769 nickel_nikE nickel i  83.5    0.73 1.6E-05   47.4   2.3   21  280-302    35-55  (265)
278 PRK10419 nikE nickel transport  83.5    0.72 1.6E-05   47.6   2.3   22  280-303    36-57  (268)
279 TIGR03411 urea_trans_UrtD urea  83.4    0.74 1.6E-05   46.3   2.3   21  280-302    26-46  (242)
280 TIGR00455 apsK adenylylsulfate  83.4    0.74 1.6E-05   44.5   2.2   22  280-303    16-37  (184)
281 TIGR02770 nickel_nikD nickel i  83.4    0.76 1.6E-05   46.1   2.3   22  280-303    10-31  (230)
282 PRK06067 flagellar accessory p  83.3    0.74 1.6E-05   46.3   2.3   21  280-302    23-43  (234)
283 PRK04328 hypothetical protein;  83.3    0.72 1.6E-05   47.4   2.2   21  280-302    21-41  (249)
284 PRK14249 phosphate ABC transpo  83.3    0.76 1.7E-05   46.6   2.4   21  280-302    28-48  (251)
285 cd00267 ABC_ATPase ABC (ATP-bi  83.3    0.79 1.7E-05   43.1   2.3   21  280-302    23-43  (157)
286 PRK15453 phosphoribulokinase;   83.3    0.63 1.4E-05   49.7   1.8   18  285-302     6-23  (290)
287 PRK11614 livF leucine/isoleuci  83.2    0.74 1.6E-05   46.2   2.2   21  280-302    29-49  (237)
288 PRK05973 replicative DNA helic  83.2    0.69 1.5E-05   47.9   2.0   21  280-302    62-82  (237)
289 PLN02772 guanylate kinase       83.2     1.8 3.9E-05   48.1   5.4   76  218-302    75-153 (398)
290 PRK10070 glycine betaine trans  83.2    0.71 1.5E-05   51.1   2.2   21  280-302    52-72  (400)
291 cd03231 ABC_CcmA_heme_exporter  83.2    0.78 1.7E-05   45.1   2.3   21  280-302    24-44  (201)
292 PRK15056 manganese/iron transp  83.2    0.77 1.7E-05   47.5   2.3   21  280-302    31-51  (272)
293 COG2884 FtsE Predicted ATPase   83.1    0.74 1.6E-05   46.9   2.1   21  280-302    26-46  (223)
294 TIGR03420 DnaA_homol_Hda DnaA   83.1    0.79 1.7E-05   45.2   2.3   20  282-303    38-57  (226)
295 TIGR03740 galliderm_ABC gallid  83.0     0.8 1.7E-05   45.6   2.3   21  280-302    24-44  (223)
296 cd03272 ABC_SMC3_euk Eukaryoti  83.0    0.79 1.7E-05   46.0   2.3   20  281-302    22-41  (243)
297 KOG1970|consensus               83.0    0.65 1.4E-05   53.4   1.9   38  262-303    92-129 (634)
298 cd02027 APSK Adenosine 5'-phos  82.9    0.61 1.3E-05   44.1   1.4   30  285-316     2-34  (149)
299 TIGR03797 NHPM_micro_ABC2 NHPM  82.9    0.73 1.6E-05   53.7   2.3   22  280-303   477-498 (686)
300 PF13481 AAA_25:  AAA domain; P  82.9    0.72 1.6E-05   44.3   1.9   21  280-302    30-50  (193)
301 COG1118 CysA ABC-type sulfate/  82.9    0.77 1.7E-05   49.6   2.3   21  280-302    26-46  (345)
302 PRK07429 phosphoribulokinase;   82.9    0.82 1.8E-05   49.4   2.5   21  282-302     6-26  (327)
303 TIGR03499 FlhF flagellar biosy  82.8    0.72 1.6E-05   48.4   2.0   36  281-318   193-233 (282)
304 PRK14255 phosphate ABC transpo  82.8    0.82 1.8E-05   46.3   2.4   22  280-303    29-50  (252)
305 PRK14265 phosphate ABC transpo  82.7     0.8 1.7E-05   47.5   2.3   22  280-303    44-65  (274)
306 PRK13640 cbiO cobalt transport  82.7    0.81 1.7E-05   47.7   2.3   22  280-303    31-52  (282)
307 PRK14248 phosphate ABC transpo  82.7    0.82 1.8E-05   47.0   2.3   21  280-302    45-65  (268)
308 cd03267 ABC_NatA_like Similar   82.6    0.82 1.8E-05   46.2   2.3   21  280-302    45-65  (236)
309 cd03220 ABC_KpsT_Wzt ABC_KpsT_  82.6    0.84 1.8E-05   45.8   2.4   22  280-303    46-67  (224)
310 PRK14236 phosphate transporter  82.6    0.81 1.7E-05   47.3   2.3   22  280-303    49-70  (272)
311 PRK14530 adenylate kinase; Pro  82.6    0.76 1.7E-05   45.8   2.0   45  581-625   161-211 (215)
312 COG1102 Cmk Cytidylate kinase   82.6    0.65 1.4E-05   46.1   1.5   17  287-303     3-19  (179)
313 TIGR00968 3a0106s01 sulfate AB  82.6    0.84 1.8E-05   46.1   2.3   21  280-302    24-44  (237)
314 PRK14253 phosphate ABC transpo  82.6    0.83 1.8E-05   46.2   2.3   22  280-303    27-48  (249)
315 TIGR01277 thiQ thiamine ABC tr  82.6    0.81 1.8E-05   45.3   2.2   22  280-303    22-43  (213)
316 PF00308 Bac_DnaA:  Bacterial d  82.6    0.52 1.1E-05   47.7   0.8   46  255-302     5-52  (219)
317 cd03253 ABCC_ATM1_transporter   82.6    0.85 1.8E-05   45.6   2.3   21  280-302    25-45  (236)
318 PRK09544 znuC high-affinity zi  82.6    0.84 1.8E-05   46.9   2.3   22  280-303    28-49  (251)
319 cd03213 ABCG_EPDR ABCG transpo  82.5    0.86 1.9E-05   44.7   2.3   21  280-302    33-53  (194)
320 cd03300 ABC_PotA_N PotA is an   82.5    0.87 1.9E-05   45.7   2.4   21  280-302    24-44  (232)
321 PRK11153 metN DL-methionine tr  82.4     0.8 1.7E-05   49.3   2.3   21  280-302    29-49  (343)
322 TIGR00635 ruvB Holliday juncti  82.4    0.72 1.6E-05   47.9   1.8   17  284-302    32-48  (305)
323 PRK14238 phosphate transporter  82.4    0.84 1.8E-05   47.2   2.3   22  280-303    48-69  (271)
324 cd03288 ABCC_SUR2 The SUR doma  82.4     1.2 2.6E-05   45.6   3.4   21  280-302    45-65  (257)
325 cd03236 ABC_RNaseL_inhibitor_d  82.4    0.87 1.9E-05   47.1   2.4   21  280-302    24-44  (255)
326 TIGR01192 chvA glucan exporter  82.3     0.9 1.9E-05   52.2   2.7   22  280-303   359-380 (585)
327 TIGR02857 CydD thiol reductant  82.3    0.81 1.8E-05   51.5   2.3   22  280-303   346-367 (529)
328 cd00984 DnaB_C DnaB helicase C  82.3    0.81 1.8E-05   45.8   2.1   21  280-302    11-31  (242)
329 PF03193 DUF258:  Protein of un  82.2    0.92   2E-05   44.5   2.4   19  282-302    35-53  (161)
330 PRK03695 vitamin B12-transport  82.2    0.89 1.9E-05   46.3   2.4   22  280-303    20-41  (248)
331 PRK11231 fecE iron-dicitrate t  82.2    0.88 1.9E-05   46.4   2.3   22  280-303    26-47  (255)
332 PRK13647 cbiO cobalt transport  82.1    0.89 1.9E-05   47.2   2.3   21  280-302    29-49  (274)
333 TIGR01242 26Sp45 26S proteasom  82.1     0.8 1.7E-05   49.4   2.1   25  275-303   151-175 (364)
334 PRK03992 proteasome-activating  82.0    0.83 1.8E-05   50.1   2.2   26  274-303   159-184 (389)
335 PRK14243 phosphate transporter  82.0    0.91   2E-05   46.7   2.4   22  280-303    34-55  (264)
336 PRK13657 cyclic beta-1,2-gluca  82.0    0.84 1.8E-05   52.2   2.3   22  280-303   359-380 (588)
337 cd02026 PRK Phosphoribulokinas  81.9    0.65 1.4E-05   48.7   1.3   15  288-302     3-17  (273)
338 PRK15134 microcin C ABC transp  81.9     1.2 2.6E-05   50.4   3.5   19  280-300    33-51  (529)
339 cd01131 PilT Pilus retraction   81.8    0.79 1.7E-05   45.4   1.8   16  285-302     4-19  (198)
340 PRK10522 multidrug transporter  81.7    0.86 1.9E-05   51.8   2.3   22  280-303   347-368 (547)
341 TIGR01193 bacteriocin_ABC ABC-  81.7    0.77 1.7E-05   53.8   1.9   22  280-303   498-519 (708)
342 TIGR02314 ABC_MetN D-methionin  81.7     0.9 1.9E-05   49.3   2.3   21  280-302    29-49  (343)
343 PRK10261 glutathione transport  81.6     1.2 2.6E-05   51.7   3.4   21  280-302   348-368 (623)
344 PRK14251 phosphate ABC transpo  81.6    0.94   2E-05   45.9   2.3   21  280-302    28-48  (251)
345 PRK14271 phosphate ABC transpo  81.6    0.93   2E-05   47.2   2.3   22  280-303    45-66  (276)
346 COG0563 Adk Adenylate kinase a  81.5    0.86 1.9E-05   45.0   1.9   17  284-302     2-18  (178)
347 cd03299 ABC_ModC_like Archeal   81.5    0.97 2.1E-05   45.6   2.3   22  280-303    23-44  (235)
348 TIGR03873 F420-0_ABC_ATP propo  81.5    0.94   2E-05   46.2   2.3   22  280-303    25-46  (256)
349 PRK03839 putative kinase; Prov  81.5    0.84 1.8E-05   43.9   1.8   17  285-303     3-19  (180)
350 PRK14270 phosphate ABC transpo  81.5    0.96 2.1E-05   45.9   2.3   21  280-302    28-48  (251)
351 PRK08903 DnaA regulatory inact  81.5    0.99 2.1E-05   45.0   2.3   20  282-303    42-61  (227)
352 PRK14275 phosphate ABC transpo  81.4    0.96 2.1E-05   47.3   2.3   21  280-302    63-83  (286)
353 TIGR01288 nodI ATP-binding ABC  81.3    0.97 2.1E-05   47.6   2.3   21  280-302    28-48  (303)
354 TIGR02982 heterocyst_DevA ABC   81.3       1 2.2E-05   44.8   2.4   21  280-302    29-49  (220)
355 smart00072 GuKc Guanylate kina  81.3    0.96 2.1E-05   44.0   2.1   19  282-302     2-20  (184)
356 PRK13650 cbiO cobalt transport  81.2    0.97 2.1E-05   47.0   2.3   21  280-302    31-51  (279)
357 KOG0635|consensus               81.2    0.94   2E-05   44.7   2.0   23  279-303    28-50  (207)
358 PRK14266 phosphate ABC transpo  81.2       1 2.2E-05   45.6   2.4   22  280-303    27-48  (250)
359 PRK14268 phosphate ABC transpo  81.2       1 2.2E-05   46.1   2.4   22  280-303    36-57  (258)
360 PRK14252 phosphate ABC transpo  81.1       1 2.2E-05   46.3   2.3   21  280-302    40-60  (265)
361 PRK13537 nodulation ABC transp  81.1     1.3 2.8E-05   46.9   3.2   21  280-302    31-51  (306)
362 PRK14235 phosphate transporter  81.1       1 2.2E-05   46.4   2.4   22  280-303    43-64  (267)
363 PRK14260 phosphate ABC transpo  81.1       1 2.2E-05   46.1   2.3   22  280-303    31-52  (259)
364 PF07728 AAA_5:  AAA domain (dy  81.1     0.8 1.7E-05   41.9   1.4   13  290-302     5-17  (139)
365 PRK14272 phosphate ABC transpo  81.0       1 2.3E-05   45.5   2.4   22  280-303    28-49  (252)
366 COG2274 SunT ABC-type bacterio  81.0    0.94   2E-05   53.8   2.3   22  280-303   497-518 (709)
367 PRK13646 cbiO cobalt transport  81.0       1 2.2E-05   47.1   2.3   21  280-302    31-51  (286)
368 PRK14269 phosphate ABC transpo  80.9       1 2.3E-05   45.6   2.3   21  280-302    26-46  (246)
369 PRK14254 phosphate ABC transpo  80.9       1 2.3E-05   47.1   2.4   21  280-302    63-83  (285)
370 TIGR01842 type_I_sec_PrtD type  80.8    0.98 2.1E-05   51.3   2.3   22  280-303   342-363 (544)
371 PRK13635 cbiO cobalt transport  80.7     1.1 2.3E-05   46.8   2.3   21  280-302    31-51  (279)
372 cd03217 ABC_FeS_Assembly ABC-t  80.7     1.1 2.4E-05   44.1   2.4   21  280-302    24-44  (200)
373 PRK14531 adenylate kinase; Pro  80.6    0.96 2.1E-05   44.0   1.9   17  284-302     4-20  (183)
374 PRK10790 putative multidrug tr  80.6       1 2.2E-05   51.6   2.3   22  280-303   365-386 (592)
375 PRK02496 adk adenylate kinase;  80.6    0.95 2.1E-05   43.7   1.8   17  285-303     4-20  (184)
376 PRK13636 cbiO cobalt transport  80.5     1.5 3.2E-05   45.8   3.4   22  280-303    30-51  (283)
377 PRK13631 cbiO cobalt transport  80.5     1.1 2.3E-05   48.0   2.3   22  280-303    50-71  (320)
378 PRK13637 cbiO cobalt transport  80.5     1.1 2.3E-05   47.0   2.3   21  280-302    31-51  (287)
379 TIGR00630 uvra excinuclease AB  80.5    0.99 2.1E-05   55.1   2.3   31  270-302     9-40  (924)
380 PF00625 Guanylate_kin:  Guanyl  80.4     1.1 2.4E-05   43.4   2.2   19  282-302     2-20  (183)
381 PTZ00454 26S protease regulato  80.4       1 2.2E-05   49.9   2.1   24  276-303   175-198 (398)
382 COG4178 ABC-type uncharacteriz  80.4       1 2.3E-05   52.4   2.3   21  280-302   417-437 (604)
383 PRK14722 flhF flagellar biosyn  80.4    0.99 2.2E-05   49.7   2.1   21  280-302   135-155 (374)
384 PRK05416 glmZ(sRNA)-inactivati  80.3     1.1 2.3E-05   47.7   2.2   20  282-303     6-25  (288)
385 TIGR03375 type_I_sec_LssB type  80.2       1 2.3E-05   52.6   2.3   22  280-303   489-510 (694)
386 TIGR03796 NHPM_micro_ABC1 NHPM  80.1       1 2.3E-05   52.7   2.3   22  280-303   503-524 (710)
387 PRK13643 cbiO cobalt transport  80.1     1.1 2.4E-05   46.9   2.2   22  280-303    30-51  (288)
388 PRK10789 putative multidrug tr  80.1     1.1 2.3E-05   51.4   2.3   22  280-303   339-360 (569)
389 PRK14245 phosphate ABC transpo  80.0     1.1 2.5E-05   45.3   2.3   22  280-303    27-48  (250)
390 PF00448 SRP54:  SRP54-type pro  80.0    0.99 2.1E-05   45.1   1.8   32  287-318     4-38  (196)
391 PRK13651 cobalt transporter AT  80.0     1.1 2.4E-05   47.5   2.2   21  280-302    31-51  (305)
392 COG0467 RAD55 RecA-superfamily  79.9     1.1 2.3E-05   46.0   2.0   21  280-302    21-41  (260)
393 PRK00698 tmk thymidylate kinas  79.9     1.1 2.3E-05   43.5   2.0   17  286-302     5-21  (205)
394 cd02029 PRK_like Phosphoribulo  79.9    0.91   2E-05   48.2   1.5   15  288-302     3-17  (277)
395 TIGR03269 met_CoM_red_A2 methy  79.9     1.1 2.4E-05   50.5   2.3   21  280-302    24-44  (520)
396 PF08423 Rad51:  Rad51;  InterP  79.9    0.95   2E-05   47.0   1.6   21  280-302    36-56  (256)
397 PRK14258 phosphate ABC transpo  79.8     1.2 2.6E-05   45.7   2.3   22  280-303    31-52  (261)
398 TIGR02204 MsbA_rel ABC transpo  79.8     1.1 2.4E-05   50.9   2.3   22  280-303   364-385 (576)
399 cd01124 KaiC KaiC is a circadi  79.7    0.92   2E-05   43.2   1.4   13  290-302     5-17  (187)
400 PRK10416 signal recognition pa  79.7     1.4   3E-05   47.4   2.9   37  281-319   113-152 (318)
401 PRK13634 cbiO cobalt transport  79.6     1.2 2.6E-05   46.7   2.3   21  280-302    31-51  (290)
402 COG4148 ModC ABC-type molybdat  79.6     1.5 3.3E-05   47.0   3.1   34  268-303    10-43  (352)
403 PF08477 Miro:  Miro-like prote  79.5     1.2 2.6E-05   39.1   2.0   16  285-302     2-17  (119)
404 TIGR00958 3a01208 Conjugate Tr  79.4     1.1 2.4E-05   52.7   2.3   22  280-303   505-526 (711)
405 PRK11160 cysteine/glutathione   79.4     1.2 2.5E-05   51.2   2.3   22  280-303   364-385 (574)
406 PRK13639 cbiO cobalt transport  79.3     1.2 2.7E-05   46.1   2.3   22  280-303    26-47  (275)
407 PF06414 Zeta_toxin:  Zeta toxi  79.3     1.2 2.7E-05   43.8   2.2   23  280-302    11-33  (199)
408 PRK06526 transposase; Provisio  79.3       1 2.3E-05   46.8   1.8   19  282-302    98-116 (254)
409 PRK00349 uvrA excinuclease ABC  79.3     1.1 2.5E-05   54.7   2.3   27  274-302    18-44  (943)
410 CHL00181 cbbX CbbX; Provisiona  79.2     1.3 2.9E-05   46.7   2.6   20  282-303    59-78  (287)
411 PRK09700 D-allose transporter   79.1     1.2 2.6E-05   50.2   2.2   21  280-302   287-307 (510)
412 COG4598 HisP ABC-type histidin  79.1     3.9 8.4E-05   41.7   5.5   51  280-334    30-84  (256)
413 PRK13633 cobalt transporter AT  79.1     1.3 2.8E-05   46.1   2.3   21  280-302    34-54  (280)
414 PRK05057 aroK shikimate kinase  79.0     1.3 2.8E-05   43.0   2.1   18  284-303     6-23  (172)
415 cd03278 ABC_SMC_barmotin Barmo  78.9     1.2 2.7E-05   44.1   2.0   19  281-302    22-40  (197)
416 PRK08727 hypothetical protein;  78.9     1.3 2.8E-05   45.0   2.3   18  283-302    42-59  (233)
417 PRK00080 ruvB Holliday junctio  78.8     1.2 2.7E-05   47.3   2.1   19  283-303    52-70  (328)
418 PRK13546 teichoic acids export  78.8     1.3 2.9E-05   45.9   2.4   22  280-303    48-69  (264)
419 PRK09700 D-allose transporter   78.7     1.3 2.7E-05   50.0   2.3   21  280-302    29-49  (510)
420 COG1122 CbiO ABC-type cobalt t  78.7     1.3 2.9E-05   45.6   2.3   22  280-303    28-49  (235)
421 COG1132 MdlB ABC-type multidru  78.7     1.1 2.4E-05   51.0   1.9   23  280-304   353-375 (567)
422 TIGR01359 UMP_CMP_kin_fam UMP-  78.7       1 2.2E-05   43.0   1.4   16  285-302     2-17  (183)
423 COG4988 CydD ABC-type transpor  78.7     1.3 2.7E-05   51.2   2.3   22  280-303   345-366 (559)
424 PF13173 AAA_14:  AAA domain     78.6     1.4   3E-05   40.3   2.1   19  282-302     2-20  (128)
425 PHA00729 NTP-binding motif con  78.6     1.4   3E-05   45.5   2.4   18  284-303    19-36  (226)
426 PRK10938 putative molybdenum t  78.5     1.3 2.8E-05   49.6   2.3   21  280-302    27-47  (490)
427 PF01695 IstB_IS21:  IstB-like   78.5     1.2 2.6E-05   43.8   1.8   20  282-303    47-66  (178)
428 PRK03731 aroL shikimate kinase  78.5     1.2 2.7E-05   42.2   1.8   18  284-303     4-21  (171)
429 TIGR02203 MsbA_lipidA lipid A   78.4     1.3 2.9E-05   50.1   2.4   22  280-303   356-377 (571)
430 PF06068 TIP49:  TIP49 C-termin  78.3     1.1 2.4E-05   49.5   1.7   60  566-626   321-381 (398)
431 PTZ00361 26 proteosome regulat  78.3     1.2 2.7E-05   49.9   2.1   25  275-303   212-236 (438)
432 PF03215 Rad17:  Rad17 cell cyc  78.3     1.2 2.6E-05   51.1   1.9   33  264-302    31-63  (519)
433 TIGR01194 cyc_pep_trnsptr cycl  78.2     1.3 2.8E-05   50.5   2.3   22  280-303   366-387 (555)
434 COG0542 clpA ATP-binding subun  78.2    0.89 1.9E-05   54.3   0.9   44  276-325   513-556 (786)
435 PRK13652 cbiO cobalt transport  78.1     1.4 3.1E-05   45.7   2.3   21  280-302    28-48  (277)
436 PRK10938 putative molybdenum t  78.1     1.4 2.9E-05   49.4   2.3   21  280-302   284-304 (490)
437 PRK14263 phosphate ABC transpo  78.1     1.4 3.1E-05   45.3   2.3   21  280-302    32-52  (261)
438 cd03279 ABC_sbcCD SbcCD and ot  78.1     1.4   3E-05   43.9   2.2   19  282-302    28-46  (213)
439 cd03297 ABC_ModC_molybdenum_tr  78.1     1.3 2.9E-05   43.7   2.0   19  283-303    24-42  (214)
440 COG0178 UvrA Excinuclease ATPa  78.0     1.4   3E-05   52.9   2.4   32  269-302    12-44  (935)
441 PRK13642 cbiO cobalt transport  78.0     1.4 3.1E-05   45.6   2.3   21  280-302    31-51  (277)
442 PRK13644 cbiO cobalt transport  77.8     1.4 3.1E-05   45.6   2.3   21  280-302    26-46  (274)
443 PRK04040 adenylate kinase; Pro  77.8     1.3 2.9E-05   43.8   1.9   16  285-302     5-20  (188)
444 PHA02530 pseT polynucleotide k  77.8     1.3 2.9E-05   45.9   2.0   13  290-302     8-20  (300)
445 TIGR02880 cbbX_cfxQ probable R  77.8     1.3 2.8E-05   46.6   1.9   18  282-301    58-75  (284)
446 TIGR03522 GldA_ABC_ATP gliding  77.7     1.4   3E-05   46.5   2.1   21  280-302    26-46  (301)
447 PRK13947 shikimate kinase; Pro  77.7     1.3 2.9E-05   41.8   1.8   17  285-303     4-20  (171)
448 PRK13641 cbiO cobalt transport  77.7     1.4 3.1E-05   45.9   2.2   21  280-302    31-51  (287)
449 PF13521 AAA_28:  AAA domain; P  77.6     1.1 2.4E-05   42.3   1.3   16  285-302     2-17  (163)
450 TIGR00017 cmk cytidylate kinas  77.5     1.3 2.9E-05   44.8   1.9   18  286-303     4-21  (217)
451 PRK11819 putative ABC transpor  77.4     1.5 3.2E-05   50.2   2.4   21  280-302    31-51  (556)
452 PRK10762 D-ribose transporter   77.4     1.4   3E-05   49.5   2.2   21  280-302    28-48  (501)
453 PF13086 AAA_11:  AAA domain; P  77.4     1.2 2.5E-05   43.1   1.4   17  284-302    19-35  (236)
454 TIGR03415 ABC_choXWV_ATP choli  77.3     1.5 3.2E-05   48.4   2.3   21  280-302    48-68  (382)
455 cd03291 ABCC_CFTR1 The CFTR su  77.1     1.6 3.4E-05   46.0   2.3   21  280-302    61-81  (282)
456 PRK14264 phosphate ABC transpo  77.1     1.6 3.4E-05   46.1   2.4   21  280-302    69-89  (305)
457 TIGR03269 met_CoM_red_A2 methy  77.1     1.5 3.3E-05   49.4   2.3   21  280-302   308-328 (520)
458 PRK12339 2-phosphoglycerate ki  77.1     1.1 2.4E-05   44.9   1.1   17  284-302     5-21  (197)
459 COG2255 RuvB Holliday junction  77.0     1.2 2.6E-05   47.9   1.4   19  283-303    53-71  (332)
460 PRK15064 ABC transporter ATP-b  77.0     1.5 3.4E-05   49.6   2.4   21  280-302    25-45  (530)
461 PRK15134 microcin C ABC transp  76.9     1.5 3.3E-05   49.6   2.3   21  280-302   310-330 (529)
462 TIGR02633 xylG D-xylose ABC tr  76.7     1.5 3.3E-05   49.1   2.2   21  280-302    25-45  (500)
463 PRK10261 glutathione transport  76.5     1.5 3.4E-05   50.9   2.3   22  280-303    40-61  (623)
464 PRK15439 autoinducer 2 ABC tra  76.5     1.6 3.4E-05   49.3   2.3   21  280-302    35-55  (510)
465 PRK08356 hypothetical protein;  76.4     1.6 3.5E-05   42.9   2.0   18  286-303     7-24  (195)
466 PRK13549 xylose transporter AT  76.4     1.5 3.2E-05   49.4   2.0   21  280-302    29-49  (506)
467 TIGR03015 pepcterm_ATPase puta  76.3     1.7 3.6E-05   44.0   2.2   17  284-302    45-61  (269)
468 PRK10982 galactose/methyl gala  76.3     1.6 3.5E-05   48.9   2.3   21  280-302    22-42  (491)
469 TIGR03880 KaiC_arch_3 KaiC dom  76.3     1.7 3.7E-05   43.4   2.2   21  280-302    14-34  (224)
470 PRK14532 adenylate kinase; Pro  76.2     1.5 3.3E-05   42.3   1.8   17  285-303     3-19  (188)
471 cd03273 ABC_SMC2_euk Eukaryoti  76.2     1.7 3.7E-05   44.3   2.2   17  284-302    27-43  (251)
472 cd04155 Arl3 Arl3 subfamily.    76.1     1.5 3.2E-05   41.0   1.6   16  287-302    17-32  (173)
473 PRK14257 phosphate ABC transpo  76.1     1.8 3.8E-05   46.6   2.4   21  280-302   106-126 (329)
474 PF04665 Pox_A32:  Poxvirus A32  76.0     1.4 3.1E-05   45.9   1.6   19  437-455   130-148 (241)
475 PRK13975 thymidylate kinase; P  76.0     1.6 3.5E-05   42.2   1.9   17  287-303     5-21  (196)
476 PRK01184 hypothetical protein;  76.0     1.6 3.4E-05   42.1   1.8   14  290-303     7-20  (184)
477 PRK06921 hypothetical protein;  75.9     1.7 3.6E-05   45.5   2.1   21  281-303   116-136 (266)
478 PRK06761 hypothetical protein;  75.7     1.6 3.5E-05   46.3   2.0   31  492-522   159-189 (282)
479 TIGR01241 FtsH_fam ATP-depende  75.7     1.7 3.7E-05   49.1   2.3   24  276-303    84-107 (495)
480 PRK09536 btuD corrinoid ABC tr  75.6     2.4 5.3E-05   47.0   3.4   36  280-318    27-66  (402)
481 PRK05703 flhF flagellar biosyn  75.5     1.7 3.6E-05   48.6   2.1   35  282-318   221-260 (424)
482 PRK15064 ABC transporter ATP-b  75.5     1.8 3.9E-05   49.0   2.4   21  280-302   343-363 (530)
483 PRK04182 cytidylate kinase; Pr  75.5     1.6 3.6E-05   41.1   1.8   17  287-303     3-19  (180)
484 cd01428 ADK Adenylate kinase (  75.4     1.4 3.1E-05   42.2   1.4   26  582-607   153-178 (194)
485 TIGR02640 gas_vesic_GvpN gas v  75.3     1.6 3.5E-05   45.2   1.8   20  282-303    21-40  (262)
486 PRK08181 transposase; Validate  75.2     1.6 3.5E-05   45.9   1.8   20  282-303   106-125 (269)
487 COG3840 ThiQ ABC-type thiamine  75.2     1.9 4.2E-05   43.9   2.2   22  280-303    23-44  (231)
488 PRK13342 recombination factor   75.1     1.7 3.7E-05   47.9   2.0   18  284-303    38-55  (413)
489 PRK11147 ABC transporter ATPas  75.1     1.8   4E-05   50.3   2.4   21  280-302    27-47  (635)
490 PRK00091 miaA tRNA delta(2)-is  75.0     1.7 3.7E-05   46.6   1.9   17  286-302     6-22  (307)
491 PRK11288 araG L-arabinose tran  75.0     1.8 3.8E-05   48.8   2.1   21  280-302   277-297 (501)
492 cd01125 repA Hexameric Replica  74.8     1.6 3.6E-05   44.1   1.7   19  282-302     1-19  (239)
493 PRK13477 bifunctional pantoate  74.6     1.6 3.6E-05   49.9   1.8   18  286-303   286-303 (512)
494 TIGR03719 ABC_ABC_ChvD ATP-bin  74.6     1.9 4.2E-05   49.1   2.4   21  280-302    29-49  (552)
495 PRK04296 thymidine kinase; Pro  74.6     1.6 3.5E-05   43.0   1.5   19  282-302     2-20  (190)
496 PRK12402 replication factor C   74.5     1.6 3.5E-05   45.6   1.6   17  284-302    38-54  (337)
497 PLN03025 replication factor C   74.5     1.9   4E-05   45.8   2.1   18  284-303    36-53  (319)
498 TIGR02239 recomb_RAD51 DNA rep  74.4     1.8 3.9E-05   46.5   1.9   21  280-302    94-114 (316)
499 PRK10982 galactose/methyl gala  74.3     1.8   4E-05   48.4   2.1   21  280-302   272-292 (491)
500 COG0194 Gmk Guanylate kinase [  74.3       2 4.3E-05   43.4   2.0   20  281-302     3-22  (191)

No 1  
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=6.4e-215  Score=1733.19  Aligned_cols=590  Identities=57%  Similarity=1.029  Sum_probs=577.7

Q ss_pred             cccCHHHHHHHHHHhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCcccccc--CCCCcEEEeeCCCcccccCCCEEEEcCC
Q psy13077         27 SAISPKLKSFIDNCVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVP--KYENCWLARTNPADVARVESKTFICTQE  104 (630)
Q Consensus        27 ~~~~~~~~~~v~~~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~--~~~g~~l~~t~p~d~aR~~~~tfIv~~~  104 (630)
                      ...|++|++||+|+++||+|++|||||||+||+++|+++|+++|++++|+  +++|||++||+|.||||+|++||||+++
T Consensus         7 ~~~n~~l~~wv~e~~~l~~Pd~v~~cdGS~ee~~~l~~~~v~~G~~~~L~~~k~~~~~~~rsdp~DvARve~rTfI~s~~   86 (601)
T PRK04210          7 PTKNPKLLEWVAEVAELTQPDRVVWCDGSEEEYDRLRDQAVEAGTEIKLNPEKRPNSFLARSDPSDVARVEDRTFICSEK   86 (601)
T ss_pred             CcCCHHHHHHHHHHHHhhCCCEEEEeCCCHHHHHHHHHHHHHcCCEeeccCCCCCceeeccCChhhhhhcccceEEecCc
Confidence            35689999999999999999999999999999999999999999999995  7999999999999999999999999999


Q ss_pred             CcccCcCCCCCccCCCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHHHhhhhhcccCC
Q psy13077        105 KAETVPDTKPGVKGTLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVGSMRIMTRIG  184 (630)
Q Consensus       105 ~~d~gp~~~~gi~~~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv~l~m~im~R~~  184 (630)
                      ++|+||+         ||||+|++|+++|.++|+|||+||||||+||||||+|||++++|||||||||||||||||||++
T Consensus        87 ~~dagp~---------nnw~~p~e~~~~l~~lf~G~M~GRTMyVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~imtR~g  157 (601)
T PRK04210         87 EEDAGPT---------NNWMDPAEMRETLKGLFKGCMRGRTMYVVPFSMGPLGSPFAKIGVEITDSPYVVHSMRIMTRMG  157 (601)
T ss_pred             hhhcCCc---------cCcCCHHHHHHHHHHhcCCccCCCeEEEeeeeeCCCCCCcccceEEeeCCHHHHHhHHHHHhcc
Confidence            9999999         6999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHhhhcCCCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhc
Q psy13077        185 TPVLNLLDADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKR  264 (630)
Q Consensus       185 ~~~l~~~~~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~  264 (630)
                      +++|+.++++++|||||||+|.|++.++.+++||||++ ++|+|+|++|+|||+|||||||||||||||||||||++|++
T Consensus       158 ~~~l~~l~~~~~Fv~~vHSvG~p~~~~~~~v~wpcn~~-r~i~h~pe~~~I~S~gSgYgGNaLLGkKc~ALRiAs~~ar~  236 (601)
T PRK04210        158 KAVLDVLGEDGEFVPCVHSVGAPLEPGQKDVPWPCNDT-KYIVHFPETREIWSYGSGYGGNALLGKKCFALRIASVMARD  236 (601)
T ss_pred             HHHHHhhCCCCceeeeeccCCCCCCCCCCCCCCCCCCC-eEEEEeCCCcEEEEecCCCCCCccchhHHHHHHHHHHHhHh
Confidence            99999999877999999999999999988999999977 79999999999999999999999999999999999999999


Q ss_pred             cCcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEecc
Q psy13077        265 EGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGVAP  344 (630)
Q Consensus       265 eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk~~  344 (630)
                      ||||||||+|+||++|+|+++||+|||||||||||||||.|++|||||++|||||||||+++||+|||||||+|||||+|
T Consensus       237 eGWLAEHMlIlgvt~P~G~~~yvaaAFPSaCGKTnlAMl~p~~~gwkv~~VGDDIAwm~~~~dG~l~AiNPE~GfFGVap  316 (601)
T PRK04210        237 EGWLAEHMLILGVTSPEGRKTYFAAAFPSACGKTNLAMLIPPIPGWKVETVGDDIAWIRPGEDGRLYAINPEAGFFGVAP  316 (601)
T ss_pred             cccHHHhhHHheeeCCCCCEEEEEEecccccccccHhhcCCCCCCceeEEeecceeeeeECCCCcEEEEccCCCeeEeCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcHHHHhhccC-CceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCC
Q psy13077        345 GTSNKTNPIAMKTVFK-NTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTI  423 (630)
Q Consensus       345 g~s~~~~P~i~~ai~~-~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~  423 (630)
                      |||+++||+||++|++ |+|||||++|+||+|||||+++++|  .+++||+|++|+|+++.|+||||||||+|++|||++
T Consensus       317 Gtn~~tnP~am~~l~~~n~IFTNValt~DG~vwWeG~~~~~P--~~~~dw~G~~W~p~~~~paaHPNsRFt~p~~q~p~i  394 (601)
T PRK04210        317 GTNEKTNPNAMATLKPGNVIFTNVALTDDGDVWWEGMTEEPP--AHLIDWQGNDWTPGSGEPAAHPNARFTVPASQCPNL  394 (601)
T ss_pred             CCCCCcCHHHHHhcccCCeEEeeeEECCCCCeecCCCCCCCC--CcccccCCCcCCCCCCCCCCCCccceeccHHHCCcC
Confidence            9999999999999987 9999999999999999999999877  678999999999999999999999999999999999


Q ss_pred             CCCCcCCCCcccceEEEeccCCCCCCceEeecCccceeeccccccchhhhhhcccCceeccCCccCCCCCCCChHHHHHH
Q psy13077        424 DPNWESHEGVPISAIIFGGRRPQGVPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYLKH  503 (630)
Q Consensus       424 ~~~~e~p~GvPi~aIiFg~rd~~glPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a~~PF~~y~~g~Y~~~  503 (630)
                      +|+||+|+|||||||||||||++++|||+|+++||||||+||||.||+|||++|++|++++|||||+|||+||+|+|++|
T Consensus       395 dp~wedP~GVpIsaiiFGGRr~~t~PlV~ea~~W~hGV~~GAtm~SE~TAAa~G~~g~~r~dPmAmlpF~gy~~gdY~~h  474 (601)
T PRK04210        395 DPEWEDPAGVPISAIIFGGRRSDTVPLVTEAFDWQHGVYMGATMGSETTAAAEGKVGVVRRDPMAMLPFCGYNMGDYFQH  474 (601)
T ss_pred             CccccCCCCCEEEEEEECCcCCCCCCeeEEccCccchheeecchhhHHHHHHhccCCcEeeCcchhccccCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCcccccCCCCCcCCCCCC-chhh
Q psy13077        504 WLSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASPIGYIPKPEALITTNLA-SDVD  582 (630)
Q Consensus       504 wl~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp~G~iP~~~~l~~~Gl~-~~~~  582 (630)
                      ||+||++++++.||||+|||||||++|+|||||||+|+|||+||++|++ |++++++||+|+||++++||+.|++ ++.+
T Consensus       475 wl~~g~~~~~~~PkIF~VNwFrkd~~G~flWPGfgeN~RVL~Wi~~R~~-G~~~a~eTpiG~iP~~~dL~~~gl~~~~~~  553 (601)
T PRK04210        475 WLDFGKKLGSKLPKIFGVNWFRKDEDGKFLWPGFGENMRVLKWIVDRVE-GEADAVETPIGYLPKYEDLDLLGLDYSEED  553 (601)
T ss_pred             HHHHhcccCCCCCcEEEeeeeeecCCCCCcCCCCcchhHHHHHHHHhhc-CccCceecCCeecCCcccCCCcCCCCCHHH
Confidence            9999999866999999999999999999999999999999999999999 9999999999999999999999997 8899


Q ss_pred             hHhhhcCCHHHHHHHHHHHHHHHHHhhCCCccHHHHHHHHHHHHHhhC
Q psy13077        583 LEELFSFDKSFWEQEVQDLQRYFNEQLGADLPTAIQAEIDALKQRIKQ  630 (630)
Q Consensus       583 ~~~~~~~d~~~w~~e~~~l~~~f~~~~~~~lP~ei~~~l~~~~~rl~~  630 (630)
                      +.++|++|+++|++|+++++++|. ++|++||++|+++|++|++||++
T Consensus       554 ~~~lf~v~~~~w~~e~~~~~~~~~-~~~~~lP~~l~~~l~~l~~rl~~  600 (601)
T PRK04210        554 YEKLFSVDVDEWLAELELIEELFE-KFGDRLPKELFEELEALKKRLLA  600 (601)
T ss_pred             HHHHhCCCHHHHHHHHHHHHHHHH-HhcCCCCHHHHHHHHHHHHHHhh
Confidence            999999999999999999999997 68999999999999999999964


No 2  
>PF00821 PEPCK:  Phosphoenolpyruvate carboxykinase;  InterPro: IPR008209  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents GTP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004611 phosphoenolpyruvate carboxykinase activity, 0005525 GTP binding, 0006094 gluconeogenesis; PDB: 2FAH_A 2FAF_A 2QZY_B 2ZCI_D 3MOE_A 3DT7_B 2RKD_A 2RKA_A 2RK8_A 2QF2_B ....
Probab=100.00  E-value=1.7e-215  Score=1742.46  Aligned_cols=583  Identities=63%  Similarity=1.139  Sum_probs=494.4

Q ss_pred             HHHHHHhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCccccc--cCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCC
Q psy13077         35 SFIDNCVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPV--PKYENCWLARTNPADVARVESKTFICTQEKAETVPDT  112 (630)
Q Consensus        35 ~~v~~~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L--~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~  112 (630)
                      +||+|+++||+|++|||||||+||+++|+++++++|++++|  .+++|||+|||+|.||||+|++||||+++++|+||+ 
T Consensus         1 ~fV~e~a~l~~P~~I~icdGS~eE~~~l~~~~~~~G~~~~L~~~~~~n~~l~~sdp~DvARve~~TfI~t~~~~d~~p~-   79 (586)
T PF00821_consen    1 EFVAEVAELCQPDSIYICDGSEEENDRLRDELVEQGEEIPLNPPKHPNCYLHRSDPSDVARVESRTFICTEDKEDAGPT-   79 (586)
T ss_dssp             HHHHHHHHHH-BSEEEE----HHHHHHHHHHHHHTTSEEEE-TTTSBSEEEE---TTSSS--GGGEEEE-SSHHHHSTT-
T ss_pred             CHHHHHHHhcCCCEEEEcCCCHHHHHHHHHHHHHcCCEEeCCCCCCCCcEEEecCccccceecCceEEEcCCccccCCc-
Confidence            69999999999999999999999999999999999999999  689999999999999999999999999999999999 


Q ss_pred             CCCccCCCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHHHhhhhhcccCChHHhhhcC
Q psy13077        113 KPGVKGTLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVGSMRIMTRIGTPVLNLLD  192 (630)
Q Consensus       113 ~~gi~~~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv~l~m~im~R~~~~~l~~~~  192 (630)
                              ||||+|++|+++|.++|+|||+||||||+||||||+|||++++||||||||||||||+||||+++++|+.++
T Consensus        80 --------~nw~~~~~~~~~l~~~f~G~M~GRtMyVipfsmGP~gsp~s~~gVqlTDS~YVv~sm~imtR~g~~v~~~l~  151 (586)
T PF00821_consen   80 --------NNWMDPEEMKAELDELFPGCMKGRTMYVIPFSMGPIGSPFSKIGVQLTDSPYVVHSMRIMTRMGYAVLDRLG  151 (586)
T ss_dssp             --------SSEE-HHHHHHHHHCCSTTTTTTSEEEEEEEEESSTTSTT-EEEEEEES-HHHHHHHHHHSEESHHHHHHHT
T ss_pred             --------cCCCCHHHHHHHHHHhchhhhhhchHHhhHhhhCCCCCCCccceEEccCcHHHHHhHHHHHhcCHHHHHHhC
Confidence                    699999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccc
Q psy13077        193 ADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHM  272 (630)
Q Consensus       193 ~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm  272 (630)
                      .+++|||||||+|+|+++++.+++||||+++++|+|+|++|+|||+||||||||||+||||||||||++|++||||||||
T Consensus       152 ~~~~Fv~~vHSvG~pl~~~~~~~~wpcn~~~~~I~h~p~~~~I~S~gsgYGGNaLlgKKc~aLRiAs~~ar~eGWLAEHM  231 (586)
T PF00821_consen  152 DDGEFVRCVHSVGAPLPPGQKDVNWPCNPDKRYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVIARDEGWLAEHM  231 (586)
T ss_dssp             TT--SEEEEEE-S--SSTSS--BTB---GGG-EEEEECCCTEEEEES--SHHHHSTCCCCCCCHHHHHHHHHHT-EEESE
T ss_pred             CCCceEeeecccCCcCCCCCCCCCCCCCccceEEEEECCCCeEEEeCCCcCcchhhhhhhhhHHHHHHHHHhhhHHhhhh
Confidence            88899999999999999999888999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEeccCCCCCCcH
Q psy13077        273 LILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGVAPGTSNKTNP  352 (630)
Q Consensus       273 ~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P  352 (630)
                      +|+||+||+|+++||+|||||||||||||||.|++|||||+|||||||||||+.||+|||||||+||||++||||+++||
T Consensus       232 lIlgit~P~G~~~yiaaAFPSaCGKTnlAMl~p~~pGwkve~VGDDIAWmr~~~dG~lrAiNPE~GfFGVapGtn~~tnP  311 (586)
T PF00821_consen  232 LILGITNPEGRKTYIAAAFPSACGKTNLAMLQPTLPGWKVETVGDDIAWMRFGEDGRLRAINPENGFFGVAPGTNMKTNP  311 (586)
T ss_dssp             EEEEEE-TTS-EEEEEEE-TTTSSHHHHHT---SSTT-EEEEEESS-EEEEE-TTSBEEEE---SEEEEE-TT-STTT-H
T ss_pred             heeeEecCCCCEEEEEEecCcccccccHHhcCCCCCCcEEEEeeccchheeEcCCCcEEEeecccceEEeccCCCCCCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhccCCceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCC
Q psy13077        353 IAMKTVFKNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEG  432 (630)
Q Consensus       353 ~i~~ai~~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~G  432 (630)
                      ++|++|.+|||||||++|+||+|||+|+++++|.  +++||+|+.|+++++.||||||||||+|++|||+++|+||+|+|
T Consensus       312 ~am~~l~~ntIFTNVa~t~dG~vwWeG~~~~~p~--~~~dw~G~~W~~~~~~paaHPNsRft~pa~qcp~i~p~wedp~G  389 (586)
T PF00821_consen  312 NAMATLGKNTIFTNVALTDDGDVWWEGMDEEPPE--HLIDWQGEPWTPESGEPAAHPNSRFTAPASQCPNIDPEWEDPKG  389 (586)
T ss_dssp             HHHHHTTBSEEEES-EEETTS-EE-TT-SS---T---EE-TTSSEE-TTSSS-SS-TT-EEEEEGGGSTTB-TTTT-TT-
T ss_pred             HHHHHhhccceEeeeeecCCCceeeccCCCCCCc--ccccCCCCcCCCCCCCCCCCCcccccCCHhHCCCCCccccCCCc
Confidence            9999999999999999999999999999999885  78999999999999999999999999999999999999999999


Q ss_pred             cccceEEEeccCCCCCCceEeecCccceeeccccccchhhhhhcccCceeccCCccCCCCCCCChHHHHHHHHHHHHhhc
Q psy13077        433 VPISAIIFGGRRPQGVPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYLKHWLSMEQRTN  512 (630)
Q Consensus       433 vPi~aIiFg~rd~~glPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a~~PF~~y~~g~Y~~~wl~lg~~~~  512 (630)
                      ||||||||||||++|+|||+|+++||||||+||||+||+|||++|++|+++||||||+|||+||+|+|++|||+|++++.
T Consensus       390 VpIsaiiFGGRr~~tvPlV~ea~~W~HGV~~gAtm~SE~TAAa~g~~g~~~~dPmAmlpF~gy~~gdY~~hwL~~~~~~~  469 (586)
T PF00821_consen  390 VPISAIIFGGRRSDTVPLVYEAFNWQHGVFLGATMRSEATAAAEGKVGVVRRDPMAMLPFCGYNMGDYLQHWLSMGKKLG  469 (586)
T ss_dssp             EEEEEEEEEEBBSSSS-SEEE-SSHHHHHHHHHT-EEEE-TTSSS-TTEEEE-GGGTTTT-SS-HHHHHHHHHHHGGSTT
T ss_pred             ceEEEEEEeccCCCCCCceEEccCCCceeEEeeeecccccchhccCCCceecCCccccccCcCCHHHHHHHHHHhhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             cCCCcEEEEeeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCcccccCCCCCcCCCCCC-chhhhHhhhcCCH
Q psy13077        513 AKLPKVFHVNWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASPIGYIPKPEALITTNLA-SDVDLEELFSFDK  591 (630)
Q Consensus       513 ~~~pkif~VN~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp~G~iP~~~~l~~~Gl~-~~~~~~~~~~~d~  591 (630)
                      +++||||+|||||||++|+|||||||+|+|||+||++|++ |++.+++||||+||++++||+.||+ ++++++++|++|+
T Consensus       470 ~k~PkIF~VNwFrk~~~G~flWPGfgen~RVL~Wi~~R~~-g~~~a~~TPiG~iP~~~dL~~~gl~~~~~~~~~lfsv~~  548 (586)
T PF00821_consen  470 RKLPKIFHVNWFRKDEDGKFLWPGFGENSRVLKWIERRVE-GEVEAVETPIGYIPKYEDLDLDGLDLSKEDYEELFSVDK  548 (586)
T ss_dssp             GBS-EEEEEEST-B-TTSSBSS--GGGHHHHHHHHHHHHT-TSS-EEEETTEEEE-TTTS--TTSSSTTCTHHHHT---H
T ss_pred             cCCCcEEEEEeeEEcCCCccccCCCcccHHHHHHHHHHhc-CccceeeCCCEecCCccccCCccCCCCHHHHHHhcCcCH
Confidence            7999999999999999999999999999999999999999 9999999999999999999999996 6789999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhCCCccHHHHHHHHHHHHHhhC
Q psy13077        592 SFWEQEVQDLQRYFNEQLGADLPTAIQAEIDALKQRIKQ  630 (630)
Q Consensus       592 ~~w~~e~~~l~~~f~~~~~~~lP~ei~~~l~~~~~rl~~  630 (630)
                      ++|++|+++++++|.+ +|++||++|.++|++|++||++
T Consensus       549 ~~W~~E~~~~~~~~~~-~g~~lP~~l~~~l~~l~~rl~~  586 (586)
T PF00821_consen  549 DFWLAEIEEIREYFDK-FGDDLPKELFEELEELEKRLKK  586 (586)
T ss_dssp             HHHHHHHHHHHHHHHH-HGGGS-HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHH-hcCCCCHHHHHHHHHHHHHhhC
Confidence            9999999999999985 5999999999999999999975


No 3  
>KOG3749|consensus
Probab=100.00  E-value=4.6e-213  Score=1666.13  Aligned_cols=614  Identities=69%  Similarity=1.248  Sum_probs=604.5

Q ss_pred             ceecceeeecccccccCHHHHHHHHHHhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccc
Q psy13077         14 QEIRKFSLKHGYVSAISPKLKSFIDNCVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVAR   93 (630)
Q Consensus        14 ~~~~~~~~~~g~~~~~~~~~~~~v~~~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR   93 (630)
                      ..++++||+||||..|+++|++||+++++||||+.|||||||++|+++|++.++++|...+|.+|+||||+||||.||||
T Consensus        25 ~~~~~vpv~kGd~~~L~~~V~~Fv~~~~eL~qP~~i~ICdGSe~E~~~l~~~l~e~g~~~~l~~ydn~~L~rtdp~DVar  104 (640)
T KOG3749|consen   25 PNIGQVPVLKGDLDSLPPAVRTFVEECAELCQPDGIHICDGSEFENQELLDALEEEGGLRPLPKYDNCWLARTDPRDVAR  104 (640)
T ss_pred             cccCcceeeecccccCCHHHHHHHHHHHHhcCcceeEecCCcHHHHHHHHHHHHHhcCcccchhhhcceeecCChhhhhe
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCEEEEcCCCcccCcCCCCCccCCCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHH
Q psy13077         94 VESKTFICTQEKAETVPDTKPGVKGTLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYV  173 (630)
Q Consensus        94 ~~~~tfIv~~~~~d~gp~~~~gi~~~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv  173 (630)
                      +|++||||+++++|..|++.+|+.+.++||||++.|+.++.+||+|||+||||||+||||||+|||.|++||||||||||
T Consensus       105 VeskT~i~t~~~~dtv~~~~eGv~~~lg~wms~~df~~~~~~rFpgcM~GRtMYVvPFSMGpvGsplskiGiqlTDspyv  184 (640)
T KOG3749|consen  105 VESKTVIVTSSKRDTVPGPPEGVEGQLGHWMSEEDFDFAVDERFPGCMKGRTMYVVPFSMGPVGSPLSKIGIQLTDSPYV  184 (640)
T ss_pred             eccceEEeccccccccCCCcccccccccccCCHHHHHHHHhhcCCccccCceEEEEeeccCCCCCcchhceeEecCCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhcccCChHHhhhcCCCCCceEEEEecCCCCCCCCc-CCCCCCCCcceEEEEcCCCCeEEEEccccccccccccce
Q psy13077        174 VGSMRIMTRIGTPVLNLLDADQPFVKALHSVGTPVSGKHE-FPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKC  252 (630)
Q Consensus       174 ~l~m~im~R~~~~~l~~~~~~~~Fv~~~hs~g~p~~~~~~-~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~  252 (630)
                      |+|||||||++..+|+.++++ ||||||||+|.|++-.++ .++||||||+++|+|.|++|+|||+|||||||+||||||
T Consensus       185 V~smRimtR~g~~Vl~~l~~~-dFvrClHSVG~Prp~~~~~v~~wpcnPe~t~i~hkp~e~EI~s~GsgyGgnsllGkKc  263 (640)
T KOG3749|consen  185 VLSMRIMTRMGTPVLDALGDG-DFVRCLHSVGMPRPGQQKIVNPWPCNPERTLIAHKPDEREIWSFGSGYGGNSLLGKKC  263 (640)
T ss_pred             eeehhHHHHhccHHHHHhccc-chhhhhhhcCCCCCcccCCCCCCCCCcceeEEeecCccceeeeeccCCCCCccccchh
Confidence            999999999999999999987 799999999999998777 667999999999999999999999999999999999999


Q ss_pred             eehhhhhhhhhccCcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEE
Q psy13077        253 FALRIGSTIAKREGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRA  332 (630)
Q Consensus       253 ~alrias~~a~~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a  332 (630)
                      |||||||.|+++||||||||+|+|||+|+|+++|++|||||+||||||||+.|++|||||+||||||||||||.||+|||
T Consensus       264 FalriaS~iak~eGWLAEhmlIlgITnP~g~k~~iaaafpSacgktnLam~~p~lPGwKV~cVgddiaWmkf~~dG~l~a  343 (640)
T KOG3749|consen  264 FALRIASRLAKDEGWLAEHMLILGITNPKGEKKYIAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDADGRLRA  343 (640)
T ss_pred             hhhhhhhhhhhhhhhHHHhHHHhcccCCCCCceEEEEecccccccchHhhcCCCCCCceEEEeccceeEEEecCCCeEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCCeeEeccCCCCCCcHHHHhhccCCceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcc
Q psy13077        333 INPENGFFGVAPGTSNKTNPIAMKTVFKNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSR  412 (630)
Q Consensus       333 ~NpE~G~fgk~~g~s~~~~P~i~~ai~~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsR  412 (630)
                      ||||+||||++||||.++||++|+++++|||||||+.|.||.+||||++++++.++.+++|.|+.|+++++.||||||||
T Consensus       344 inPEngffgvapgts~~tnP~am~t~~~ntIftnvaeTsDg~~~weg~e~~l~~~v~it~wlgk~w~~~~~~~aahPnsr  423 (640)
T KOG3749|consen  344 INPENGFFGVAPGTSEKTNPNAMATIQKNTIFTNVAETSDGGVYWEGIEKPLAPGVTITSWLGKPWSIGDGEPAAHPNSR  423 (640)
T ss_pred             ecccccccccCCCcccccCHHHHHHHHhccceeeeeeccCCceeeccccccccCCceeecccCCcccCCCCCcCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCCCCCCCCCcCCCCcccceEEEeccCCCCCCceEeecCccceeeccccccchhhhhhcccCceeccCCccCCCC
Q psy13077        413 FCTPASQCPTIDPNWESHEGVPISAIIFGGRRPQGVPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFAMRPF  492 (630)
Q Consensus       413 ft~P~~~~pn~~~~~e~p~GvPi~aIiFg~rd~~glPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a~~PF  492 (630)
                      ||+|++|||+++|.||+|.|||||||||||||+.|+|+|+|+++|+||||+||.|+||+|||++.+.++++||||||+||
T Consensus       424 f~~pa~Qcpii~p~Wesp~GVPI~AiiFggRRp~gvPLvyEa~~WehGVfvga~mrseataaae~~gkiimhdP~amrpf  503 (640)
T KOG3749|consen  424 FCAPASQCPIIDPAWESPEGVPISAIIFGGRRPAGVPLVYEANSWEHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPF  503 (640)
T ss_pred             ccCchhhCCCcCccccCCCCCceeEEEecCCCCCCCceEEEccccccceeeeehhhhhhhHHHHhcCceEeeCchhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCChHHHHHHHHHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCcccccCCCCCc
Q psy13077        493 FGYNFGDYLKHWLSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASPIGYIPKPEAL  572 (630)
Q Consensus       493 ~~y~~g~Y~~~wl~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp~G~iP~~~~l  572 (630)
                      |+||+|+|++|||+|+++...+.||||||||||++.+|||||||||+|+|||+||++|+. |+..+++||||++|+.++|
T Consensus       504 ~gynfgkYl~HWL~m~~~~~~~~PkIFhvNwfrk~~~gKfLWPGfgeN~RVlewI~rR~~-ge~~~~~t~iG~vp~~~~l  582 (640)
T KOG3749|consen  504 FGYNFGKYLEHWLSMGQRPKAKLPKIFHVNWFRKDKEGKFLWPGFGENARVLEWIFRRVA-GEDSAKETPIGLVPKEGAL  582 (640)
T ss_pred             ccCcHHHHHHHHHHhccCCCCCCCcEEEeeeeeeccCCCccCCCCcchhHHHHHHHHHhc-cchhcccccccccccCCce
Confidence            999999999999999999878999999999999999999999999999999999999998 8999999999999999999


Q ss_pred             CCCCCCchhhhHhhhcCCHHHHHHHHHHHHHHHHHhhCCCccHHHHHHHHHHHHHhhC
Q psy13077        573 ITTNLASDVDLEELFSFDKSFWEQEVQDLQRYFNEQLGADLPTAIQAEIDALKQRIKQ  630 (630)
Q Consensus       573 ~~~Gl~~~~~~~~~~~~d~~~w~~e~~~l~~~f~~~~~~~lP~ei~~~l~~~~~rl~~  630 (630)
                      ||+|+. .+++.++|++++++|.+|+++||+||++|+|.+||++|.++|++|++|+.+
T Consensus       583 nL~gl~-~id~~~L~svpkdfW~qev~~ir~y~~~Qv~~dLP~~i~~el~~L~~rv~~  639 (640)
T KOG3749|consen  583 NLSGLG-NIDLAELFSVPKDFWEQEVNDIRKYLEEQVGADLPPEIDAELDALEARVHQ  639 (640)
T ss_pred             ecccCC-ccCHHHHhCCCHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhhc
Confidence            999998 699999999999999999999999999999999999999999999999864


No 4  
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the GTP-dependent group.
Probab=100.00  E-value=6.6e-211  Score=1699.20  Aligned_cols=575  Identities=63%  Similarity=1.130  Sum_probs=560.6

Q ss_pred             HHHHHHHHhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCC
Q psy13077         33 LKSFIDNCVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDT  112 (630)
Q Consensus        33 ~~~~v~~~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~  112 (630)
                      |++||+|+++||||++|||||||+||+++|+++|+++|++++|+.++|||+|||+|.||||+|++||||+++++|+||+ 
T Consensus         1 l~~~v~e~~~l~~Pd~v~~cdGS~ee~~~l~~~~v~~G~~~~L~~~~~~~l~rs~p~DvARve~rTfI~s~~~~dagp~-   79 (579)
T cd00819           1 LLEWVEEAAELCQPDSVYICDGSEEEYDRLRDLMVEQGEEIRLNKYPNSYLARSDPSDVARVESRTFICSEDEEDAGPT-   79 (579)
T ss_pred             CHHHHHHHHHhcCCCEEEEcCCCHHHHHHHHHHHHhcCcEeeCCCCCCCEEEeCCccccceeccceEEecCchhccCCc-
Confidence            5789999999999999999999999999999999999999999877999999999999999999999999999999999 


Q ss_pred             CCCccCCCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHHHhhhhhcccCChHHhhhcC
Q psy13077        113 KPGVKGTLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVGSMRIMTRIGTPVLNLLD  192 (630)
Q Consensus       113 ~~gi~~~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv~l~m~im~R~~~~~l~~~~  192 (630)
                              ||||+|++|+++|.++|+|||+||||||+||||||+|||++++|||||||||||||||||||++.++|+.++
T Consensus        80 --------nnw~~p~e~~~~l~~lf~G~M~GRTMYVipfsmGP~gSp~s~~gVqiTDS~YVv~sm~imtR~g~~vl~~lg  151 (579)
T cd00819          80 --------NNWMDPEEMKAELKELFKGCMRGRTMYVIPFSMGPLGSPISKIGVELTDSPYVVHSMRIMTRMGKAVLDALG  151 (579)
T ss_pred             --------cccCCHHHHHHHHHhhCCcccCCCeEEEEeeecCCCCCCcccceEEEeCCHHHHHhHHHHHhcCHHHHHhcC
Confidence                    699999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccc
Q psy13077        193 ADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHM  272 (630)
Q Consensus       193 ~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm  272 (630)
                      + ++|||||||+|.|+..++++ +||||+++++|+|+|++++|||+||||||||||+||||||||||++|++||||||||
T Consensus       152 ~-~~Fv~~vHSvG~pl~~~~~~-~wpcn~~~~~I~h~pe~~~I~S~gSgYGGNaLlgKKcfaLRiAs~~ar~eGWLAEHM  229 (579)
T cd00819         152 E-GEFVPCLHSVGAPLSAGQKD-VWPCNPEKKYIVHFPEEREIWSFGSGYGGNALLGKKCFALRIASVMARDEGWLAEHM  229 (579)
T ss_pred             c-CCeeeeeccCCCcCCCCCCC-CCCCCCCccEEEEEcCCCeEEEecCCcCCCcccchhHHHHHHHHHHhHhcCcHHHhh
Confidence            7 59999999999999998876 999999989999999999999999999999999999999999999999999999999


Q ss_pred             hhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEeccCCCCCCcH
Q psy13077        273 LILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGVAPGTSNKTNP  352 (630)
Q Consensus       273 ~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P  352 (630)
                      +|+||++|+|+++||+|||||||||||||||.|++||||++||||||||||+++||+|||||||+|||||+||||.++||
T Consensus       230 lIlgvt~P~G~~~yvaaAFPSaCGKTnlAMl~p~~~gwkv~~vGDDIAwm~~~~dG~l~AINPE~GfFGVapGtn~~tnP  309 (579)
T cd00819         230 LILGVTNPEGEKKYFAAAFPSACGKTNLAMLIPPLPGWKVETVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTNAKTNP  309 (579)
T ss_pred             HHheeeCCCCCEEEEEEEcccccccccHhhcCCCCCCceeEEeccceeeeEECCCCcEEEEcCCCCeeEeCCCCCCCcCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhccCCceeEcceEcCCCceeccCCccCCCCCccccccC--CCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCC
Q psy13077        353 IAMKTVFKNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWH--NKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESH  430 (630)
Q Consensus       353 ~i~~ai~~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~--g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p  430 (630)
                      ++|++|++|||||||++|+||+|||||+++++|  .+++||+  |+.|+++++.||||||||||+|++|||+++|+||+|
T Consensus       310 ~am~~l~~n~IFTNVa~t~DG~vwWeG~~~e~p--~~~~~w~~~G~~w~~~~~~paAHPNsRFt~p~~q~p~idp~wedP  387 (579)
T cd00819         310 NAMATLHKNTIFTNVALTEDGDVWWEGLTEEPP--EHLTDWQGLGKRWTPGDGEPAAHPNSRFTAPASQCPNIDPEWENP  387 (579)
T ss_pred             HHHHHhcCCceEEEEeEcCCCCeeCCCCCCCCC--CceeeccCCCCCCCCCCCCcCCCCcccccccHHHCCcCCccccCC
Confidence            999999999999999999999999999999887  5789999  999999999999999999999999999999999999


Q ss_pred             CCcccceEEEeccCCCCCCceEeecCccceeeccccccchhhhhhcccCceeccCCccCCCCCCCChHHHHHHHHHHHHh
Q psy13077        431 EGVPISAIIFGGRRPQGVPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYLKHWLSMEQR  510 (630)
Q Consensus       431 ~GvPi~aIiFg~rd~~glPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a~~PF~~y~~g~Y~~~wl~lg~~  510 (630)
                      +|||||||||||||++++|||+|+++|+||||+||||.||+|||++|++|+++||||||+|||+||+|+|++|||+||++
T Consensus       388 ~GVpI~aiiFGGRr~~tvPlV~ea~~W~hGV~~GA~m~SE~TAAa~g~~g~~r~dPmAmlPF~gy~~gdY~~hwL~~g~~  467 (579)
T cd00819         388 EGVPIDAIIFGGRRPDTVPLVYEAFNWNHGVFIGASMGSETTAAAEGKVGVVRRDPFAMLPFCGYNMGDYFRHWLSFGRK  467 (579)
T ss_pred             CCCEEEEEEECCcCCCCCCeEEEccCcccceeeechhhhHHHHHhhcCCCcEEeCcccccccCCCCHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCcEEEEeeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCcccccCCCCCcCCCCCC-chhhhHhhhcC
Q psy13077        511 TNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASPIGYIPKPEALITTNLA-SDVDLEELFSF  589 (630)
Q Consensus       511 ~~~~~pkif~VN~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp~G~iP~~~~l~~~Gl~-~~~~~~~~~~~  589 (630)
                      ++++.||||+|||||||++|+|||||||||+|||+||++|++ |++.+++||||+||++++||++||+ +..++  ++.+
T Consensus       468 ~~~~~PkIF~VNwFrkd~~G~flwpgfgdn~rvL~Wi~~R~~-g~~~a~eTpiG~iP~~~~ldl~gL~~~~~~~--l~~~  544 (579)
T cd00819         468 LGAKLPKIFGVNWFRKDEDGKFLWPGFGENSRVLKWIFRRVE-GKANAIETPIGYIPKYGDLDLKGLGKSKLDF--LFSV  544 (579)
T ss_pred             ccCCCCcEEEEeeeeecCCCCCcCCCccchhhHHHHHHHHhc-CCcCceecCCeecCCccccCccCCCCchhhh--hcCC
Confidence            867999999999999999999999999999999999999999 9999999999999999999999997 44444  9999


Q ss_pred             CHHHHHHHHHHHHHHHHHhhCC-CccHHHHHHHHHH
Q psy13077        590 DKSFWEQEVQDLQRYFNEQLGA-DLPTAIQAEIDAL  624 (630)
Q Consensus       590 d~~~w~~e~~~l~~~f~~~~~~-~lP~ei~~~l~~~  624 (630)
                      |+++|++|+.+++++|+ ++++ +||++|.++|++|
T Consensus       545 ~~~~w~~e~~~i~~~~~-~~~~~~lP~~l~~~l~~l  579 (579)
T cd00819         545 DEDYWLQELIEIEEYLE-KIGRADLPQELFDELEAL  579 (579)
T ss_pred             CHHHHHHHHHHHHHHHH-HhCCCCCCHHHHHHHhcC
Confidence            99999999999999997 5677 9999999999875


No 5  
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]
Probab=100.00  E-value=8.5e-209  Score=1643.24  Aligned_cols=599  Identities=55%  Similarity=1.003  Sum_probs=583.4

Q ss_pred             ceeeecccccccCHHHHHHHHHHhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCcccccc--CCCCcEEEeeCCCcccccC
Q psy13077         18 KFSLKHGYVSAISPKLKSFIDNCVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVP--KYENCWLARTNPADVARVE   95 (630)
Q Consensus        18 ~~~~~~g~~~~~~~~~~~~v~~~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~--~~~g~~l~~t~p~d~aR~~   95 (630)
                      .++-+..+-...|+.+++||+|+++||+|++||+||||+||+++|+++|++.|++++|+  +++||||+||+|.||||+|
T Consensus         5 ~~~~l~~~~~i~n~~l~~wi~ev~~l~~P~~V~~cdGS~eE~~~l~~~~v~aG~~i~Ln~~~~pn~~l~~s~psDvAR~e   84 (608)
T COG1274           5 PIDGLDKLAPINNQGLKSWIEEVAELTEPDDVVVCDGSPEEYDYLCWKMVEAGEEIKLNPEKHPNSYLARSNPSDVARVE   84 (608)
T ss_pred             cccccccccccccHHHHHHHHHHHHhcCCCeEEEeCCCHHHHHHHHHHHHhcCceeecCcccCCCceEeecChhhhhhhh
Confidence            44555566678999999999999999999999999999999999999999999999997  7999999999999999999


Q ss_pred             CCEEEEcCCCcccCcCCCCCccCCCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHHHh
Q psy13077         96 SKTFICTQEKAETVPDTKPGVKGTLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVG  175 (630)
Q Consensus        96 ~~tfIv~~~~~d~gp~~~~gi~~~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv~l  175 (630)
                      ++||||++++.++||+         ||||+|+++++++.++|+|||+||||||+||||||++||++++||||||||||||
T Consensus        85 ~rTfI~s~~~~~agPt---------nNw~~p~e~~~~m~~l~~G~MrGrtmyVvpf~mGP~~Spf~~~gVeiTDS~YVv~  155 (608)
T COG1274          85 ERTFICSPKEEDAGPT---------NNWMDPQEMRSEMNELFRGCMRGRTMYVVPFCMGPLNSPFTILGVELTDSPYVVH  155 (608)
T ss_pred             hceeeecccccccCCc---------cCCCCHHHHHHHHHHHHHhhhcCceEEEEeeeeCCCCCCcccceeEeecCceeee
Confidence            9999999999999999         6999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcccCChHHhhhcCCCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeeh
Q psy13077        176 SMRIMTRIGTPVLNLLDADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFAL  255 (630)
Q Consensus       176 ~m~im~R~~~~~l~~~~~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~al  255 (630)
                      ||+|||||+.++++.+++++.|+|||||+|.|+.+|+++++||||.- .+|.|+|++++|||+||||||||||+|||+||
T Consensus       156 sm~imtRmG~~vl~~lG~~g~Fvk~vHSvG~pL~pg~~dv~wPcn~~-k~i~hfped~~v~S~gsgYGGNall~KKC~AL  234 (608)
T COG1274         156 SMRIMTRMGKEVLEKLGDDGNFVKCVHSVGKPLDPGQKDVAWPCNET-KYIRHFPEDREVWSFGSGYGGNALLGKKCLAL  234 (608)
T ss_pred             ehHHHHHHHHHHHHhcCCCCceeeeeeccCCCCCCCcccCcCCcccc-cceeecCCCcceEeecCCccchhhhhhhHHHH
Confidence            99999999999999999988899999999999999999999999955 69999999999999999999999999999999


Q ss_pred             hhhhhhhhccCcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEecc
Q psy13077        256 RIGSTIAKREGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINP  335 (630)
Q Consensus       256 rias~~a~~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~Np  335 (630)
                      ||||++|++||||||||+|++|++|+|+++||+|||||||||||||||.|++||||++|||||||||||..||+|||+||
T Consensus       235 Rias~~A~~EGWLAEHMlil~v~~PeGk~~yftaAFPSacGKTnlAMi~p~~pGWk~~~igDDIawik~~~DG~lyAvNP  314 (608)
T COG1274         235 RIASVMARDEGWLAEHMLILGVTNPEGKKYYFTAAFPSACGKTNLAMIPPTIPGWKAETIGDDIAWIKFGKDGRLYAVNP  314 (608)
T ss_pred             HHHHHHhhhhhhHhhhheeeEecCCCCceEEEEeecccccCccchhhcCCCCCCcceeeccCceeeeeccCCCceEeecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeeEeccCCCCCCcHHHHhhcc-CCceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCC-CCCCCCCCCcce
Q psy13077        336 ENGFFGVAPGTSNKTNPIAMKTVF-KNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKS-DGTQAAHPNSRF  413 (630)
Q Consensus       336 E~G~fgk~~g~s~~~~P~i~~ai~-~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~-~~~~~aHpNsRf  413 (630)
                      |.|||||+||||.++||+||++|+ .|+|||||++|+||+|||||++.++|  .+++||+|+.|+++ .++|||||||||
T Consensus       315 E~GfFGVapGtn~~tnpnam~tl~~~n~IFTNV~lT~DGdvwWEG~~~~~p--~~l~dw~G~~w~~~~~g~paAHpNsRf  392 (608)
T COG1274         315 EIGFFGVAPGTNEKTNPNAMATLHSGNTIFTNVALTDDGDVWWEGLEGEPP--EELIDWKGNDWRPGETGEPAAHPNSRF  392 (608)
T ss_pred             ccceEEeecCCCccCChhHHHHhccCceEEeeeeecCCCCccccCCCCCCc--cccccCCCCccCCCCCCCCCCCCCccc
Confidence            999999999999999999999998 89999999999999999999999877  57899999999995 488999999999


Q ss_pred             eecCCCCCCCCCCCcCCCCcccceEEEeccCCCCCCceEeecCccceeeccccccchhhhhhcccCceeccCCccCCCCC
Q psy13077        414 CTPASQCPTIDPNWESHEGVPISAIIFGGRRPQGVPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFAMRPFF  493 (630)
Q Consensus       414 t~P~~~~pn~~~~~e~p~GvPi~aIiFg~rd~~glPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a~~PF~  493 (630)
                      |+|++|||+++|+|++|.|||||||||||||++++|||+|+++|+|||+|||+|.||+|||++|++|+++||||||+|||
T Consensus       393 t~pl~~~P~ld~ew~dP~GVpi~aiiFGgRr~~TvPlV~EA~~W~HGV~mGA~m~Se~TAA~~Gk~G~lr~dPmAmLpF~  472 (608)
T COG1274         393 TVPLSQCPNLDPEWDDPEGVPIDAIIFGGRRPTTVPLVTEAFDWEHGVFMGATMGSETTAAAEGKVGVLRRDPMAMLPFC  472 (608)
T ss_pred             ccchhhCCccCccccCCCCceEeeEEecCcCCcccCceeeecccccceeeeeccccchhhhhhccccceecCcchhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHHHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCcccccCCCCCcC
Q psy13077        494 GYNFGDYLKHWLSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASPIGYIPKPEALI  573 (630)
Q Consensus       494 ~y~~g~Y~~~wl~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp~G~iP~~~~l~  573 (630)
                      +||+++|++|||+||+|++++.||||.|||||+|++|+|||||||||+|||+||++|++ |.+.+++||||+||++|+||
T Consensus       473 gyn~~dYf~hwl~~G~k~~~k~PKIF~VNwFrr~e~G~Flwpgf~en~rvL~Wi~~R~e-~~~~a~eTpIG~iP~~edL~  551 (608)
T COG1274         473 GYNMGDYFRHWLEFGRKLRDKLPKIFGVNWFRRGEDGRFLWPGFGENSRVLKWIVDRIE-GDANAIETPIGYIPKYEDLN  551 (608)
T ss_pred             cccHHHHHHHHHHHHHhhhccCCcEEEEEeEEEcCCCcEeCCCcccchhhhhhHHHHhc-cccCccccccccccchhhcc
Confidence            99999999999999999988999999999999999999999999999999999999999 99999999999999999999


Q ss_pred             CCCCC-chhhhHhhhcCCHHHHHHHHHHHHHHHHHhhCCCccHHHHHHHHHHHHHhhC
Q psy13077        574 TTNLA-SDVDLEELFSFDKSFWEQEVQDLQRYFNEQLGADLPTAIQAEIDALKQRIKQ  630 (630)
Q Consensus       574 ~~Gl~-~~~~~~~~~~~d~~~w~~e~~~l~~~f~~~~~~~lP~ei~~~l~~~~~rl~~  630 (630)
                      +.||+ +..+++++|.+|.+.|++|+++++++|. +||+++|++|++||+++++||.+
T Consensus       552 ~~Gld~s~ed~~~~f~id~~~w~~e~~~I~e~~~-~~g~~iP~~l~~e~~~~k~Rl~~  608 (608)
T COG1274         552 LDGLDYSKEDVEKLFTIDAEGWLAEIERIWEYYS-FFGNKIPEELLDELEALKERLGK  608 (608)
T ss_pred             cccccCCHHHHHHHhCcCHHHHHHHHHHHHHHHH-HhcccCcHHHHHHHHHHHHHhcC
Confidence            99999 8899999999999999999999999996 79999999999999999999974


No 6  
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).
Probab=100.00  E-value=2.1e-125  Score=1035.11  Aligned_cols=493  Identities=43%  Similarity=0.658  Sum_probs=436.2

Q ss_pred             CcEEEeCCCHHHHHHHHHHHHHC-CccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccCCCCCcCC
Q psy13077         47 SDVHICDGSEREYKELIDLMVKD-KTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKGTLGNWIS  125 (630)
Q Consensus        47 ~~I~~~~gs~ee~~~L~~~~~~~-Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~~~n~~~~  125 (630)
                      +.||||+..    ++|+++|+++ ||++.+   +|++|+++++.||||||+|||||+++.++.++.-++ -|+..|+||+
T Consensus         1 ~~v~~n~~~----~~L~e~~~~~~g~~~~~---~~g~l~~~tg~~tgRsp~dkfIv~~~~~~~~~~w~~-~w~~~N~~~~   72 (515)
T cd01919           1 DHIHINDEN----GRLLQQMLEEYGILRLT---KNGALAVTDPRDTGRSPSDKVIVTQDQRRTVPIPKT-GLSQLNRWLS   72 (515)
T ss_pred             CceEECCCH----HHHHHHHHHhcCCEEEC---CCceEEECCCCccccCCCceEEeCCCccccCccccc-cccccCCCCC
Confidence            469999955    5599999999 987744   688899999999999999999999999864442101 0235699999


Q ss_pred             HHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceEEccchHHHhhhhhcccCCh-HHhhhcCCCCCceEEEEec
Q psy13077        126 PQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVGSMRIMTRIGT-PVLNLLDADQPFVKALHSV  204 (630)
Q Consensus       126 ~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~iTdsayv~l~m~im~R~~~-~~l~~~~~~~~Fv~~~hs~  204 (630)
                      +++|++.+...|.++|+||+|||+|++||| +++.++.+++|||+|||+|||++|+|++. ++|+.+++  .|+.|+||+
T Consensus        73 ~~~~~~~~~~~~~~~m~gr~myV~d~~~G~-~~~~~~~~r~it~~ay~~lf~~~m~~~p~~~~l~~~~~--p~~~ii~~~  149 (515)
T cd01919          73 EEDFEKAFNARFPGLMKGRTLFVVDFFMGP-GSPLRLIVRELTDSPYVAAFMRIMTIMPTDEELAAFGD--PDVKCLNSV  149 (515)
T ss_pred             HHHHHHHHHHHHHHHhcCCCEEEEeceECC-CCcccccEEEEEChHHHHHHHHHhccCCChHHHhhCCC--CCEEEEeCC
Confidence            999997555558899999999999999999 77777777779999999999999997777 89999864  355599999


Q ss_pred             CCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhccccCCCCCE
Q psy13077        205 GTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPEGQK  284 (630)
Q Consensus       205 g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~gv~~p~G~~  284 (630)
                      |.|+++.+    |||++++++|+|||++|+|||+||+|+||   +|||+ ||+|+++++++|||+|||+++++  ++|+.
T Consensus       150 g~~~~~~~----w~g~~s~~~I~~~~~~~~i~i~Gt~Y~Ge---~KK~~-l~~~~~l~~~~g~L~~H~s~~~~--~~g~~  219 (515)
T cd01919         150 GCPLPLQK----WPGLPSLTLVAHNPDRREQIIFGTGYGGE---MKKGF-LRMMSRLAPEEGWLAMHMSANVG--TNGDV  219 (515)
T ss_pred             CCcCCccC----CCCCCCCcEEEEEcccCEEEEecCccccc---hHHHH-HHHHHHHHHhcCceeeeceeecc--CCCCE
Confidence            99988754    88876668999999999999999999998   99998 99999999999999999998754  46776


Q ss_pred             EEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHHhhccCCcee
Q psy13077        285 KYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAMKTVFKNTIF  364 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~~ai~~~tIf  364 (630)
                      +.||  ||||||||||||+      |++++||||++|++  ++|   +||||+|||||++|||+++||+||+||++|+||
T Consensus       220 ~~~~--GlSGtGKTTLa~~------~~~~ligDD~~~w~--~~g---v~N~EgGcyak~~gls~e~eP~i~~ai~~~ail  286 (515)
T cd01919         220 LVFF--GLSGTGKTTLSMD------PKRELIGDDEHWWK--DDG---VFNPEGGCYAKAIGLSVKTEPNIYKAIRKNAIF  286 (515)
T ss_pred             EEEE--ecccCCCcccccC------CCcCeecccEEEEe--CCC---EEecCCceEEEecCCCcccCHHHHHHhcCCcEE
Confidence            6666  9999999999993      56999999998764  688   799999999999999999999999999999999


Q ss_pred             EcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCCcccceEEEeccC
Q psy13077        365 TNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEGVPISAIIFGGRR  444 (630)
Q Consensus       365 ~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~GvPi~aIiFg~rd  444 (630)
                      |||++|+||+|||+|++                         +|||||||||+++|||++++|++  |+||++|||||||
T Consensus       287 eNV~~d~~g~v~~~~~s-------------------------~t~NtR~~yP~~~i~n~~~~~~~--g~~~~~IiFltrd  339 (515)
T cd01919         287 ENVAETSDGGIDFEDIS-------------------------AHPNTRVCYPASHIPIIDAAWES--AGHIEGVIFLTRD  339 (515)
T ss_pred             EeeeEcCCCCEeCCCCC-------------------------CCchheEEeEHHhCCCCCCcccc--CCCccEEEEEecC
Confidence            99999999999999852                         46899999999999999999887  8888999999999


Q ss_pred             CCC-CCceEeecCccceeeccccccchhhhh--hcccCceeccCCccCCCCCCCChHHHHHHHHHHHHhhccCCCcEEEE
Q psy13077        445 PQG-VPLVYESFDWQHGVFLGASMRSEATAA--AEHKGKVIMHDPFAMRPFFGYNFGDYLKHWLSMEQRTNAKLPKVFHV  521 (630)
Q Consensus       445 ~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa--~~g~~g~~~~dP~a~~PF~~y~~g~Y~~~wl~lg~~~~~~~pkif~V  521 (630)
                      ++| ||||++|+ |+||+|.++|..|+.||+  +.+++++++|+||+|+|||+|||++|++||++++++   +.|+||+|
T Consensus       340 a~gvlPpV~~lt-~eqavy~f~sg~T~ktAgteag~~~p~~~fs~cf~~PFl~~~p~~Ya~~l~e~~~~---~~~~i~lv  415 (515)
T cd01919         340 AFGVVPPVYRLT-WQQGVFVFAAGRTAATAGTEAGHKGKIPMFSPCFGRPFLGYHFTKYLEHLLSMMQH---PLPKIFLV  415 (515)
T ss_pred             CCCCCCcEEEcc-HHHHHHHHHhhhhhhhcchhcccccCceeecccccCCcccCCHHHHHHHHHHHHhh---cCCcEEEE
Confidence            997 89999999 777777666666667776  444677888999999999999999999999966554   79999999


Q ss_pred             eeeeeCCCCCcccCCCcchhHHHHHHHHhHhcCccceecCc-ccc-cCCCCCcCCCCCCchhhhHhhhcCCHHHHHHHHH
Q psy13077        522 NWFRKGSQGEFLWPGFGENIRVLDWILRRVENNKEIAEASP-IGY-IPKPEALITTNLASDVDLEELFSFDKSFWEQEVQ  599 (630)
Q Consensus       522 N~F~~g~~G~flWpG~G~n~RvL~wi~~r~~~G~~~~~~tp-~G~-iP~~~~l~~~Gl~~~~~~~~~~~~d~~~w~~e~~  599 (630)
                      |||++|.+|+++||+++++.|||+||+++.+ ++++++++| ||+ ||++    |+|+|.+++.|+.+|.+++.|+++++
T Consensus       416 Ntg~~gg~G~g~r~~~~~tr~il~~i~~g~~-~~~~~~~~pif~~~iP~~----~~gv~~~~l~p~~~w~~~~~~~~~~~  490 (515)
T cd01919         416 NTGRKGKEGKFKRPGFGETRAIIDAIFNGIL-DKAETKLTPIFNLYIPKA----LNLVGLGHLNPRNMMELFSQSKEFWD  490 (515)
T ss_pred             eccccCCCCCcccCCHHHHHHHHHHHHhCCc-CCCCeEEccccCEEeCcc----cCCCCcccCCHHHhhhhhhhhHHHHH
Confidence            9999998899999999999999999999999 899999999 666 9997    99999999999999999999999999


Q ss_pred             HHHHHHHHhh
Q psy13077        600 DLQRYFNEQL  609 (630)
Q Consensus       600 ~l~~~f~~~~  609 (630)
                      +|++.|+++|
T Consensus       491 ~l~~~f~~nf  500 (515)
T cd01919         491 KLVEDFEKYF  500 (515)
T ss_pred             HHHHHHHHHH
Confidence            9999888755


No 7  
>PLN02597 phosphoenolpyruvate carboxykinase [ATP]
Probab=100.00  E-value=5.2e-106  Score=873.87  Aligned_cols=489  Identities=18%  Similarity=0.195  Sum_probs=438.8

Q ss_pred             hhhcCCCcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC-C
Q psy13077         41 VELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG-T  119 (630)
Q Consensus        41 ~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~-~  119 (630)
                      ....++..||+|+..++    |+++|++++|+. +....|++++.|+.+ |||||+|+|||.++..      ++.||| .
T Consensus        27 ~~~~~~~~v~~nl~~~~----Lye~Al~~~eG~-l~~~~GaL~v~TGk~-TGRSP~DKfIV~d~~t------~~~iwWg~   94 (555)
T PLN02597         27 DSGLKFTHVLYNLSPAE----LYEQAIKYEKGS-FITSTGALATLSGAK-TGRSPKDKRVVRDETT------EDELWWGK   94 (555)
T ss_pred             cccCCcceEEeCCCHHH----HHHHHHHhCCCe-EEecCCCEEecCCCc-CCCCcccceecCCCCc------ccceeccC
Confidence            34567889999999977    999999999987 443589977766666 9999999999988774      456666 2


Q ss_pred             --CCCcCCHHHHHHHHHhhhhhhcCCCe-EEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhc-CC
Q psy13077        120 --LGNWISPQDYEEAIMQRFPGCMKGRT-MYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLL-DA  193 (630)
Q Consensus       120 --~n~~~~~~~~~~~L~~~~~g~m~Grt-myV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~-~~  193 (630)
                        .|++++++.|+ .|++++..++++|+ +||++.++|+  +|.+++.|| ||+.|||+|+|+.|+ |+..++++.+ .+
T Consensus        95 g~vN~p~~~~~f~-~l~~~~~~~l~~~~~lfv~D~~~Ga--d~~~r~~vRvite~aw~alF~~nmfirP~~~el~~f~~P  171 (555)
T PLN02597         95 GSPNIEMDEETFL-VNRERAVDYLNSLDKVFVNDQFLNW--DPENRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTP  171 (555)
T ss_pred             CccCccCCHHHHH-HHHHHHHHHHccCCCEEEEeeeecc--CccceeeEEEEeCHHHHHHHHHhcCCCCChHHhccCCCC
Confidence              69999999999 59999999999876 9999999999  999999999 899999999999999 9999999998 56


Q ss_pred             CCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccch
Q psy13077        194 DQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHML  273 (630)
Q Consensus       194 ~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~  273 (630)
                        ||+ ++|+++.+.++.. +   +++|+ ++|++|+++++++|+||.|+||   +||++ |++|+++++++|+|+|||+
T Consensus       172 --dft-Ii~ap~f~a~~~~-~---g~~Se-~~i~in~~~~~~lI~GT~YaGE---~KK~i-Fs~~~~ll~~rg~l~mHas  239 (555)
T PLN02597        172 --DFT-IYNAGQFPCNRYT-H---YMTSS-TSIDLNLKRKEMVILGTQYAGE---MKKGL-FSLMHYLMPMRGILSLHSG  239 (555)
T ss_pred             --CEE-EEeCCCCCCCccc-c---CCCCC-cEEEEEccCCeEEEEccchhhh---hHHHH-HHHHHHHHHHCCcEeecCe
Confidence              899 9999998765422 3   67999 7999999999999999999999   99998 9999999999999999999


Q ss_pred             hccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcH
Q psy13077        274 ILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNP  352 (630)
Q Consensus       274 i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P  352 (630)
                      .+  .+.+|+++.||  |+|||||||||+ +|   +  +.+||||+ +|   +++|   +||+|+|||+|+++||+|+||
T Consensus       240 aN--v~~~g~~~lff--GlSGtGKTTLsa-d~---~--~~li~DDEHgW---~~~G---VfNfEGGCYAK~i~Ls~e~EP  303 (555)
T PLN02597        240 CN--MGKDGDVALFF--GLSGTGKTTLST-DP---N--RYLIGDDEHCW---SDNG---VSNIEGGCYAKCIDLSEEKEP  303 (555)
T ss_pred             ec--cCCCCcEEEEE--ecCCCCccceec-CC---C--Cceeecccccc---cCCc---eEeecCceEEEecCCCcccch
Confidence            42  35789999999  999999999998 55   6  79999996 99   9999   599999999999999999999


Q ss_pred             HHHhhccCCceeEcceEcCCCc-eeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCC
Q psy13077        353 IAMKTVFKNTIFTNVASTSDGG-VYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHE  431 (630)
Q Consensus       353 ~i~~ai~~~tIf~NV~~~~dg~-v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~  431 (630)
                      +||+||++|+|+|||+++++++ |+|++                .+.|+         |+|++||+++|||++.+  +.+
T Consensus       304 eI~~Ai~fgavLENVv~d~~~~~~df~D----------------~s~Te---------NtR~aYPi~~I~na~~p--~~~  356 (555)
T PLN02597        304 DIWNAIKFGTVLENVVFDEHTREVDYSD----------------KSVTE---------NTRASYPIEYIPNAKIP--CVG  356 (555)
T ss_pred             HHHHhcCCCceEEeeEECCCCCccCCcC----------------Ccccc---------cceEEeEHHhccccCCC--ccC
Confidence            9999999999999999998755 46655                46684         99999999999999875  899


Q ss_pred             CcccceEEEeccCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHHH
Q psy13077        432 GVPISAIIFGGRRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKHW  504 (630)
Q Consensus       432 GvPi~aIiFg~rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~w  504 (630)
                      |+| ++|||||||++| ||||++|++.|++|||    .|+|||+++||+.++ .+|.+      ++|||++||++|+++ 
T Consensus       357 ~hP-~~IifLT~DAfGVlPPvskLt~eQA~yhF----lsGyTakvAGTE~Gv-~ep~~tFS~CFG~PFl~l~P~~Ya~~-  429 (555)
T PLN02597        357 PHP-KNVILLACDAFGVLPPVSKLTLAQTMYHF----ISGYTALVAGTEDGI-KEPTATFSACFGAAFIMLHPTKYAAM-  429 (555)
T ss_pred             CCC-CEEEEEeccccCCCCccccCCHHHHHHHH----HhcceeccccccCCC-CCCcccchhccCCCCcCCCHHHHHHH-
Confidence            999 899999999999 8999999999999999    999999999996666 58876      899999999999999 


Q ss_pred             HHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCcc---ceecCc-ccc-cCCCCCcCCC
Q psy13077        505 LSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKE---IAEASP-IGY-IPKPEALITT  575 (630)
Q Consensus       505 l~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~---~~~~tp-~G~-iP~~~~l~~~  575 (630)
                        |++|+.++..+||+||   |||+|+    .||++.|| |++   |++++++|++   .+...| ||| ||++    |+
T Consensus       430 --L~eki~~~~~~vyLvN---TGw~GG----~yg~G~Ri~l~~TRaiv~ail~G~l~~~~~~~~p~Fgl~iP~~----~~  496 (555)
T PLN02597        430 --LAEKMQKHGATAWLVN---TGWSGG----SYGVGKRMSLAYTRKIIDAIHSGSLLNAEYVKTPIFGLEVPTE----IE  496 (555)
T ss_pred             --HHHHHHHcCCCEEEEe---cCccCC----CCCCcceechHHHHHHHHHHhcCCccCCcceECCccCcccccc----CC
Confidence              7799999999999999   999988    79999999 987   9999999996   677778 999 9999    99


Q ss_pred             CCCchhhhHhhhcCCHHHHHHHHHHHHHHHHHh---hC-------CCccHHHHH
Q psy13077        576 NLASDVDLEELFSFDKSFWEQEVQDLQRYFNEQ---LG-------ADLPTAIQA  619 (630)
Q Consensus       576 Gl~~~~~~~~~~~~d~~~w~~e~~~l~~~f~~~---~~-------~~lP~ei~~  619 (630)
                      |||++++.|+.+|.|+++|++++++|++.|.++   |.       ..+++++.+
T Consensus       497 gVp~~iL~Pr~~w~d~~~yd~~a~~La~~F~~Nf~kf~~~~~~~~~~~~~~v~~  550 (555)
T PLN02597        497 GVPSEILDPENTWSDKKAYDETLNKLAGLFKKNFEVFADYKIGVDGKLTEEILA  550 (555)
T ss_pred             CCChhhcChhhcCCCHHHHHHHHHHHHHHHHHHHHHhcccccccccccCHHHHh
Confidence            999999999999999999999999999999884   42       345676654


No 8  
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]
Probab=100.00  E-value=1.1e-106  Score=857.89  Aligned_cols=472  Identities=20%  Similarity=0.290  Sum_probs=428.3

Q ss_pred             CcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC-CCCCcCC
Q psy13077         47 SDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG-TLGNWIS  125 (630)
Q Consensus        47 ~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~-~~n~~~~  125 (630)
                      ..|+.|.+.++    |+++++++||+. |+ ..|++.++|+.+ |||||+|+|||.++..      ++.||| ..|++++
T Consensus        19 ~~v~~n~s~~~----L~e~~i~~~eg~-lt-~~Gal~~~TG~~-TGRSPkDkfiV~~~~t------~~~i~W~~~Nkpi~   85 (529)
T COG1866          19 EDVVYNLSAAQ----LYEEAIRRGEGV-LT-ATGALRVDTGIY-TGRSPKDKFIVRDDST------RDTIWWGTRNKPIS   85 (529)
T ss_pred             HHHHhcCCHHH----HHHHHhhcCCCc-cC-CCCceEEecccc-cCCCCCCceEEecCcc------cccccccccCccCC
Confidence            67899999865    999999999976 65 678866655555 9999999999988874      456666 4699999


Q ss_pred             HHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhcCCCCCceEEEEe
Q psy13077        126 PQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLLDADQPFVKALHS  203 (630)
Q Consensus       126 ~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~~~~~~Fv~~~hs  203 (630)
                      +|.|+. |+.++..+++||++||++.++|+  ++.+++.|| ||+++||+|+|++|+ |++.+++..+.+  ||+ ++.+
T Consensus        86 ~e~f~~-L~~~~~~yl~~k~lfv~d~~~Ga--~~~~~l~vrvvte~Awh~lF~~nlfIrP~~e~l~~~~~--dft-vin~  159 (529)
T COG1866          86 PETFDR-LKGDVTDYLSGKDLFVVDGFAGA--DPDYRLPVRVVTEVAWHALFIRNLFIRPTGEELSTFKP--DFT-VINA  159 (529)
T ss_pred             HHHHHH-HHHHHHHHhccCcEEEEEeeecC--CccceeeeEeehhhHHHHHHHHhcccccchhhhccCCC--CeE-EEeC
Confidence            999995 99999999999999999999999  999999999 899999999999999 999999999888  899 9987


Q ss_pred             cCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhccccCCCCC
Q psy13077        204 VGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPEGQ  283 (630)
Q Consensus       204 ~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~gv~~p~G~  283 (630)
                      +...... ..+   ++||| ++|+++++++.++|.||.|+||   |||++ |++|||++|.+|+|+|||+  +++++.|+
T Consensus       160 p~f~~~~-~~~---g~~Se-~~i~~n~~~~~~lIggT~YaGE---MKK~~-fs~mnylLP~~~i~~MHcs--ANvG~~gd  228 (529)
T COG1866         160 PSFKADP-KRD---GLRSE-TFVAFNFTERIVLIGGTWYAGE---MKKGI-FSVMNYLLPLKGILSMHCS--ANVGEKGD  228 (529)
T ss_pred             CcCCCCh-hhc---ccccc-cEEEEecccceeeeeccchhhh---hhhhH-HHHhhccccccccccceec--cccCcCCC
Confidence            7753332 213   67999 7999999999999999999999   99998 9999999999999999999  55679999


Q ss_pred             EEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHHhhccCCc
Q psy13077        284 KKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAMKTVFKNT  362 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~~ai~~~t  362 (630)
                      +++||  |||||||||||+ ||     +|+|||||+ +|   +++|   +||+|+|||+||+++|++.||+||.||++++
T Consensus       229 valFF--GLSGTGKTTLSa-Dp-----~R~LIGDDEHgW---~d~G---VFN~EGGCYAK~I~Ls~e~EP~I~~Ai~~~a  294 (529)
T COG1866         229 VALFF--GLSGTGKTTLSA-DP-----HRRLIGDDEHGW---DDRG---VFNFEGGCYAKTINLSEEKEPEIYAAIKRGA  294 (529)
T ss_pred             eEEEE--eccCCCcceecc-CC-----ccccccCccccc---CCCc---eEeecCccccccccCchhhchhHHHHhhccc
Confidence            99999  999999999999 88     599999997 99   9999   5999999999999999999999999999999


Q ss_pred             eeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCCcccceEEEec
Q psy13077        363 IFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEGVPISAIIFGG  442 (630)
Q Consensus       363 If~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~GvPi~aIiFg~  442 (630)
                      ++|||++++||.|+++|.                +.|         +|||++||+++|||..|.  ..+|+| ++|||||
T Consensus       295 vLENVVvdedg~~Df~D~----------------SlT---------eNTR~aYpi~~Ipn~~~~--~~~ghp-~~iIfLT  346 (529)
T COG1866         295 VLENVVVDEDGTPDFDDG----------------SLT---------ENTRAAYPIEHIPNVSPS--VKAGHP-KNVIFLT  346 (529)
T ss_pred             eeeeEEEcCCCCcCCccc----------------ccc---------ccccccchHhhccccCcc--cccCCC-ceEEEEe
Confidence            999999999999888774                557         499999999999998885  788899 7999999


Q ss_pred             cCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHHHHHHHHhhccCC
Q psy13077        443 RRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKHWLSMEQRTNAKL  515 (630)
Q Consensus       443 rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~wl~lg~~~~~~~  515 (630)
                      ||+|| ||||++|+++|+||||    .|++||+.+||+.++ .+|.+      ++|||++|+++|+++   |++++.++.
T Consensus       347 aDafGVlPPvsrLTpeQamYhF----lsG~TaK~agTE~Gv-tep~pTFStCFGaPFmp~hp~~YA~~---L~~~i~~~~  418 (529)
T COG1866         347 ADAFGVLPPVSRLTPEQAMYHF----LSGYTAKLAGTERGV-TEPEPTFSTCFGAPFMPLHPTRYAEL---LGKLIKAHG  418 (529)
T ss_pred             ccccCCCCcchhcCHHHHHHHH----HcchhhhccccccCC-CCCCcccccccCCcccCCChhHHHHH---HHHHHHHcC
Confidence            99999 8999999999999999    999999999995554 35443      999999999999999   669999999


Q ss_pred             CcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCccceec---Cc-ccc-cCCCCCcCCCCCCchhhhHhh
Q psy13077        516 PKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKEIAEA---SP-IGY-IPKPEALITTNLASDVDLEEL  586 (630)
Q Consensus       516 pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~~~~~---tp-~G~-iP~~~~l~~~Gl~~~~~~~~~  586 (630)
                      .+||+||   |||+|+    +||.++|| |++   |+.++++|+++..+   .| ||+ ||+.    ++||++.+++|+.
T Consensus       419 ~~vyLvN---TGWtGg----~yg~GkRi~ik~TRall~a~l~G~l~nae~~~d~~f~l~iP~~----~pGV~~~ilnP~~  487 (529)
T COG1866         419 ANVYLVN---TGWTGG----AYGTGKRIPIKYTRALLDAILDGSLENAETKTDPIFGLAIPVA----LPGVDSDILNPRN  487 (529)
T ss_pred             CcEEEEe---cCccCC----CCCCccccCHHHHHHHHHHHhccccccceeeeccccccccccc----CCCCCccccChhh
Confidence            9999999   999998    89999999 986   99999999965544   47 999 9999    9999999999999


Q ss_pred             hcCCHHHHHHHHHHHHHHHHHhh
Q psy13077        587 FSFDKSFWEQEVQDLQRYFNEQL  609 (630)
Q Consensus       587 ~~~d~~~w~~e~~~l~~~f~~~~  609 (630)
                      +|.|+.+|++++++|++.|.++|
T Consensus       488 tw~dk~~y~~~a~~La~~F~~NF  510 (529)
T COG1866         488 TWADKAAYDEKARRLAKLFIENF  510 (529)
T ss_pred             hhccHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999998865


No 9  
>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the ATP-dependent groups.
Probab=100.00  E-value=9.5e-105  Score=864.51  Aligned_cols=481  Identities=21%  Similarity=0.280  Sum_probs=434.7

Q ss_pred             cEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC-CCCCcCCH
Q psy13077         48 DVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG-TLGNWISP  126 (630)
Q Consensus        48 ~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~-~~n~~~~~  126 (630)
                      .||+|+..++    |+++|+++++++ ++ ..|++++.|+.. |||||+|||||.++.+      ++.||| ..|+++++
T Consensus         2 ~v~~Nls~~e----L~E~A~~~~eg~-~t-~~GaL~v~TG~~-TGRSPkDkfIV~~~~t------~~~i~wg~vn~~~~~   68 (508)
T cd00484           2 HIHHNLSPAE----LYEEALKRGEGV-LT-STGALAVDTGKK-TGRSPKDKFIVDEPSS------EDDIWWGKVNQPISE   68 (508)
T ss_pred             ccccCCCHHH----HHHHHHhCCCCE-Ee-cCCCeEeccCCc-cCCCCCceeEeCCCCc------cccccccccCcCCCH
Confidence            5899999977    999999999977 65 589977766666 9999999999987664      345555 55899999


Q ss_pred             HHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhcCCCCCceEEEEec
Q psy13077        127 QDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLLDADQPFVKALHSV  204 (630)
Q Consensus       127 ~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~~~~~~Fv~~~hs~  204 (630)
                      ++|++ |++++..++++|+|||++.++|+  +|.+++.|| ||+.||++|+|+.|+ |+..++++.+.+  ||+ +++.+
T Consensus        69 ~~f~~-L~~~~~~yl~~~~lyv~D~~vGa--dp~~r~~vRvi~~~a~~alF~~nmfi~P~~eel~~f~p--dft-I~~~P  142 (508)
T cd00484          69 ETFEI-LRERAVDYLNTKKLFVFDGFAGA--DPEYRLKVRVITERAWHALFMRNMFIRPTEEELENFGP--DFT-IYNAP  142 (508)
T ss_pred             HHHHH-HHHHHHHHhcCCCEEEEeeeeec--CcccceeeEEEECHHHHHHHHHhCCCCCChHHhccCCc--CEE-EEECC
Confidence            99994 99999999999999999999999  999999999 899999999999998 999999998886  899 99999


Q ss_pred             CCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhccccCCCCCE
Q psy13077        205 GTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPEGQK  284 (630)
Q Consensus       205 g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~gv~~p~G~~  284 (630)
                      +.+.++.. +   +++|+ ++|++|++++.++|+||.|+||   +||++ |++|+++++++|+|+|||+..  .+.+|++
T Consensus       143 ~f~~~~~~-~---G~~s~-~~iiin~~~~~~lI~GT~YaGE---iKKgi-f~~~~~ll~~~g~l~lH~san--v~~~~~~  211 (508)
T cd00484         143 KFKANPET-D---GMNSE-TFVIINFAEREMVIGGTEYAGE---MKKGI-FSVMNYLLPKKGVLSMHCSAN--VGKKGDV  211 (508)
T ss_pred             CCcCCccc-c---CCCcc-cEEEEEccCCeEEEECccchhh---hHHHH-HHHHHHHHHhCCcEeeccccc--cCCCCCE
Confidence            97655422 3   67898 7999999999999999999999   99998 999999999999999999942  3577999


Q ss_pred             EEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHHhhccCCce
Q psy13077        285 KYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAMKTVFKNTI  363 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~~ai~~~tI  363 (630)
                      +.||  |+|||||||||+ +|     .+.+||||+ +|   +++|   +||+|+|||+|+++||+|.||+||+||++|+|
T Consensus       212 ~~ff--GlSGtGKtTLsa-~~-----~r~li~DDehgW---~~~G---vfn~EGGcYaK~i~Ls~e~EP~I~~Ai~fgav  277 (508)
T cd00484         212 ALFF--GLSGTGKTTLSA-DP-----NRKLIGDDEHGW---SDRG---VFNIEGGCYAKCINLSEEKEPEIYNAIKFGAV  277 (508)
T ss_pred             EEEE--ecCCCCHHHhcc-Cc-----cCCeeccccccc---CCCc---eEeecCceEEEecCCCcccChHHHHhhccCce
Confidence            9999  999999999998 66     479999996 99   9999   59999999999999999999999999999999


Q ss_pred             eEcceEcCC-CceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCCcccceEEEec
Q psy13077        364 FTNVASTSD-GGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEGVPISAIIFGG  442 (630)
Q Consensus       364 f~NV~~~~d-g~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~GvPi~aIiFg~  442 (630)
                      +|||+++++ |.|+|++                .++|+         |+|++||+++|||++.+  ..+|+| ++|||||
T Consensus       278 lENVv~d~~~~~~df~d----------------~s~Te---------NtR~~yP~~~I~na~~~--~~~~~p-~~iifLT  329 (508)
T cd00484         278 LENVVVDEETREVDYDD----------------DSITE---------NTRAAYPIEHIPNAVIP--GVGGHP-KNIIFLT  329 (508)
T ss_pred             EeeeEEcCCCCccCCCC----------------Ccccc---------cceEEeEHHHccccCCC--CcCCCC-CEEEEEe
Confidence            999999964 7766665                56784         99999999999999875  789999 8999999


Q ss_pred             cCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHHHHHHHHhhccCC
Q psy13077        443 RRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKHWLSMEQRTNAKL  515 (630)
Q Consensus       443 rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~wl~lg~~~~~~~  515 (630)
                      ||++| ||||++|++.|+||||    .|+|||+++||+.++ .+|.|      +.|||++||++|+++   |++|++++.
T Consensus       330 ~DafgVlPPvskLt~eQA~y~F----lsGyTak~agTE~Gv-~ep~~tFS~cfg~PF~~~~p~~ya~~---L~eki~~~~  401 (508)
T cd00484         330 ADAFGVLPPVSKLTPEQAMYHF----LSGYTAKVAGTERGI-TEPTATFSACFGAPFLPLHPTVYAEM---LGEKIKKHG  401 (508)
T ss_pred             ccccCCCCccccCCHHHHHHHH----HccccccccccccCC-cCCcccchhhcCCcCCCCCHHHHHHH---HHHHHHHcC
Confidence            99999 8999999999999999    999999999996555 58877      999999999999999   779999999


Q ss_pred             CcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCcc---ceecCc-ccc-cCCCCCcCCCCCCchhhhHhh
Q psy13077        516 PKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKE---IAEASP-IGY-IPKPEALITTNLASDVDLEEL  586 (630)
Q Consensus       516 pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~---~~~~tp-~G~-iP~~~~l~~~Gl~~~~~~~~~  586 (630)
                      .+||+||   |||+|+    +||+++|| |++   |++++++|++   .+..+| ||+ ||++    |+|||++++.|+.
T Consensus       402 ~~v~LvN---TGw~GG----~yg~G~Ri~l~~Traiv~a~~~G~l~~~~~~~~~~fgl~iP~~----~~gvp~~~L~P~~  470 (508)
T cd00484         402 AKVWLVN---TGWTGG----SYGVGKRIPLKYTRAIIDAILSGELNNAEYEKDPVFNLAIPTS----IPGVPSEILNPRN  470 (508)
T ss_pred             CCEEEEe---cCccCC----CCCCCccccHHHHHHHHHHHHcCCccCCCceECCccCcccccc----CCCCChhhcCHhh
Confidence            9999999   999988    79999999 997   9999999997   567778 999 9998    9999999999999


Q ss_pred             hcCCHHHHHHHHHHHHHHHHH---hhCCCccHHHHH
Q psy13077        587 FSFDKSFWEQEVQDLQRYFNE---QLGADLPTAIQA  619 (630)
Q Consensus       587 ~~~d~~~w~~e~~~l~~~f~~---~~~~~lP~ei~~  619 (630)
                      +|.|+++|++++++|++.|.+   ||.++++++|++
T Consensus       471 ~w~d~~~y~~~a~~La~~F~~nf~~f~~~~~~~i~~  506 (508)
T cd00484         471 TWADKEAYDETAKKLAKLFIENFKKFADKVSEEIAA  506 (508)
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHhcccCCHHHHh
Confidence            999999999999999999988   555567788765


No 10 
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=3.8e-104  Score=864.10  Aligned_cols=488  Identities=20%  Similarity=0.250  Sum_probs=435.0

Q ss_pred             HhhhcCCCcEEEeCCCHHHHHHHHHHHH-HCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC
Q psy13077         40 CVELCQPSDVHICDGSEREYKELIDLMV-KDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG  118 (630)
Q Consensus        40 ~~~l~~p~~I~~~~gs~ee~~~L~~~~~-~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~  118 (630)
                      ..+| ++..||+|...++    |+++|+ +++++. ++ ..|++++.|+.+ |||||+|||||.++..      ++.|||
T Consensus        36 ~~g~-~~~~i~~Nl~~~~----L~E~al~~~~~g~-~t-~~GaL~v~TG~~-TGRSpkDKfIV~~~~~------~d~i~W  101 (561)
T PTZ00311         36 KLGL-HNTTIHRNLTVPE----LYEHALKYEKNTS-IT-STGALCVYSGAK-TGRSPKDKRIVKEDSS------EDDIWW  101 (561)
T ss_pred             hcCC-CCCeEEeCCCHHH----HHHHHHhhcCCcE-Ee-cCCceEEecCCc-cCCCCCceEEeCCCCc------cccccc
Confidence            3445 4468999999977    999999 788866 76 689977766666 9999999999987664      345555


Q ss_pred             -CCCCcCCHHHHHHHHHhhhhhhc-CCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHh----hh
Q psy13077        119 -TLGNWISPQDYEEAIMQRFPGCM-KGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVL----NL  190 (630)
Q Consensus       119 -~~n~~~~~~~~~~~L~~~~~g~m-~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l----~~  190 (630)
                       +.|+++++++|+. |++++..++ ++|++||++.++|+  +|.+++.|| ||+.||++|+|+.|+ |+..+++    +.
T Consensus       102 g~vN~p~~~~~f~~-L~~~~~~yl~~~~~lyv~D~~vGa--Dp~~~l~vRvit~~a~~alF~~nmfirP~~~el~~~~~~  178 (561)
T PTZ00311        102 GKVNIPLSEESFEI-NKKRAIDYLNTRERLFVVDGYAGW--DPKYRLKVRVITTRAYHALFMRNMLIRPTNEELKKFGED  178 (561)
T ss_pred             CccCccCCHHHHHH-HHHHHHHHHhcCCCEEEEeeeeec--CcccceeEEEEecHHHHHHHHHHCCCCCChHHhhccccC
Confidence             5589999999995 999999999 57899999999999  999999999 899999999999999 8998888    55


Q ss_pred             cCCCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccc
Q psy13077        191 LDADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAE  270 (630)
Q Consensus       191 ~~~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLae  270 (630)
                      +.+  ||+ +++.++.+.++.. +   +++|+ ++|++|+++++++|+||.|+||   +||++ |++|+++++++|+|+|
T Consensus       179 f~P--dft-Ii~~P~f~a~~~~-~---G~~se-~~i~in~~~~~~lI~GT~YaGE---iKKgi-Ft~~~~ll~~rg~l~l  246 (561)
T PTZ00311        179 FVP--DFT-IYNAGEFKANRLI-E---GVTSE-TSVALNFKRREMVILGTQYAGE---MKKGI-LTVMMYLMPKQGVLPL  246 (561)
T ss_pred             CCC--CEE-EEECCCCCCCccc-C---CCCcc-cEEEEEccCCeEEEEcccchhh---hHHHH-HHHHHHHHHHCCceee
Confidence            556  898 9999997655422 3   67898 7999999999999999999999   99998 9999999999999999


Q ss_pred             cchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCC
Q psy13077        271 HMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNK  349 (630)
Q Consensus       271 Hm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~  349 (630)
                      ||+.+  .+.+|+++.||  |+|||||||||+ +|   +  +.+||||+ +|   +++|   +||+|+|||+|+++||+|
T Consensus       247 Hasa~--v~~~g~~~~ff--GlSGtGKtTLsa-~~---~--~~li~DD~~gW---~~~G---vfn~EGGCYAK~i~Ls~e  310 (561)
T PTZ00311        247 HSSAN--VGKKGDVTLFF--GLSGTGKTTLSA-DP---N--RKLIGDDEHVW---TDDG---VFNIEGGCYAKCIDLSKE  310 (561)
T ss_pred             eeeEe--eCCCCCEEEEE--ccCCCCHHHhcc-CC---C--Cceeecccccc---cCCc---eEeecCceEEEecCCCcc
Confidence            99944  34679999999  999999999999 66   5  79999997 99   9999   599999999999999999


Q ss_pred             CcHHHHhhccCCceeEcceEcCC-CceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCc
Q psy13077        350 TNPIAMKTVFKNTIFTNVASTSD-GGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWE  428 (630)
Q Consensus       350 ~~P~i~~ai~~~tIf~NV~~~~d-g~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e  428 (630)
                      .||+||+||++|||+|||+++++ +.|+|++                .+.|+         |+|++||+++|||++.+  
T Consensus       311 ~EPeI~~Ai~fgavLENVv~d~~~~~~df~d----------------~s~Te---------NtR~ayP~~~I~na~~~--  363 (561)
T PTZ00311        311 TEPEIYNAIRFGAVLENVVLDKVTREVDFND----------------ISITE---------NTRCAYPLEHIPNAKIP--  363 (561)
T ss_pred             cChHHHHhhccCceEEeeEEcCCCCcccCCC----------------Ccccc---------cceEEeEHHhccccCCC--
Confidence            99999999999999999999985 6766665                46684         99999999999999864  


Q ss_pred             CCCCcccceEEEeccCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHH
Q psy13077        429 SHEGVPISAIIFGGRRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYL  501 (630)
Q Consensus       429 ~p~GvPi~aIiFg~rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~  501 (630)
                      +.+|+| ++|||||||++| ||||++|+++|+||||    .|+|||+++||+.++ .+|.|      ++|||++||++|+
T Consensus       364 ~~~~~P-~~IifLT~DafGVlPPvskLt~eQA~yhF----lsGyTakvaGTE~Gv-tep~~tFS~CFg~PFl~l~p~~Ya  437 (561)
T PTZ00311        364 AVGGHP-KNIIFLTCDAFGVLPPVSKLTPEQAMYHF----ISGYTAKVAGTEVGV-KEPTATFSACFGEPFLVLHPTVYA  437 (561)
T ss_pred             CcCCCC-CEEEEEeccccCCCCccccCCHHHHHHHH----HccccccccccccCC-ccCccccccccCCcCCCCCHHHHH
Confidence            899999 899999999999 8999999999999999    999999999995554 57766      7999999999999


Q ss_pred             HHHHHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcc-hhHH-HHH---HHHhHhcCcc---ceecCc-ccc-cCCCCC
Q psy13077        502 KHWLSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGE-NIRV-LDW---ILRRVENNKE---IAEASP-IGY-IPKPEA  571 (630)
Q Consensus       502 ~~wl~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~-n~Rv-L~w---i~~r~~~G~~---~~~~tp-~G~-iP~~~~  571 (630)
                      ++   |++|++++..+||+||   |||+|+    .||+ ++|| |++   |++++++|++   .+..+| ||+ ||++  
T Consensus       438 ~l---L~eki~~~~~~v~LvN---TGw~GG----~yg~~G~Ri~l~~TRaiv~ail~G~l~~~~~~~~p~Fgl~iP~~--  505 (561)
T PTZ00311        438 EM---LAEKIKKHNTRVWLLN---TGWIGG----SYGSGGKRMPLKYTRAIIDAIHDGELKKAEYEKFPIFGLQIPKS--  505 (561)
T ss_pred             HH---HHHHHHHcCCCEEEee---cCccCC----cCCCCCcccCHHHHHHHHHHHhcCCccCCceeECCccCcccccc--
Confidence            99   7799999999999999   999988    7999 8999 997   9999999997   777778 999 9998  


Q ss_pred             cCCCCCCchhhhHhhhcCCHHHHHHHHHHHHHHHHH---hhCCCccHHHHH
Q psy13077        572 LITTNLASDVDLEELFSFDKSFWEQEVQDLQRYFNE---QLGADLPTAIQA  619 (630)
Q Consensus       572 l~~~Gl~~~~~~~~~~~~d~~~w~~e~~~l~~~f~~---~~~~~lP~ei~~  619 (630)
                        |+|||++++.|+.+|.|+++|++++++|++.|.+   ||.+.+++++++
T Consensus       506 --~pgVp~eiL~Pr~~w~d~~ayd~~a~~La~~F~~nf~~f~~~~~~~i~~  554 (561)
T PTZ00311        506 --CAGVPSELLDPRNAWKDKAAFDKQLKELAAKFQKNFKKYADKASPEVLA  554 (561)
T ss_pred             --CCCCChhhcCHhhcCCCHHHHHHHHHHHHHHHHHHHHHhcccCCHHHHh
Confidence              9999999999999999999999999999999988   566666777765


No 11 
>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP). Involved in the gluconeogenesis pathway. It converts oxaloacetic acid to phosphoenolpyruvate using ATP. Enzyme is a monomer. The reaction is also catalysed by phosphoenolpyruvate carboxykinase (GTP) (EC 4.1.1.32) using GTP instead of ATP, described in PROSITE:PDOC00421
Probab=100.00  E-value=2e-103  Score=853.06  Aligned_cols=487  Identities=18%  Similarity=0.245  Sum_probs=430.8

Q ss_pred             HhhhcCCCcEEEeCCCHHHHHHHHHHHHHC-----CccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCC
Q psy13077         40 CVELCQPSDVHICDGSEREYKELIDLMVKD-----KTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKP  114 (630)
Q Consensus        40 ~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~-----Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~  114 (630)
                      ..++.+...||+|+..++    |+++|+++     +|+. ++ ..|++++.|+.. |||||+|||||.++..      ++
T Consensus        12 ~~g~~~~~~v~~Nl~~~~----L~e~a~~~~~~~~~eg~-~t-~~Gal~v~TG~~-TGRSpkDK~IV~~~~t------~~   78 (532)
T TIGR00224        12 ALGISDVHDIVYNPSYAQ----LYEEELKPSLTGYEKGV-LT-STGAVAVDTGIF-TGRSPKDKYIVEDETT------KD   78 (532)
T ss_pred             hcCCCCCceEEeCCCHHH----HHHHHHhhccccCCCce-ec-cCCceEEecCCe-eCCCcCceEEeCCCCc------cc
Confidence            334555578999999977    99999999     7766 66 589977766666 9999999999977764      34


Q ss_pred             CccC-CCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhc
Q psy13077        115 GVKG-TLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLL  191 (630)
Q Consensus       115 gi~~-~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~  191 (630)
                      .||| ..|++++++.|+ .|++++..++++|+|||++.++|+  +|.+++.|| ||+.|||+|+|+.|+ |+..++++.+
T Consensus        79 ~i~Wg~vN~p~~~~~f~-~L~~~v~~~l~~~~lyv~D~~~Ga--Dp~~rl~vRvite~AwhalF~~nmfirP~~eel~~f  155 (532)
T TIGR00224        79 TIWWGPVNKPLSEETWQ-HLKGLVTRQLSRKRLFVVDAFCGA--DPKYRLSVRVVTEVAWQAHFVKNMFIRPTEEELAGF  155 (532)
T ss_pred             ccccCcCCcCCCHHHHH-HHHHHHHHHhcCCCEEEEeeeecc--CcccceeEEEEEcHHHHHHHHHhhCCCCChHHhccC
Confidence            4554 558999999999 599999999999999999999999  999999999 899999999999999 9999999998


Q ss_pred             CCCCCceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCccccc
Q psy13077        192 DADQPFVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEH  271 (630)
Q Consensus       192 ~~~~~Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeH  271 (630)
                      .+  ||+ ++|+++.+.++...+   +++|+ ++|++|+++|+++|+||.|+||   +||++ |++|+++++++|+|+||
T Consensus       156 eP--dft-I~~~p~f~~ad~~~~---g~~S~-~~i~in~~~~~~lI~GT~YaGE---iKKgi-Fs~~~~ll~~rg~l~lH  224 (532)
T TIGR00224       156 EP--DFT-VMNGAKFTNPNWKEQ---GLNSE-NFVAFNLTERMQLIGGTWYGGE---MKKGM-FSMMNYLLPLKGILSMH  224 (532)
T ss_pred             CC--CEE-EEeCCCCCCCCcccC---CCCcC-cEEEEecccCeEEEECcchhhh---hHHHH-HHHHHHHHHhCCeEeec
Confidence            77  899 999999642322223   67898 7999999999999999999999   99998 99999999999999999


Q ss_pred             chhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCC
Q psy13077        272 MLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKT  350 (630)
Q Consensus       272 m~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~  350 (630)
                      |+.+  .+.+|+++.||  |+|||||||||+ +|     .+.+||||+ +|   +++|   +||+|+|||+|+++||+|.
T Consensus       225 ~san--v~~~g~~~~ff--GlSGtGKTTLsa-d~-----~r~li~DDEhgW---~~~G---vfn~EGGCYaK~i~Ls~e~  288 (532)
T TIGR00224       225 CSAN--VGEKGDVALFF--GLSGTGKTTLST-DP-----KRRLIGDDEHGW---DDDG---VFNFEGGCYAKTIHLSEEK  288 (532)
T ss_pred             Ceee--eCCCCCEEEEE--ecCCCChhhhhc-cc-----cccccccccccc---cCCc---eEeecCceEEEecCCCccc
Confidence            9952  34779999999  999999999999 66     479999996 99   9999   5999999999999999999


Q ss_pred             cHHHHhhccCCceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCC
Q psy13077        351 NPIAMKTVFKNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESH  430 (630)
Q Consensus       351 ~P~i~~ai~~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p  430 (630)
                      ||+||+||++|+|+|||+++++|.|+|++                .+.|+         |+|++||+++|||++.+ .+.
T Consensus       289 EPeI~~Ai~fgavLENVv~d~~~~vdf~d----------------~s~Te---------NtR~ayPi~~I~n~~~~-~~~  342 (532)
T TIGR00224       289 EPEIYNAIRRDALLENVVVREDGTVDFDD----------------GSKTE---------NTRVSYPIYHIDNIVKP-VSA  342 (532)
T ss_pred             chHHHHhcCCCceEEeeeECCCCCccCCC----------------Ccccc---------cceEEeEHHhccccCCC-Ccc
Confidence            99999999999999999999888877765                46674         99999999999999654 347


Q ss_pred             CCcccceEEEeccCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHH
Q psy13077        431 EGVPISAIIFGGRRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKH  503 (630)
Q Consensus       431 ~GvPi~aIiFg~rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~  503 (630)
                      +|+| ++|||||||++| ||||++|++.|+||||    .|+|||+++||+.++ .+|.+      ++|||++||++|+++
T Consensus       343 ~~~p-~~iifLT~DAfGVlPPvskLt~eQA~yhF----lsGyTakvAGTE~Gv-~ep~~tFS~Cfg~PFl~~~p~~Ya~l  416 (532)
T TIGR00224       343 AGHA-TKVIFLTADAFGVLPPVSKLTPEQTMYHF----LSGFTAKLAGTERGI-TEPTPTFSACFGAAFLSLHPTQYAEV  416 (532)
T ss_pred             CCCC-CEEEEEeccccCCCCccccCCHHHHHHHH----HhcceeccccccCCC-CCCcccchhhcCCCCCCCCHHHHHHH
Confidence            7899 899999999999 8999999999999999    999999999997666 68877      799999999999999


Q ss_pred             HHHHHHhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCccc---eecCc-ccc-cCCCCCcCC
Q psy13077        504 WLSMEQRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKEI---AEASP-IGY-IPKPEALIT  574 (630)
Q Consensus       504 wl~lg~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~~---~~~tp-~G~-iP~~~~l~~  574 (630)
                         |++|+++|..+||+||   |||+        |+++|| |++   |+++|++|+++   +..+| ||+ ||++    |
T Consensus       417 ---L~~ki~~~~~~v~LvN---TGw~--------G~G~Ri~l~~TRaiv~ail~G~l~~~~~~~~~~fgl~iP~~----~  478 (532)
T TIGR00224       417 ---LVKRMQAAGAQAYLVN---TGWN--------GTGKRISIKDTRAIIDAILDGSLENAEMFTLPIFNLAIPTE----L  478 (532)
T ss_pred             ---HHHHHHHcCCCEEEEe---cCcc--------cCCcEecHHHHHHHHHHHhcCCccCCCceECCccCcccccc----C
Confidence               7799999999999999   9955        477999 997   99999999966   55678 999 9999    9


Q ss_pred             CCCCchhhhHhhhcCCHHHHHHHHHHHHHHHHHhh---CCC-ccHHHHH
Q psy13077        575 TNLASDVDLEELFSFDKSFWEQEVQDLQRYFNEQL---GAD-LPTAIQA  619 (630)
Q Consensus       575 ~Gl~~~~~~~~~~~~d~~~w~~e~~~l~~~f~~~~---~~~-lP~ei~~  619 (630)
                      +|||++++.|+.+|.|+++|++++++|++.|.++|   .+. +++++++
T Consensus       479 pgvp~~iL~Pr~~W~d~~~y~~~a~~La~~F~~Nf~~f~~~~~~~~v~~  527 (532)
T TIGR00224       479 PGVDTKILDPRNTYASKEQWQEKAETLANLFVDNFKKYADTPAGAALVA  527 (532)
T ss_pred             CCCChhhcCHhhccCCHHHHHHHHHHHHHHHHHHHHhhccCCCCHHHHh
Confidence            99999999999999999999999999999998854   333 6777664


No 12 
>PRK09344 phosphoenolpyruvate carboxykinase; Provisional
Probab=100.00  E-value=1.1e-93  Score=783.49  Aligned_cols=489  Identities=21%  Similarity=0.293  Sum_probs=432.1

Q ss_pred             HhhhcCCCcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC-
Q psy13077         40 CVELCQPSDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG-  118 (630)
Q Consensus        40 ~~~l~~p~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~-  118 (630)
                      ..+|.+...||+|...++    |+++|++++++. ++ ..|++++.|+.. |||||+|||||.++..      ++.||| 
T Consensus        10 ~~g~~~~~~i~~n~~~~~----L~e~a~~~~~g~-~t-~~Gal~~~tG~~-tGRSp~dk~iV~~~~~------~~~i~wg   76 (526)
T PRK09344         10 AYGITNLSNVHYNLSYAE----LYEEALRRGEGV-LT-DTGALAVDTGKF-TGRSPKDKFIVRDPST------EDTIWWG   76 (526)
T ss_pred             hcCCCCcceeEeCCCHHH----HHHHHHHcCCCe-ec-cCCceEEecCCc-cCCCcCceeeecCccc------ccccccc
Confidence            445666688999999977    999999999976 65 689977777666 9999999999987664      233444 


Q ss_pred             CCCCcCCHHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhcCCCCC
Q psy13077        119 TLGNWISPQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLLDADQP  196 (630)
Q Consensus       119 ~~n~~~~~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~~~~~~  196 (630)
                      ..|+++++++|+. |++++..++++|++||+|.++|.  +|.+++.|| +|+.+||+|+|++|+ |+..++++.+.+  |
T Consensus        77 ~~n~~~~~~~f~~-l~~~~~~~l~~~~lyv~d~~vG~--d~~~~~~vrvi~~~a~~~lf~~nlf~~p~~~e~~~~~P--d  151 (526)
T PRK09344         77 DDNKPISPEKFDA-LKQKVLAYLSGKDLFVVDGFAGA--DPEYRLPVRVITELAWHALFVRNLFIRPSEEELASFEP--D  151 (526)
T ss_pred             ccCCCCCHHHHHH-HHHHHHHHhcCCcEEEEeeeecC--ChhHeeeEEEEecHHHHHHHHhhcCCCCChhHhccCCC--C
Confidence            4489999999994 99999999999999999999999  999999999 899999999999999 999999987777  8


Q ss_pred             ceEEEEecCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhcc
Q psy13077        197 FVKALHSVGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILG  276 (630)
Q Consensus       197 Fv~~~hs~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~g  276 (630)
                      |+ +++.+..+.++.. +   +++|+ ++|+++++++.++++||.|+||   +||++ |++++++++++|+|+|||+.  
T Consensus       152 ~~-ii~~p~~~~~~~~-~---g~~s~-~~i~~~~~~~~~~I~Gt~Y~GE---~KK~~-lt~~~~~l~~rg~l~lH~sa--  219 (526)
T PRK09344        152 FT-IINAPKFKADPER-D---GTNSE-TFIAINFTERIVLIGGTDYAGE---MKKSI-FSVMNYLLPLKGVLPMHCSA--  219 (526)
T ss_pred             EE-EEEcCCCCCCccc-c---CCCCC-ceEEEecccCeEEEEcchhHHH---HHHHH-HHHHHHHHHHCCcEeeeCee--
Confidence            99 9999986544321 2   56888 7999999999999999999999   99997 99999999999999999984  


Q ss_pred             ccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHH
Q psy13077        277 ITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAM  355 (630)
Q Consensus       277 v~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~  355 (630)
                      ..+.+|+++.||  |+|||||||||+ ++   +  +.+||||+ +|   +++|   +||+|+|||+|+++|++++||+|+
T Consensus       220 ~i~~~g~~~~ff--GlSGtGKSTls~-~~---~--~~li~DD~~~~---~d~g---vfn~EgGcyaK~~dL~~~~EP~I~  285 (526)
T PRK09344        220 NVGEEGDVALFF--GLSGTGKTTLSA-DP---N--RKLIGDDEHGW---DDGG---VFNFEGGCYAKTINLSEEAEPEIY  285 (526)
T ss_pred             ecCCCCcEEEEE--eecCCCeeeccc-cC---C--cceeccceEEE---cCCc---eEeccceEEEEecCCCccccchHh
Confidence            234668999999  999999999998 44   5  89999996 89   8888   699999999999999999999999


Q ss_pred             hhccCCceeEcceEcCCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCCccc
Q psy13077        356 KTVFKNTIFTNVASTSDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEGVPI  435 (630)
Q Consensus       356 ~ai~~~tIf~NV~~~~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~GvPi  435 (630)
                      +|+++++|+|||+++++|.|++.+                .++|+         |+|++||++++||++..  ...|+| 
T Consensus       286 ~a~~~gavlENV~~d~~~~vdf~d----------------~s~T~---------NtR~~yP~~~i~n~~~~--~~~~~p-  337 (526)
T PRK09344        286 DAIRFGAVLENVVVDEDGTVDFDD----------------GSLTE---------NTRAAYPIEHIPNAVKP--SRAGHP-  337 (526)
T ss_pred             hhhccCceeeeEEECCCCcccCCC----------------Ccccc---------cceEEEEhHHhcCcccc--ccCCCC-
Confidence            999999999999999999977765                45674         99999999999999875  677898 


Q ss_pred             ceEEEeccCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHHHHHHH
Q psy13077        436 SAIIFGGRRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKHWLSME  508 (630)
Q Consensus       436 ~aIiFg~rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~wl~lg  508 (630)
                      ++|||++||++| ||||+++++.||+|||    .|++||+++|++.++ .+|.+      +.||+++|+.+|+++   |+
T Consensus       338 ~~iifLt~Da~gvlPPvskLt~eQA~y~F----lsGyTak~agtE~G~-tep~~tfs~cFg~PF~p~~p~~ya~~---L~  409 (526)
T PRK09344        338 KNIIFLTADAFGVLPPVSKLTPEQAMYHF----LSGYTAKVAGTERGV-TEPQPTFSTCFGAPFLPLHPTVYAEL---LG  409 (526)
T ss_pred             CEEEEEEcCCcCCCCcceeCCHHHHHHHH----HcCceecccccccCc-ccCCceeecccCCCCcCCCHHHHHHH---HH
Confidence            799999999999 8999999999999999    888999999996544 46544      789999999999999   66


Q ss_pred             HhhccCCCcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCccc---eecCc-ccc-cCCCCCcCCCCCCc
Q psy13077        509 QRTNAKLPKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKEI---AEASP-IGY-IPKPEALITTNLAS  579 (630)
Q Consensus       509 ~~~~~~~pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~~---~~~tp-~G~-iP~~~~l~~~Gl~~  579 (630)
                      +++.++..+||+||   |||.|+    .||.++|| |++   |+++|++|++.   +...| ||+ ||++    |+|||+
T Consensus       410 ~kl~~~~~~vylvN---TGw~GG----~~g~g~ri~~~~Traii~ai~~G~l~~~~~~~~p~fg~~vP~~----~~gv~~  478 (526)
T PRK09344        410 ERIKAHGAKVYLVN---TGWTGG----PYGTGKRISIKYTRAIINAILDGSLDNAETTTDPIFGLAVPTS----VPGVDS  478 (526)
T ss_pred             HHHHHcCCCEEEEe---cccccC----CCCCCccCCHHHHHHHHHHHhcCCccCCCceeCCccCccCCCc----CCCCCh
Confidence            89988999999999   998887    68999999 987   99999999976   55568 999 9998    999999


Q ss_pred             hhhhHhhhcCCHHHHHHHHHHHHHHHHH---hhCCCccHHHHH
Q psy13077        580 DVDLEELFSFDKSFWEQEVQDLQRYFNE---QLGADLPTAIQA  619 (630)
Q Consensus       580 ~~~~~~~~~~d~~~w~~e~~~l~~~f~~---~~~~~lP~ei~~  619 (630)
                      +++.|+.+|.|+++|++++++|++.|.+   ||.+.++++|.+
T Consensus       479 ~~l~P~~~w~d~~~y~~~a~~La~~f~~nf~~f~~~~~~~i~~  521 (526)
T PRK09344        479 EILDPRNTWADKAAYDEKAKKLARLFRENFEKFEDTVGEEIVA  521 (526)
T ss_pred             HhcChhhccCCHHHHHHHHHHHHHHHHHHHHHhccccCHHHHh
Confidence            9999999999999999999999999987   565557777764


No 13 
>PF01293 PEPCK_ATP:  Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region;  InterPro: IPR001272  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents ATP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004612 phosphoenolpyruvate carboxykinase (ATP) activity, 0005524 ATP binding, 0006094 gluconeogenesis; PDB: 2PY7_X 2OLR_A 1AYL_A 1K3D_A 1OEN_A 1AQ2_A 1OS1_A 2OLQ_A 1K3C_A 2PXZ_X ....
Probab=100.00  E-value=5.4e-90  Score=749.65  Aligned_cols=444  Identities=21%  Similarity=0.289  Sum_probs=353.1

Q ss_pred             CcEEEeCCCHHHHHHHHHHHHHCCccccccCCCCcEEEeeCCCcccccCCCEEEEcCCCcccCcCCCCCccC-CCCCcCC
Q psy13077         47 SDVHICDGSEREYKELIDLMVKDKTLRPVPKYENCWLARTNPADVARVESKTFICTQEKAETVPDTKPGVKG-TLGNWIS  125 (630)
Q Consensus        47 ~~I~~~~gs~ee~~~L~~~~~~~Ge~~~L~~~~g~~l~~t~p~d~aR~~~~tfIv~~~~~d~gp~~~~gi~~-~~n~~~~  125 (630)
                      .+||+|++.++    |+++|+++||+. |+ ..|++++.|+.. |||||+|||||.++..      .+.||| ..|++|+
T Consensus         2 ~~v~~Nls~~~----L~e~a~~~~eg~-lt-~~Gal~v~tG~~-TGRSp~dkfIV~~~~~------~~~v~Wg~~n~~i~   68 (466)
T PF01293_consen    2 ANVYRNLSPPE----LYEEAIKRGEGV-LT-KTGALVVNTGKF-TGRSPKDKFIVDEPGT------EDKVWWGSVNQPIS   68 (466)
T ss_dssp             SEEEES--HHH----HHHHHCHTTTEE-E--TTSSEEE--TT--SSB-GGGEEEE-STTT------TTTS-BTTSBEEE-
T ss_pred             CeeEeCCCHHH----HHHHHHhcCCCE-Ec-cCCCEEEeCCCc-cCCCCCceEEecCCcc------ccccccccCCcccC
Confidence            47999999987    999999999977 76 689987777765 9999999999987774      345565 6689999


Q ss_pred             HHHHHHHHHhhhhhhcCCCeEEEEeccccCCCCCCCccceE-EccchHHHhhhhhcc-cCChHHhhhcCCCCCceEEEEe
Q psy13077        126 PQDYEEAIMQRFPGCMKGRTMYVIPFSMGPVGSPLSKIGVE-ITDSPYVVGSMRIMT-RIGTPVLNLLDADQPFVKALHS  203 (630)
Q Consensus       126 ~~~~~~~L~~~~~g~m~GrtmyV~~~~~Gp~gsp~~~~gV~-iTdsayv~l~m~im~-R~~~~~l~~~~~~~~Fv~~~hs  203 (630)
                      +++|++ |++++..++++|+|||++.++|+  +|.+++.|| ||+.||++|+++.|+ |+..+++..+.+  +|+ ++|.
T Consensus        69 ~e~f~~-L~~~v~~yL~~k~lyv~D~~vG~--d~~~~~~vRvit~~a~~aLF~~nL~~~p~~~e~~~f~p--d~t-I~~~  142 (466)
T PF01293_consen   69 EEQFEK-LLERVVDYLSTKELYVQDGYVGA--DPDYRIKVRVITERAWHALFARNLFIRPPPEELQNFEP--DFT-IINA  142 (466)
T ss_dssp             HHHHHH-HHHHHHHHHTTSEEEEEEEEESS--STTT-EEEEEEESSHHHHHHHHHHSB-GSHHHHHT-S---SEE-EEEE
T ss_pred             HHHHHH-HHHHHHHHhcccceEEEEEEEec--CHHHceeEEEEeCcHHHHHHHHHhhcCCChhHhcccCC--CEE-EEeC
Confidence            999984 99999999999999999999999  999999999 899999999999998 999999998887  888 9999


Q ss_pred             cCCCCCCCCcCCCCCCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhccccCCCCC
Q psy13077        204 VGTPVSGKHEFPEWPCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPEGQ  283 (630)
Q Consensus       204 ~g~p~~~~~~~~~wpcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~gv~~p~G~  283 (630)
                      ++...++.. +   +++|+ ++|++|++++.++|+||.|+||   +||++ |++||++++++|.|+|||+..-  +.+|+
T Consensus       143 p~f~~~p~~-~---g~~s~-~~i~~d~~~~~~vI~Gt~Y~GE---iKK~i-ft~~n~ll~~~g~l~mH~san~--~~~gd  211 (466)
T PF01293_consen  143 PDFKADPEI-D---GTNSD-TFIIFDFERNVAVILGTRYAGE---IKKGI-FTVMNYLLPRNGVLPMHCSANV--GKDGD  211 (466)
T ss_dssp             TTS--TTCH-C---T-SSS--EEEEETTTTEEEEES---THH---HHHHH-HHHHHHHHHHTT-EEEEEEEEE--ETTSS
T ss_pred             CccccCCCc-C---CCCCC-cEEEEccccCeEEEECCccccc---chHHH-HHHHHHhhHhcCeEEEEeeeee--CCCCC
Confidence            996444322 2   67888 7999999999999999999999   99997 9999999999999999999542  35899


Q ss_pred             EEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHHhhccCCc
Q psy13077        284 KKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAMKTVFKNT  362 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~~ai~~~t  362 (630)
                      ++.||  |||||||||||+ +|     ++++||||+ +|   +++|   +||+|+|||+|+++++++++|+|+.|+++++
T Consensus       212 ~alfF--GLSGTGKTTLs~-d~-----~r~ligDDe~~w---~d~g---v~~~EggcyaKt~~l~~~~ep~i~~ai~~~a  277 (466)
T PF01293_consen  212 TALFF--GLSGTGKTTLSA-DP-----ERELIGDDEHGW---SDGG---VFNFEGGCYAKTIDLSKESEPEIYNAIKFGA  277 (466)
T ss_dssp             EEEEE--ESTTSSHHHHHS-BT-----TSEEEESSEEEE---ESSE---EEES-SEEEEE-TT--TTTSHHHHHCCSTT-
T ss_pred             eEEEE--ecCCCCcccccc-CC-----cceEEeCceeee---cCCc---eEeecCceeeeecCCCcccchhHHHHhccCe
Confidence            99999  999999999999 67     589999997 99   7777   6999999999999999999999999999999


Q ss_pred             eeEcceEc-CCCceeccCCccCCCCCccccccCCCCCCCCCCCCCCCCCcceeecCCCCCCCCCCCcCCCCcccceEEEe
Q psy13077        363 IFTNVAST-SDGGVYWEGMEDEISPDVSITDWHNKPWKKSDGTQAAHPNSRFCTPASQCPTIDPNWESHEGVPISAIIFG  441 (630)
Q Consensus       363 If~NV~~~-~dg~v~w~g~~~~~p~~~~~~dw~g~~~t~~~~~~~aHpNsRft~P~~~~pn~~~~~e~p~GvPi~aIiFg  441 (630)
                      |+|||++| ++|+|++++                .+.|+         |+|.+||++++||++..  ...|+| ++|||+
T Consensus       278 vlENV~~d~~~~~vd~~d----------------~s~t~---------N~R~~~p~~~i~n~~~~--~~~~~p-~~IifL  329 (466)
T PF01293_consen  278 VLENVVVDEETREVDFDD----------------DSITE---------NTRAIYPREFIPNAVDP--GDGGHP-KNIIFL  329 (466)
T ss_dssp             EEES-EEETTTSCEETT------------------SS-S-----------EEEEEGGGSSSB-SS--SEES-E-EEEEEE
T ss_pred             eecceEEeCCCCccCCcc----------------ccccC---------ceeEEEEhhHhhccccc--cccCCC-CEEEEE
Confidence            99999999 568877765                45674         99999999999999885  556888 899999


Q ss_pred             ccCCCC-CCceEeecCccceeeccccccchhhhhhcccCceeccCCcc------CCCCCCCChHHHHHHHHHHHHhhccC
Q psy13077        442 GRRPQG-VPLVYESFDWQHGVFLGASMRSEATAAAEHKGKVIMHDPFA------MRPFFGYNFGDYLKHWLSMEQRTNAK  514 (630)
Q Consensus       442 ~rd~~g-lPpV~e~~~wq~gv~lGas~~Se~TAa~~g~~g~~~~dP~a------~~PF~~y~~g~Y~~~wl~lg~~~~~~  514 (630)
                      |||++| ||||++|++.|++|||    .|++||+.+|++..+ .+|.|      +.|||+|||.+|+++   |.++++++
T Consensus       330 t~Da~gvlPPvskLt~~qa~~~F----~~G~t~k~agtE~g~-~ep~~~fs~~f~~PF~~~~p~~ya~~---l~~~~~~~  401 (466)
T PF01293_consen  330 TCDAFGVLPPVSKLTPEQAMYYF----LSGYTAKVAGTERGV-TEPQATFSECFGNPFMPLPPSVYAEL---LKEKIKKH  401 (466)
T ss_dssp             E--TTS-S-SEEEE-HHHHHHHH----HH-EEEEETTSBTTS-SSEEEEE-GGG-GGG-SS-HHHHHHH---HHHHHHHH
T ss_pred             ECCCCCCCCcceeCCHHHHHHHH----HHHHHhhhcccccCc-cCCCCceecccCCCCccCCHHHHHHH---HHHHHHhc
Confidence            999999 8999999999999999    788999999985544 45654      779999999999999   55888889


Q ss_pred             CCcEEEEeeeeeCCCCCcccCCCcchhHH-HHH---HHHhHhcCcc---ceecCc-ccc-cCCCCCcCCCCCCchh
Q psy13077        515 LPKVFHVNWFRKGSQGEFLWPGFGENIRV-LDW---ILRRVENNKE---IAEASP-IGY-IPKPEALITTNLASDV  581 (630)
Q Consensus       515 ~pkif~VN~F~~g~~G~flWpG~G~n~Rv-L~w---i~~r~~~G~~---~~~~tp-~G~-iP~~~~l~~~Gl~~~~  581 (630)
                      ..+||+||   |||.|+    .||.++|| |++   |+++|++|++   .+..+| ||+ ||++    |+|||++|
T Consensus       402 ~~~~yl~N---TG~~gg----~~~~g~ri~~~~t~~~i~~il~g~l~~~~~~~~~~f~~~ip~~----~~gv~~~~  466 (466)
T PF01293_consen  402 GVNCYLVN---TGWTGG----PYGVGKRIPLEYTRAIIEAILDGTLEFVEFEKDPIFGLEIPTS----CPGVPSEI  466 (466)
T ss_dssp             T-EEEEEE----SBETT----SCCCSSB--HHHHHHHHHHHHTSGCCTS-EEEETTTTEEEES-----BTTS-GCC
T ss_pred             CCCEEEEe---CCccCC----CCCceeECCHHHHHHHHHHHhcCCccCCCceEcCccCeecccc----CCCCCCCC
Confidence            99999999   998887    69999999 987   9999999997   666678 999 9999    99999654


No 14 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=99.65  E-value=5.1e-17  Score=146.94  Aligned_cols=70  Identities=29%  Similarity=0.203  Sum_probs=57.4

Q ss_pred             CcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEe
Q psy13077        266 GWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGV  342 (630)
Q Consensus       266 GwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk  342 (630)
                      ||++.|+..+.+  +.|+...+.  ||||||||||+++-+   ..++.+.|||+.+|+.++.+++++++||.+||+.
T Consensus         1 ~~~aL~~vsl~i--~~ge~v~I~--GpSGsGKSTLl~~l~---~G~i~~~g~di~~~~~~~~~~~~~~~~q~lf~~t   70 (107)
T cd00820           1 GTTSLHGVLVDV--YGKVGVLIT--GDSGIGKTELALELI---KRKHRLVGDDNVEIREDSKDELIGRNPELGLEIR   70 (107)
T ss_pred             CceEEEeeEEEE--cCCEEEEEE--cCCCCCHHHHHHHhh---CCeEEEeeEeHHHhhhhhcCCEEEEechhcchhh
Confidence            789999986655  457777777  999999999998755   3479999999988886778999999999977644


No 15 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=96.40  E-value=0.0019  Score=62.18  Aligned_cols=60  Identities=30%  Similarity=0.375  Sum_probs=41.6

Q ss_pred             ccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccC
Q psy13077        268 LAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPE  336 (630)
Q Consensus       268 LaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE  336 (630)
                      ...|.+.+.+   .|.-..|.  |+||+||||||. .=-..|  -.+|+||...++. .+|++++-.|+
T Consensus         3 ~~~H~~~v~~---~g~gvLi~--G~sG~GKStlal-~L~~~g--~~lvaDD~v~v~~-~~~~l~~~~p~   62 (149)
T cd01918           3 VTVHGVLVEV---GGIGVLIT--GPSGIGKSELAL-ELIKRG--HRLVADDRVVVKR-EGGRLVGRAPE   62 (149)
T ss_pred             ccEEEEEEEE---CCEEEEEE--cCCCCCHHHHHH-HHHHcC--CeEEECCEEEEEE-ECCEEEEeChH
Confidence            3568876544   35557888  999999999986 111125  4799999877763 45777666665


No 16 
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=94.91  E-value=0.018  Score=62.30  Aligned_cols=21  Identities=33%  Similarity=0.564  Sum_probs=17.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .+|+-..+.  ||||||||||--
T Consensus        27 ~~Gef~vll--GPSGcGKSTlLr   47 (338)
T COG3839          27 EDGEFVVLL--GPSGCGKSTLLR   47 (338)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            678877777  999999999843


No 17 
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=94.87  E-value=0.014  Score=57.21  Aligned_cols=33  Identities=30%  Similarity=0.487  Sum_probs=24.4

Q ss_pred             ccccchh--ccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        268 LAEHMLI--LGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       268 LaeHm~i--~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |..||++  +-.|=.+|+..-+.  |||||||+||-.
T Consensus        12 l~g~cLLa~~n~Tia~GeivtlM--GPSGcGKSTLls   46 (213)
T COG4136          12 LPGSCLLANVNFTIAKGEIVTLM--GPSGCGKSTLLS   46 (213)
T ss_pred             CCCceEEEeeeEEecCCcEEEEE--CCCCccHHHHHH
Confidence            5678862  22344679888888  999999999854


No 18 
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=94.75  E-value=0.022  Score=61.92  Aligned_cols=37  Identities=32%  Similarity=0.492  Sum_probs=23.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccCC----CCCCCeeEEeeccE
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLNP----TLPGYKVECVGDDI  319 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~p----~~pgwk~~lIGDDi  319 (630)
                      ++|+..-+.  ||||||||||-++-.    +..| ++.+=|-|+
T Consensus        29 ~~Gef~~lL--GPSGcGKTTlLR~IAGfe~p~~G-~I~l~G~~i   69 (352)
T COG3842          29 KKGEFVTLL--GPSGCGKTTLLRMIAGFEQPSSG-EILLDGEDI   69 (352)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHHHhCCCCCCCc-eEEECCEEC
Confidence            568655555  999999999976432    2344 444444444


No 19 
>PF07475 Hpr_kinase_C:  HPr Serine kinase C-terminal domain;  InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the C-terminal kinase domain of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller [].; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 2QMH_C 1KKM_B 1KKL_C 1JB1_A 3TQF_B 1KNX_B 1KO7_A.
Probab=94.20  E-value=0.031  Score=55.17  Aligned_cols=61  Identities=28%  Similarity=0.265  Sum_probs=39.9

Q ss_pred             ccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccC
Q psy13077        268 LAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPE  336 (630)
Q Consensus       268 LaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE  336 (630)
                      ...|.+.+.|   .|.-..++  |+||.|||+||. .=-..|  -.+|+||...++...++.|++-.|+
T Consensus         7 ~~~Hg~~v~i---~G~GVLi~--G~SG~GKS~lAl-~Li~rG--h~lvaDD~v~i~~~~~~~l~g~~p~   67 (171)
T PF07475_consen    7 TTLHGSLVDI---GGVGVLIT--GPSGIGKSELAL-ELIKRG--HRLVADDRVEIRRIGGRTLIGRAPE   67 (171)
T ss_dssp             EEEESEEEEE---TTEEEEEE--ESTTSSHHHHHH-HHHHTT---EEEESSEEEEEECTTCEEEEEE-G
T ss_pred             ceeeEEEEEE---CCEEEEEE--CCCCCCHHHHHH-HHHHCC--CeEEeCCEEEEEECCCCEEEEeCCh
Confidence            4567765543   46568888  999999999986 111136  4999999877775555545544433


No 20 
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=93.85  E-value=0.05  Score=54.34  Aligned_cols=21  Identities=38%  Similarity=0.543  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+.+.++  |||||||+||--
T Consensus        27 ~~Ge~iait--GPSG~GKStllk   47 (223)
T COG4619          27 RAGEFIAIT--GPSGCGKSTLLK   47 (223)
T ss_pred             cCCceEEEe--CCCCccHHHHHH
Confidence            458889999  999999999843


No 21 
>PTZ00301 uridine kinase; Provisional
Probab=93.76  E-value=0.041  Score=55.60  Aligned_cols=17  Identities=29%  Similarity=0.360  Sum_probs=13.8

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      .+.-||+|||||||||.
T Consensus         5 iIgIaG~SgSGKTTla~   21 (210)
T PTZ00301          5 VIGISGASGSGKSSLST   21 (210)
T ss_pred             EEEEECCCcCCHHHHHH
Confidence            44456999999999994


No 22 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.74  E-value=0.038  Score=57.45  Aligned_cols=21  Identities=38%  Similarity=0.542  Sum_probs=16.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+..-+.  ||||||||||--
T Consensus        27 ~~GEfvsil--GpSGcGKSTLLr   47 (248)
T COG1116          27 EKGEFVAIL--GPSGCGKSTLLR   47 (248)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568766666  999999999854


No 23 
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.74  E-value=0.038  Score=56.32  Aligned_cols=22  Identities=41%  Similarity=0.604  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||--+
T Consensus        29 a~ge~vv~l--GpSGcGKTTLLnl   50 (259)
T COG4525          29 ASGELVVVL--GPSGCGKTTLLNL   50 (259)
T ss_pred             cCCCEEEEE--cCCCccHHHHHHH
Confidence            458887777  9999999999553


No 24 
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=93.49  E-value=0.03  Score=54.68  Aligned_cols=33  Identities=33%  Similarity=0.220  Sum_probs=23.6

Q ss_pred             EEeEcCCccchhhhcccC-CCCCCCeeEEeeccE
Q psy13077        287 IAAAFPSACGKTNLAMLN-PTLPGYKVECVGDDI  319 (630)
Q Consensus       287 f~~afpSg~GKTtLam~~-p~~pgwk~~lIGDDi  319 (630)
                      ++-+|||||||||||..- ..+.+.++.+++.|-
T Consensus         2 igi~G~~GsGKSTl~~~l~~~l~~~~~~v~~~D~   35 (198)
T cd02023           2 IGIAGGSGSGKTTVAEEIIEQLGNPKVVIISQDS   35 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCCeEEEEecc
Confidence            345699999999998732 223455788888885


No 25 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=93.39  E-value=0.047  Score=47.15  Aligned_cols=19  Identities=42%  Similarity=0.518  Sum_probs=16.2

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      +....++  ||+|||||||+.
T Consensus         2 ~~~~~l~--G~~G~GKTtl~~   20 (148)
T smart00382        2 GEVILIV--GPPGSGKTTLAR   20 (148)
T ss_pred             CCEEEEE--CCCCCcHHHHHH
Confidence            4567778  999999999987


No 26 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=93.30  E-value=0.044  Score=48.74  Aligned_cols=14  Identities=36%  Similarity=0.489  Sum_probs=12.4

Q ss_pred             eEcCCccchhhhcc
Q psy13077        289 AAFPSACGKTNLAM  302 (630)
Q Consensus       289 ~afpSg~GKTtLam  302 (630)
                      -+|+|||||||+|.
T Consensus         4 I~G~~gsGKST~a~   17 (121)
T PF13207_consen    4 ISGPPGSGKSTLAK   17 (121)
T ss_dssp             EEESTTSSHHHHHH
T ss_pred             EECCCCCCHHHHHH
Confidence            34999999999987


No 27 
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=92.89  E-value=0.059  Score=55.46  Aligned_cols=20  Identities=35%  Similarity=0.669  Sum_probs=16.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLA  301 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLa  301 (630)
                      |+++++-+.  ||||||||||-
T Consensus        31 ~~~~VTAlI--GPSGcGKST~L   50 (253)
T COG1117          31 PKNKVTALI--GPSGCGKSTLL   50 (253)
T ss_pred             cCCceEEEE--CCCCcCHHHHH
Confidence            677777777  99999999985


No 28 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=92.81  E-value=0.065  Score=55.10  Aligned_cols=21  Identities=33%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||-.
T Consensus        29 ~~Ge~vaI~--GpSGSGKSTLLn   49 (226)
T COG1136          29 EAGEFVAIV--GPSGSGKSTLLN   49 (226)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            678887777  999999999854


No 29 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=92.77  E-value=0.056  Score=53.49  Aligned_cols=21  Identities=38%  Similarity=0.336  Sum_probs=16.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|...-+.  |+||||||||+-
T Consensus         4 ~~g~vi~I~--G~sGsGKSTl~~   24 (207)
T TIGR00235         4 PKGIIIGIG--GGSGSGKTTVAR   24 (207)
T ss_pred             CCeEEEEEE--CCCCCCHHHHHH
Confidence            556554455  999999999986


No 30 
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=92.46  E-value=0.065  Score=54.85  Aligned_cols=38  Identities=29%  Similarity=0.116  Sum_probs=28.4

Q ss_pred             CCEEEEEeEcCCccchhhhccc-CCCCCCCeeEEeeccE
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML-NPTLPGYKVECVGDDI  319 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~-~p~~pgwk~~lIGDDi  319 (630)
                      -+...+.-||+|||||||+|-. .-.++++++.+|.-|=
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~l~~~~~~~~~~~I~~D~   44 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKELSEQLGVEKVVVISLDD   44 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHHHHHHhCcCcceEeeccc
Confidence            3458888889999999999863 2335667788888664


No 31 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=92.37  E-value=0.081  Score=54.48  Aligned_cols=21  Identities=33%  Similarity=0.411  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|++..+.  ||||||||||--
T Consensus        26 ~~Gevv~ii--GpSGSGKSTlLR   46 (240)
T COG1126          26 EKGEVVVII--GPSGSGKSTLLR   46 (240)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            579999999  999999999853


No 32 
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=92.32  E-value=0.068  Score=52.39  Aligned_cols=16  Identities=56%  Similarity=0.607  Sum_probs=13.8

Q ss_pred             EEeEcCCccchhhhcc
Q psy13077        287 IAAAFPSACGKTNLAM  302 (630)
Q Consensus       287 f~~afpSg~GKTtLam  302 (630)
                      ++-+|+|||||||||-
T Consensus         2 IgI~G~sgSGKTTla~   17 (194)
T PF00485_consen    2 IGIAGPSGSGKTTLAK   17 (194)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            4556999999999987


No 33 
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=92.30  E-value=0.078  Score=55.86  Aligned_cols=21  Identities=33%  Similarity=0.335  Sum_probs=17.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+-..+.  |||||||||+--
T Consensus        25 ~~gef~vli--GpSGsGKTTtLk   45 (309)
T COG1125          25 EEGEFLVLI--GPSGSGKTTTLK   45 (309)
T ss_pred             cCCeEEEEE--CCCCCcHHHHHH
Confidence            678777777  999999999854


No 34 
>PRK00300 gmk guanylate kinase; Provisional
Probab=92.07  E-value=0.093  Score=51.25  Aligned_cols=22  Identities=27%  Similarity=0.335  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||+.+
T Consensus         3 ~~g~~i~i~--G~sGsGKstl~~~   24 (205)
T PRK00300          3 RRGLLIVLS--GPSGAGKSTLVKA   24 (205)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            357777777  9999999999873


No 35 
>PRK08233 hypothetical protein; Provisional
Probab=91.93  E-value=0.086  Score=50.01  Aligned_cols=18  Identities=44%  Similarity=0.385  Sum_probs=14.5

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..++.+|+|||||||||.
T Consensus         4 ~iI~I~G~~GsGKtTla~   21 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTE   21 (182)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            444555999999999987


No 36 
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=91.84  E-value=0.14  Score=53.43  Aligned_cols=37  Identities=32%  Similarity=0.355  Sum_probs=26.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc----cCCCCCCCeeEEeeccE
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM----LNPTLPGYKVECVGDDI  319 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam----~~p~~pgwk~~lIGDDi  319 (630)
                      +.|+..-|.  ||||||||||--    +-++..| ++++-|.|+
T Consensus        32 ~~Gei~~ii--GgSGsGKStlLr~I~Gll~P~~G-eI~i~G~~i   72 (263)
T COG1127          32 PRGEILAIL--GGSGSGKSTLLRLILGLLRPDKG-EILIDGEDI   72 (263)
T ss_pred             cCCcEEEEE--CCCCcCHHHHHHHHhccCCCCCC-eEEEcCcch
Confidence            779888888  999999999843    2233455 455666555


No 37 
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=91.78  E-value=0.11  Score=51.11  Aligned_cols=21  Identities=24%  Similarity=0.192  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||--
T Consensus        19 ~~G~~~~l~--G~nG~GKSTLl~   39 (176)
T cd03238          19 PLNVLVVVT--GVSGSGKSTLVN   39 (176)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            678888888  999999999965


No 38 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=91.74  E-value=0.091  Score=47.86  Aligned_cols=16  Identities=31%  Similarity=0.432  Sum_probs=13.6

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      .+++  ||+||||||||.
T Consensus         2 ii~~--G~pgsGKSt~a~   17 (143)
T PF13671_consen    2 IILC--GPPGSGKSTLAK   17 (143)
T ss_dssp             EEEE--ESTTSSHHHHHH
T ss_pred             EEEE--CCCCCCHHHHHH
Confidence            3455  999999999987


No 39 
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene of Enterococcus faecalis encodes a bifunctional enzyme: the HPr kinase/phosphatase
Probab=91.72  E-value=0.13  Score=55.11  Aligned_cols=93  Identities=16%  Similarity=0.107  Sum_probs=57.2

Q ss_pred             CCCCeEEEEccccccccccccceeehhhhhhhhh-ccCcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCC
Q psy13077        230 PAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAK-REGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLP  308 (630)
Q Consensus       230 ~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~-~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~p  308 (630)
                      -++..|-++-|-+.+..      +...+-.|+.. -.+-...|.+.+.+   .|.-..+.  |+||.||||||. .=-..
T Consensus       102 a~~~~ip~l~t~~~~~~------~~~~l~~~L~~~la~~~~~hg~~v~i---~g~gvli~--G~sg~GKS~lal-~Li~r  169 (304)
T TIGR00679       102 NETYQVPILKTDLFSTE------LSFRLETYLNEQFAPTAAIHGVLVEV---YGVGVLIT--GKSGVGKSETAL-ELINR  169 (304)
T ss_pred             HHHhCCcEEEeCCcHHH------HHHHHHHHHHHhhccceeeeeEEEEE---CCEEEEEE--cCCCCCHHHHHH-HHHHc
Confidence            34555556667776663      22233333332 13566888875543   46668888  999999999876 11013


Q ss_pred             CCeeEEeeccEEEEEECCCccEEEeccC
Q psy13077        309 GYKVECVGDDIAWMKFDKEGVLRAINPE  336 (630)
Q Consensus       309 gwk~~lIGDDiaW~~~~~dG~l~a~NpE  336 (630)
                      |  -.+|.||...++-..+|+|++--||
T Consensus       170 g--~~lvaDD~~~~~~~~~~~L~g~~p~  195 (304)
T TIGR00679       170 G--HRLVADDAVEIYRLNGNRLFGRAQE  195 (304)
T ss_pred             C--CceeecCeEEEEEecCCEEEEeCCh
Confidence            5  4799999877774456766555444


No 40 
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=91.70  E-value=0.1  Score=51.22  Aligned_cols=21  Identities=38%  Similarity=0.504  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....++  |++|||||+|++
T Consensus        10 ~~g~i~~i~--G~~GsGKT~l~~   30 (209)
T TIGR02237        10 ERGTITQIY--GPPGSGKTNICM   30 (209)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHH
Confidence            779999999  999999999998


No 41 
>PRK06696 uridine kinase; Validated
Probab=91.64  E-value=0.1  Score=52.36  Aligned_cols=21  Identities=29%  Similarity=0.172  Sum_probs=18.1

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...++.+|+|||||||||.
T Consensus        20 ~~~~iI~I~G~sgsGKSTlA~   40 (223)
T PRK06696         20 TRPLRVAIDGITASGKTTFAD   40 (223)
T ss_pred             CCceEEEEECCCCCCHHHHHH
Confidence            456788888999999999986


No 42 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=91.63  E-value=0.11  Score=51.40  Aligned_cols=19  Identities=37%  Similarity=0.240  Sum_probs=15.1

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      ..++-+|+||||||||+..
T Consensus         7 ~iI~I~G~sGsGKTTl~~~   25 (209)
T PRK05480          7 IIIGIAGGSGSGKTTVAST   25 (209)
T ss_pred             EEEEEECCCCCCHHHHHHH
Confidence            4555559999999999873


No 43 
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=91.55  E-value=0.1  Score=49.89  Aligned_cols=18  Identities=33%  Similarity=0.445  Sum_probs=14.2

Q ss_pred             CEEEEEeEcCCccchhhhcc
Q psy13077        283 QKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam  302 (630)
                      +...+.  ||||||||||+-
T Consensus         2 ~~~~i~--G~sGsGKttl~~   19 (179)
T TIGR02322         2 RLIYVV--GPSGAGKDTLLD   19 (179)
T ss_pred             cEEEEE--CCCCCCHHHHHH
Confidence            344555  999999999984


No 44 
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=91.49  E-value=0.12  Score=55.95  Aligned_cols=63  Identities=27%  Similarity=0.334  Sum_probs=43.0

Q ss_pred             hhhhhhhhhccCcccccchhccccC-----CCCCEEEEEeEcCCccchhhhccc----CCCCCCCeeEEeeccEE
Q psy13077        255 LRIGSTIAKREGWLAEHMLILGITN-----PEGQKKYIAAAFPSACGKTNLAML----NPTLPGYKVECVGDDIA  320 (630)
Q Consensus       255 lrias~~a~~eGwLaeHm~i~gv~~-----p~G~~~~f~~afpSg~GKTtLam~----~p~~pgwk~~lIGDDia  320 (630)
                      +++...=..+.-+++.+...+|+.+     ++|+...+.  |+|||||+||.-+    .++-.| ++.+=|+|++
T Consensus        22 ~~~~~~G~~k~ei~~~tg~vvGv~~~sl~v~~GeIfViM--GLSGSGKSTLvR~~NrLiept~G-~ilv~g~di~   93 (386)
T COG4175          22 LKLLDQGKSKAEILKKTGLVVGVNDASLDVEEGEIFVIM--GLSGSGKSTLVRLLNRLIEPTRG-EILVDGKDIA   93 (386)
T ss_pred             HHHHHcCCcHHHHHHhhCcEEeeccceeeecCCeEEEEE--ecCCCCHHHHHHHHhccCCCCCc-eEEECCcchh
Confidence            5544433446668888888888765     568878888  9999999999752    222345 4666666663


No 45 
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=91.34  E-value=0.11  Score=51.99  Aligned_cols=35  Identities=23%  Similarity=0.277  Sum_probs=25.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccCCC---CCCCeeEEee
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLNPT---LPGYKVECVG  316 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~p~---~pgwk~~lIG  316 (630)
                      .+|-+.+|+  ||||+||||||.+--.   ..|+.+.++=
T Consensus        21 ~~~~viW~T--GLSGsGKSTiA~ale~~L~~~G~~~y~LD   58 (197)
T COG0529          21 QKGAVIWFT--GLSGSGKSTIANALEEKLFAKGYHVYLLD   58 (197)
T ss_pred             CCCeEEEee--cCCCCCHHHHHHHHHHHHHHcCCeEEEec
Confidence            457789999  9999999999973211   2577777663


No 46 
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=91.19  E-value=0.13  Score=50.37  Aligned_cols=20  Identities=20%  Similarity=0.195  Sum_probs=17.1

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |+...+.  ||||||||||+-+
T Consensus         3 ge~i~l~--G~sGsGKSTl~~~   22 (176)
T PRK09825          3 GESYILM--GVSGSGKSLIGSK   22 (176)
T ss_pred             CcEEEEE--CCCCCCHHHHHHH
Confidence            6777788  9999999999863


No 47 
>PRK14738 gmk guanylate kinase; Provisional
Probab=91.15  E-value=0.14  Score=51.11  Aligned_cols=19  Identities=26%  Similarity=0.204  Sum_probs=14.8

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++..++.  ||||||||||+-
T Consensus        13 ~~~ivi~--GpsG~GK~tl~~   31 (206)
T PRK14738         13 PLLVVIS--GPSGVGKDAVLA   31 (206)
T ss_pred             CeEEEEE--CcCCCCHHHHHH
Confidence            4455555  999999999965


No 48 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=91.15  E-value=0.13  Score=48.04  Aligned_cols=20  Identities=15%  Similarity=0.189  Sum_probs=17.0

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...+++  |++||||||+|-
T Consensus         3 ~~~~i~l~--G~~GsGKstla~   22 (175)
T PRK00131          3 KGPNIVLI--GFMGAGKSTIGR   22 (175)
T ss_pred             CCCeEEEE--cCCCCCHHHHHH
Confidence            46677788  999999999976


No 49 
>PRK08118 topology modulation protein; Reviewed
Probab=91.10  E-value=0.12  Score=50.02  Aligned_cols=17  Identities=29%  Similarity=0.298  Sum_probs=14.7

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      +.+++  |||||||||||-
T Consensus         3 rI~I~--G~~GsGKSTlak   19 (167)
T PRK08118          3 KIILI--GSGGSGKSTLAR   19 (167)
T ss_pred             EEEEE--CCCCCCHHHHHH
Confidence            46677  999999999987


No 50 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=91.06  E-value=0.13  Score=49.14  Aligned_cols=19  Identities=37%  Similarity=0.429  Sum_probs=15.3

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+...+.  ||||||||||+.
T Consensus         1 g~ii~l~--G~~GsGKsTl~~   19 (180)
T TIGR03263         1 GLLIVIS--GPSGVGKSTLVK   19 (180)
T ss_pred             CcEEEEE--CCCCCCHHHHHH
Confidence            4455666  999999999976


No 51 
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=91.01  E-value=0.15  Score=51.28  Aligned_cols=45  Identities=24%  Similarity=0.418  Sum_probs=34.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc----CCCCCCCeeEEeeccEEEEEECCCcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML----NPTLPGYKVECVGDDIAWMKFDKEGV  329 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~----~p~~pgwk~~lIGDDiaW~~~~~dG~  329 (630)
                      ..|++.-+.  ||||+||+||-|+    +-+..| .|.+.|-+..=|  |+|++
T Consensus        34 ~~Ge~vaiV--G~SGSGKSTLl~vlAGLd~~ssG-eV~l~G~~L~~l--dEd~r   82 (228)
T COG4181          34 KRGETVAIV--GPSGSGKSTLLAVLAGLDDPSSG-EVRLLGQPLHKL--DEDAR   82 (228)
T ss_pred             cCCceEEEE--cCCCCcHHhHHHHHhcCCCCCCc-eEEEcCcchhhc--CHHHH
Confidence            458888777  9999999999874    334456 699999997433  88886


No 52 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=90.98  E-value=0.17  Score=42.20  Aligned_cols=19  Identities=37%  Similarity=0.670  Sum_probs=16.8

Q ss_pred             CCCCEEEEEeEcCCccchhhh
Q psy13077        280 PEGQKKYIAAAFPSACGKTNL  300 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtL  300 (630)
                      +.|+...|.  |+||+|||||
T Consensus        21 ~~g~~tli~--G~nGsGKSTl   39 (62)
T PF13555_consen   21 PRGDVTLIT--GPNGSGKSTL   39 (62)
T ss_pred             CCCcEEEEE--CCCCCCHHHH
Confidence            567788888  9999999998


No 53 
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=90.78  E-value=0.14  Score=53.26  Aligned_cols=23  Identities=35%  Similarity=0.307  Sum_probs=19.4

Q ss_pred             CCCCCEEEEEeEcCCccchhhhccc
Q psy13077        279 NPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       279 ~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      =..|++.=+.  |+||||||||+.+
T Consensus        30 i~~Ge~lgiv--GeSGsGKSTL~r~   52 (252)
T COG1124          30 IERGETLGIV--GESGSGKSTLARL   52 (252)
T ss_pred             ecCCCEEEEE--cCCCCCHHHHHHH
Confidence            3678887777  9999999999884


No 54 
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=90.73  E-value=0.14  Score=49.82  Aligned_cols=20  Identities=30%  Similarity=0.449  Sum_probs=15.5

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |+...+.  ||||||||||+.+
T Consensus         2 g~~i~l~--G~sGsGKsTl~~~   21 (186)
T PRK10078          2 GKLIWLM--GPSGSGKDSLLAA   21 (186)
T ss_pred             CcEEEEE--CCCCCCHHHHHHH
Confidence            4445555  9999999999874


No 55 
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=90.69  E-value=0.15  Score=51.48  Aligned_cols=22  Identities=32%  Similarity=0.347  Sum_probs=18.6

Q ss_pred             CCCCCEEEEEeEcCCccchhhhcc
Q psy13077        279 NPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       279 ~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      =+.|+..-+.  |+||||||||++
T Consensus        18 i~~Ge~~~l~--G~sGsGKSTL~~   39 (226)
T cd03270          18 IPRNKLVVIT--GVSGSGKSSLAF   39 (226)
T ss_pred             cCCCcEEEEE--cCCCCCHHHHHH
Confidence            3679887777  999999999974


No 56 
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=90.60  E-value=0.21  Score=54.70  Aligned_cols=28  Identities=25%  Similarity=0.370  Sum_probs=20.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc----cCCCCCC
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM----LNPTLPG  309 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam----~~p~~pg  309 (630)
                      +.|+..-++  ||||||||||.-    +.++..|
T Consensus        43 ~~Ge~~~ll--GpsGsGKSTLLr~IaGl~~p~~G   74 (377)
T PRK11607         43 YKGEIFALL--GASGCGKSTLLRMLAGFEQPTAG   74 (377)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHHHHhCCCCCCce
Confidence            468877788  999999999943    3444455


No 57 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=90.53  E-value=0.17  Score=48.42  Aligned_cols=21  Identities=33%  Similarity=0.463  Sum_probs=17.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|....|.  |+|||||||+|-
T Consensus         5 ~~~~~I~i~--G~~GsGKst~a~   25 (176)
T PRK05541          5 PNGYVIWIT--GLAGSGKTTIAK   25 (176)
T ss_pred             CCCCEEEEE--cCCCCCHHHHHH
Confidence            456677777  999999999986


No 58 
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=90.49  E-value=0.15  Score=50.40  Aligned_cols=21  Identities=33%  Similarity=0.488  Sum_probs=19.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+...++  |+||||||||++
T Consensus        17 ~~g~i~~i~--G~~GsGKT~l~~   37 (218)
T cd01394          17 ERGTVTQVY--GPPGTGKTNIAI   37 (218)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHH
Confidence            678888899  999999999988


No 59 
>PRK07261 topology modulation protein; Provisional
Probab=90.47  E-value=0.15  Score=49.44  Aligned_cols=17  Identities=41%  Similarity=0.258  Sum_probs=14.3

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      +..+.  |+|||||||||.
T Consensus         2 ri~i~--G~~GsGKSTla~   18 (171)
T PRK07261          2 KIAII--GYSGSGKSTLAR   18 (171)
T ss_pred             EEEEE--cCCCCCHHHHHH
Confidence            34566  999999999997


No 60 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=90.45  E-value=0.24  Score=48.75  Aligned_cols=22  Identities=36%  Similarity=0.539  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        26 ~~G~~~~l~--G~nGsGKSTLl~~   47 (214)
T TIGR02673        26 RKGEFLFLT--GPSGAGKTTLLKL   47 (214)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 61 
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=90.41  E-value=0.24  Score=49.82  Aligned_cols=22  Identities=27%  Similarity=0.330  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||..+
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~~   46 (236)
T TIGR03864        25 RPGEFVALL--GPNGAGKSTLFSL   46 (236)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 62 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=90.35  E-value=0.19  Score=44.13  Aligned_cols=21  Identities=33%  Similarity=0.423  Sum_probs=17.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.+...++.  ||+|||||+|+.
T Consensus        17 ~~~~~v~i~--G~~G~GKT~l~~   37 (151)
T cd00009          17 PPPKNLLLY--GPPGTGKTTLAR   37 (151)
T ss_pred             CCCCeEEEE--CCCCCCHHHHHH
Confidence            345667787  999999999987


No 63 
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=90.28  E-value=0.13  Score=51.86  Aligned_cols=21  Identities=29%  Similarity=0.442  Sum_probs=16.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...++-+||||+|||||+-
T Consensus        31 ~~~~iigi~G~~GsGKTTl~~   51 (229)
T PRK09270         31 QRRTIVGIAGPPGAGKSTLAE   51 (229)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            455666667999999999875


No 64 
>PF01583 APS_kinase:  Adenylylsulphate kinase;  InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....
Probab=90.27  E-value=0.15  Score=49.63  Aligned_cols=35  Identities=31%  Similarity=0.273  Sum_probs=23.9

Q ss_pred             CCEEEEEeEcCCccchhhhcccCC-C--CCCCeeEEeecc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAMLNP-T--LPGYKVECVGDD  318 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~~p-~--~pgwk~~lIGDD  318 (630)
                      |-+.+|+  |+||+||||||..-- .  ..|+++.++.=|
T Consensus         2 g~vIwlt--GlsGsGKtTlA~~L~~~L~~~g~~~~~LDgD   39 (156)
T PF01583_consen    2 GFVIWLT--GLSGSGKTTLARALERRLFARGIKVYLLDGD   39 (156)
T ss_dssp             -EEEEEE--SSTTSSHHHHHHHHHHHHHHTTS-EEEEEHH
T ss_pred             CEEEEEE--CCCCCCHHHHHHHHHHHHHHcCCcEEEecCc
Confidence            5567888  999999999997311 1  146778887555


No 65 
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=90.25  E-value=0.17  Score=48.63  Aligned_cols=19  Identities=26%  Similarity=0.324  Sum_probs=16.2

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+..++.  |+|||||||+|.
T Consensus         2 ~~~i~l~--G~~gsGKst~a~   20 (175)
T cd00227           2 GRIIILN--GGSSAGKSSIAR   20 (175)
T ss_pred             CCEEEEE--CCCCCCHHHHHH
Confidence            5566667  999999999997


No 66 
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=90.01  E-value=0.12  Score=58.59  Aligned_cols=70  Identities=34%  Similarity=0.488  Sum_probs=47.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccC----CCCCCCeeEEeeccE-EEEEECCCccEEEeccCCCeeEeccCCCCCCcHHH
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLN----PTLPGYKVECVGDDI-AWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIA  354 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~----p~~pgwk~~lIGDDi-aW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i  354 (630)
                      +.|+..=+.  ||||+|||||+-+-    |+..| +|++=|-|+ -|   |.+           .||+-+|+-+.+ =  
T Consensus       360 ~~G~~lgII--GPSgSGKSTLaR~lvG~w~p~~G-~VRLDga~l~qW---d~e-----------~lG~hiGYLPQd-V--  419 (580)
T COG4618         360 QAGEALGII--GPSGSGKSTLARLLVGIWPPTSG-SVRLDGADLRQW---DRE-----------QLGRHIGYLPQD-V--  419 (580)
T ss_pred             cCCceEEEE--CCCCccHHHHHHHHHcccccCCC-cEEecchhhhcC---CHH-----------HhccccCcCccc-c--
Confidence            347666666  99999999998632    44456 677777776 67   433           377777775431 1  


Q ss_pred             HhhccCCceeEcceEcC
Q psy13077        355 MKTVFKNTIFTNVASTS  371 (630)
Q Consensus       355 ~~ai~~~tIf~NV~~~~  371 (630)
                        -+-.|||-||++--+
T Consensus       420 --eLF~GTIaeNIaRf~  434 (580)
T COG4618         420 --ELFDGTIAENIARFG  434 (580)
T ss_pred             --eecCCcHHHHHHhcc
Confidence              134689999987654


No 67 
>PRK06547 hypothetical protein; Provisional
Probab=89.88  E-value=0.19  Score=49.21  Aligned_cols=21  Identities=33%  Similarity=0.214  Sum_probs=16.2

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      +....+...|+|||||||||-
T Consensus        13 ~~~~~i~i~G~~GsGKTt~a~   33 (172)
T PRK06547         13 GGMITVLIDGRSGSGKTTLAG   33 (172)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            334555666999999999986


No 68 
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=89.85  E-value=0.19  Score=50.04  Aligned_cols=21  Identities=29%  Similarity=0.184  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+...+.  |+||||||+|++
T Consensus        17 ~~g~i~~i~--G~~GsGKT~l~~   37 (235)
T cd01123          17 ETGSITEIF--GEFGSGKTQLCH   37 (235)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHH
Confidence            678888888  999999999997


No 69 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=89.70  E-value=0.19  Score=45.65  Aligned_cols=21  Identities=29%  Similarity=0.357  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |++|||||||.-
T Consensus         9 ~~g~~~~i~--G~nGsGKStLl~   29 (137)
T PF00005_consen    9 KPGEIVAIV--GPNGSGKSTLLK   29 (137)
T ss_dssp             ETTSEEEEE--ESTTSSHHHHHH
T ss_pred             cCCCEEEEE--ccCCCcccccee
Confidence            568888899  999999999965


No 70 
>PRK05428 HPr kinase/phosphorylase; Provisional
Probab=89.67  E-value=0.26  Score=52.93  Aligned_cols=92  Identities=21%  Similarity=0.142  Sum_probs=51.9

Q ss_pred             cCCCCeEEEEccccccccccccceeehhhhhhhhhccCcccccchhccccCCCCCEEEEEeEcCCccchhhhcccCCCCC
Q psy13077        229 KPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAKREGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAMLNPTLP  308 (630)
Q Consensus       229 ~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~p  308 (630)
                      .-++..|-++-|.+.-..+ +-+. ..=+...+|++   ...|...+-|   .|.-..+.  |+||.|||+||. .=-.-
T Consensus       101 ~a~~~~ipll~t~~~t~~~-i~~l-~~~L~~~la~~---~~iHg~~v~V---~G~GvLi~--G~SG~GKSelAL-eLi~r  169 (308)
T PRK05428        101 AAKEAGIPLLRTPLSTTRL-ISKL-TNYLDRKLAPR---TSVHGVLVDI---YGIGVLIT--GESGIGKSETAL-ELIKR  169 (308)
T ss_pred             HHHHcCCcEEEeCCcHHHH-HHHH-HHHHHHHhhhc---ceeeeEEEEE---CCEEEEEE--cCCCCCHHHHHH-HHHHc
Confidence            3456666677777755432 1111 12222333333   3557664433   35558888  999999999886 11012


Q ss_pred             CCeeEEeeccEEEEEECCCccEEEe
Q psy13077        309 GYKVECVGDDIAWMKFDKEGVLRAI  333 (630)
Q Consensus       309 gwk~~lIGDDiaW~~~~~dG~l~a~  333 (630)
                      |  -.+|+||...++-..+..|.+-
T Consensus       170 G--h~LVaDD~v~i~~~~~~~L~g~  192 (308)
T PRK05428        170 G--HRLVADDAVDIKRIGPDTLEGR  192 (308)
T ss_pred             C--CceEecCeEEEEEecCCEEEee
Confidence            5  4799999887773333334333


No 71 
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=89.65  E-value=0.23  Score=51.55  Aligned_cols=30  Identities=33%  Similarity=0.437  Sum_probs=23.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccCCCCCCCe
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLNPTLPGYK  311 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk  311 (630)
                      +.|+++-+.  ||.|+||||||..---.|+|+
T Consensus        28 ~~GEvhaiM--GPNGsGKSTLa~~i~G~p~Y~   57 (251)
T COG0396          28 KEGEVHAIM--GPNGSGKSTLAYTIMGHPKYE   57 (251)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHHHhCCCCce
Confidence            569999999  999999999998543345653


No 72 
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=89.64  E-value=0.18  Score=52.17  Aligned_cols=21  Identities=24%  Similarity=0.110  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |++|||||+|++
T Consensus        34 p~gs~~lI~--G~pGtGKT~l~~   54 (259)
T TIGR03878        34 PAYSVINIT--GVSDTGKSLMVE   54 (259)
T ss_pred             ECCcEEEEE--cCCCCCHHHHHH
Confidence            778889998  999999999998


No 73 
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=89.46  E-value=0.17  Score=52.31  Aligned_cols=18  Identities=33%  Similarity=0.373  Sum_probs=15.5

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..+|.  ||.||||||||.+
T Consensus        52 h~lf~--GPPG~GKTTLA~I   69 (233)
T PF05496_consen   52 HMLFY--GPPGLGKTTLARI   69 (233)
T ss_dssp             EEEEE--SSTTSSHHHHHHH
T ss_pred             eEEEE--CCCccchhHHHHH
Confidence            46677  9999999999985


No 74 
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.43  E-value=0.33  Score=48.51  Aligned_cols=21  Identities=33%  Similarity=0.339  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||..
T Consensus        29 ~~Ge~~~l~--G~nGsGKSTLl~   49 (233)
T cd03258          29 PKGEIFGII--GRSGAGKSTLIR   49 (233)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 75 
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=89.15  E-value=0.23  Score=49.11  Aligned_cols=21  Identities=33%  Similarity=0.398  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+.+.++  |+||||||+|++
T Consensus        17 ~~g~v~~I~--G~~GsGKT~l~~   37 (226)
T cd01393          17 PTGRITEIF--GEFGSGKTQLCL   37 (226)
T ss_pred             cCCcEEEEe--CCCCCChhHHHH
Confidence            679999999  999999999988


No 76 
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=89.14  E-value=0.34  Score=49.81  Aligned_cols=22  Identities=23%  Similarity=0.354  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        35 ~~Ge~~~i~--G~nGsGKSTLl~~   56 (265)
T PRK10575         35 PAGKVTGLI--GHNGSGKSTLLKM   56 (265)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 77 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=89.12  E-value=0.25  Score=48.83  Aligned_cols=22  Identities=32%  Similarity=0.400  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||.-+
T Consensus        28 ~~G~~~~l~--G~nGsGKSTLl~~   49 (218)
T cd03255          28 EKGEFVAIV--GPSGSGKSTLLNI   49 (218)
T ss_pred             cCCCEEEEE--cCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 78 
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.09  E-value=0.25  Score=49.53  Aligned_cols=22  Identities=27%  Similarity=0.285  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~~   46 (241)
T cd03256          25 NPGEFVALI--GPSGAGKSTLLRC   46 (241)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 79 
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=89.06  E-value=0.33  Score=51.20  Aligned_cols=37  Identities=32%  Similarity=0.506  Sum_probs=25.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc----CCCCCCCeeEEeeccE
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML----NPTLPGYKVECVGDDI  319 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~----~p~~pgwk~~lIGDDi  319 (630)
                      .+|++.-+.  |.||||||||+-+    .++..| ++..=|.|+
T Consensus        37 ~~ge~~glV--GESG~GKSTlgr~i~~L~~pt~G-~i~f~g~~i   77 (268)
T COG4608          37 KEGETLGLV--GESGCGKSTLGRLILGLEEPTSG-EILFEGKDI   77 (268)
T ss_pred             cCCCEEEEE--ecCCCCHHHHHHHHHcCcCCCCc-eEEEcCcch
Confidence            678887777  9999999999862    233345 355555553


No 80 
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=89.00  E-value=0.35  Score=51.86  Aligned_cols=22  Identities=36%  Similarity=0.546  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||+.+
T Consensus        39 ~~Ge~~~Iv--G~sGsGKSTLl~~   60 (327)
T PRK11308         39 ERGKTLAVV--GESGCGKSTLARL   60 (327)
T ss_pred             CCCCEEEEE--CCCCCcHHHHHHH
Confidence            568888888  9999999999763


No 81 
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=89.00  E-value=0.26  Score=48.72  Aligned_cols=22  Identities=23%  Similarity=0.404  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||.-+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (216)
T TIGR00960        27 TKGEMVFLV--GHSGAGKSTFLKL   48 (216)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 82 
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=88.98  E-value=0.26  Score=48.42  Aligned_cols=22  Identities=27%  Similarity=0.288  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||.-+
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~~   45 (205)
T cd03226          24 YAGEIIALT--GKNGAGKTTLAKI   45 (205)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999653


No 83 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=88.94  E-value=0.25  Score=48.64  Aligned_cols=23  Identities=22%  Similarity=0.206  Sum_probs=18.7

Q ss_pred             CCCCCEEEEEeEcCCccchhhhccc
Q psy13077        279 NPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       279 ~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      .+.|....++  |+||||||||+.+
T Consensus        21 ~~~~~~i~i~--G~~GsGKSTla~~   43 (198)
T PRK03846         21 GHKGVVLWFT--GLSGSGKSTVAGA   43 (198)
T ss_pred             CCCCEEEEEE--CCCCCCHHHHHHH
Confidence            3567777777  9999999999873


No 84 
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=88.93  E-value=0.24  Score=56.13  Aligned_cols=21  Identities=19%  Similarity=0.325  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+...++  ||||||||||..
T Consensus        30 ~~GEiv~L~--G~SGsGKSTLLr   50 (504)
T TIGR03238        30 PSSSLLFLC--GSSGDGKSEILA   50 (504)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHh
Confidence            679999999  999999999954


No 85 
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=88.89  E-value=0.25  Score=50.35  Aligned_cols=21  Identities=29%  Similarity=0.346  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....+.  |++||||||||+
T Consensus        22 ~~g~~~~i~--G~~G~GKTtl~~   42 (230)
T PRK08533         22 PAGSLILIE--GDESTGKSILSQ   42 (230)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHH
Confidence            678888888  999999999975


No 86 
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.87  E-value=0.37  Score=48.73  Aligned_cols=22  Identities=36%  Similarity=0.400  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (241)
T PRK14250         27 EGGAIYTIV--GPSGAGKSTLIKL   48 (241)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 87 
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=88.77  E-value=0.27  Score=49.37  Aligned_cols=22  Identities=32%  Similarity=0.303  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||.-+
T Consensus        26 ~~Ge~~~l~--G~nGsGKSTLl~~   47 (243)
T TIGR02315        26 NPGEFVAII--GPSGAGKSTLLRC   47 (243)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999663


No 88 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=88.75  E-value=0.27  Score=48.38  Aligned_cols=21  Identities=29%  Similarity=0.395  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        25 ~~G~~~~l~--G~nGsGKSTLl~   45 (211)
T cd03225          25 KKGEFVLIV--GPNGSGKSTLLR   45 (211)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 89 
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=88.69  E-value=0.38  Score=55.15  Aligned_cols=36  Identities=33%  Similarity=0.409  Sum_probs=26.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc----cCCCCCCCeeEEeecc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM----LNPTLPGYKVECVGDD  318 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam----~~p~~pgwk~~lIGDD  318 (630)
                      ..|++.=+.  |.|||||||||-    |.++..| .+.+.|.|
T Consensus       315 ~~GE~lglV--GeSGsGKSTlar~i~gL~~P~~G-~i~~~g~~  354 (539)
T COG1123         315 REGETLGLV--GESGSGKSTLARILAGLLPPSSG-SIIFDGQD  354 (539)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHHHhCCCCCCCc-eEEEeCcc
Confidence            679887777  999999999985    3444445 45666666


No 90 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=88.67  E-value=0.24  Score=43.97  Aligned_cols=15  Identities=40%  Similarity=0.496  Sum_probs=12.8

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      ++.  ||+|||||+|+-
T Consensus         2 ll~--G~~G~GKT~l~~   16 (132)
T PF00004_consen    2 LLH--GPPGTGKTTLAR   16 (132)
T ss_dssp             EEE--SSTTSSHHHHHH
T ss_pred             EEE--CcCCCCeeHHHH
Confidence            455  999999999976


No 91 
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=88.60  E-value=0.17  Score=48.73  Aligned_cols=12  Identities=33%  Similarity=0.268  Sum_probs=11.3

Q ss_pred             cCCccchhhhcc
Q psy13077        291 FPSACGKTNLAM  302 (630)
Q Consensus       291 fpSg~GKTtLam  302 (630)
                      ||||||||||+-
T Consensus         2 G~sGsGKSTla~   13 (163)
T PRK11545          2 GVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCcHHHHHH
Confidence            899999999986


No 92 
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=88.58  E-value=0.39  Score=48.33  Aligned_cols=21  Identities=24%  Similarity=0.235  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        27 ~~Ge~~~l~--G~nGsGKSTLl~   47 (241)
T PRK10895         27 NSGEIVGLL--GPNGAGKTTTFY   47 (241)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999966


No 93 
>PRK08084 DNA replication initiation factor; Provisional
Probab=88.58  E-value=0.27  Score=50.06  Aligned_cols=21  Identities=14%  Similarity=0.210  Sum_probs=17.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.+...|++  ||+|||||+|+.
T Consensus        43 ~~~~~l~l~--Gp~G~GKThLl~   63 (235)
T PRK08084         43 EHSGYIYLW--SREGAGRSHLLH   63 (235)
T ss_pred             CCCCeEEEE--CCCCCCHHHHHH
Confidence            334567888  999999999987


No 94 
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.57  E-value=0.41  Score=47.11  Aligned_cols=21  Identities=33%  Similarity=0.442  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  ||||||||||..
T Consensus        22 ~~Ge~~~l~--G~nGsGKSTLl~   42 (211)
T cd03298          22 AQGEITAIV--GPSGSGKSTLLN   42 (211)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 95 
>PLN02348 phosphoribulokinase
Probab=88.54  E-value=0.26  Score=54.51  Aligned_cols=21  Identities=29%  Similarity=0.393  Sum_probs=17.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...+.-||+|||||||||.
T Consensus        47 ~~p~IIGIaG~SGSGKSTfA~   67 (395)
T PLN02348         47 DGTVVIGLAADSGCGKSTFMR   67 (395)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            456888888999999999875


No 96 
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=88.53  E-value=0.23  Score=55.83  Aligned_cols=22  Identities=45%  Similarity=0.683  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  ||||||||||+.+
T Consensus       359 ~~G~~vaIv--G~SGsGKSTLl~l  380 (529)
T TIGR02868       359 PPGERVAIL--GPSGSGKSTLLML  380 (529)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999898  9999999999875


No 97 
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=88.51  E-value=0.19  Score=47.45  Aligned_cols=13  Identities=23%  Similarity=0.235  Sum_probs=12.0

Q ss_pred             cCCccchhhhccc
Q psy13077        291 FPSACGKTNLAML  303 (630)
Q Consensus       291 fpSg~GKTtLam~  303 (630)
                      |||||||||+|..
T Consensus         5 G~~GsGKSTla~~   17 (163)
T TIGR01313         5 GVAGSGKSTIASA   17 (163)
T ss_pred             CCCCCCHHHHHHH
Confidence            9999999999884


No 98 
>PRK07667 uridine kinase; Provisional
Probab=88.44  E-value=0.29  Score=48.24  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=17.4

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...++-+|+|||||||||.
T Consensus        15 ~~~~iIgI~G~~gsGKStla~   35 (193)
T PRK07667         15 ENRFILGIDGLSRSGKTTFVA   35 (193)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            445777888999999999876


No 99 
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=88.39  E-value=0.3  Score=48.43  Aligned_cols=22  Identities=27%  Similarity=0.277  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        29 ~~Ge~~~i~--G~nGsGKSTLl~~   50 (228)
T cd03257          29 KKGETLGLV--GESGSGKSTLARA   50 (228)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            579888888  9999999999763


No 100
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=88.37  E-value=0.24  Score=43.77  Aligned_cols=13  Identities=31%  Similarity=0.281  Sum_probs=11.9

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      .|++|+||||||.
T Consensus         4 ~G~~GsGKtTia~   16 (129)
T PF13238_consen    4 SGIPGSGKTTIAK   16 (129)
T ss_dssp             EESTTSSHHHHHH
T ss_pred             ECCCCCCHHHHHH
Confidence            3999999999987


No 101
>PRK00889 adenylylsulfate kinase; Provisional
Probab=88.36  E-value=0.28  Score=46.91  Aligned_cols=37  Identities=30%  Similarity=0.385  Sum_probs=23.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccCC-C--CCCCeeEEeecc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLNP-T--LPGYKVECVGDD  318 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~p-~--~pgwk~~lIGDD  318 (630)
                      +.|+...+.  |+|||||||+|..-- .  ..|+++.+|.-|
T Consensus         2 ~~g~~i~~~--G~~GsGKST~a~~la~~l~~~g~~v~~id~D   41 (175)
T PRK00889          2 QRGVTVWFT--GLSGAGKTTIARALAEKLREAGYPVEVLDGD   41 (175)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHHHHHHHHHHcCCeEEEEcCc
Confidence            457777777  999999999986211 0  135556555433


No 102
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=88.30  E-value=0.31  Score=47.27  Aligned_cols=21  Identities=19%  Similarity=0.290  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        16 ~~Ge~~~i~--G~nGsGKSTLl~   36 (190)
T TIGR01166        16 ERGEVLALL--GANGAGKSTLLL   36 (190)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888788  999999999964


No 103
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=88.30  E-value=0.31  Score=48.57  Aligned_cols=21  Identities=38%  Similarity=0.705  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (227)
T cd03260          24 PKGEITALI--GPSGCGKSTLLR   44 (227)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 104
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=88.29  E-value=0.31  Score=48.09  Aligned_cols=22  Identities=27%  Similarity=0.304  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        23 ~~Ge~~~l~--G~nGsGKSTLl~~   44 (213)
T cd03235          23 KPGEFLAIV--GPNGAGKSTLLKA   44 (213)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 105
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=88.28  E-value=0.22  Score=48.64  Aligned_cols=16  Identities=44%  Similarity=0.546  Sum_probs=13.3

Q ss_pred             EEeEcCCccchhhhcc
Q psy13077        287 IAAAFPSACGKTNLAM  302 (630)
Q Consensus       287 f~~afpSg~GKTtLam  302 (630)
                      ++-+|+|||||||||.
T Consensus         2 i~i~G~sgsGKttla~   17 (179)
T cd02028           2 VGIAGPSGSGKTTFAK   17 (179)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3445999999999987


No 106
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=88.24  E-value=0.27  Score=53.14  Aligned_cols=21  Identities=43%  Similarity=0.597  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+.+.++  ||+||||||||+
T Consensus        53 p~G~iteI~--Gp~GsGKTtLal   73 (325)
T cd00983          53 PKGRIIEIY--GPESSGKTTLAL   73 (325)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHH
Confidence            889999999  999999999998


No 107
>PRK06762 hypothetical protein; Provisional
Probab=88.24  E-value=0.27  Score=46.48  Aligned_cols=16  Identities=38%  Similarity=0.291  Sum_probs=13.4

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..++  |+|||||||+|.
T Consensus         5 i~i~--G~~GsGKST~A~   20 (166)
T PRK06762          5 IIIR--GNSGSGKTTIAK   20 (166)
T ss_pred             EEEE--CCCCCCHHHHHH
Confidence            4455  999999999987


No 108
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact
Probab=88.23  E-value=0.38  Score=52.57  Aligned_cols=21  Identities=24%  Similarity=0.173  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||..
T Consensus        17 ~~Gei~~l~--G~sGsGKSTLLr   37 (363)
T TIGR01186        17 AKGEIFVIM--GLSGSGKSTTVR   37 (363)
T ss_pred             cCCCEEEEE--CCCCChHHHHHH
Confidence            579888888  999999999965


No 109
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=88.22  E-value=0.42  Score=47.89  Aligned_cols=21  Identities=29%  Similarity=0.249  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||..
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (237)
T cd03252          26 KPGEVVGIV--GRSGSGKSTLTK   46 (237)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 110
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.19  E-value=0.31  Score=47.93  Aligned_cols=22  Identities=23%  Similarity=0.264  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        24 ~~G~~~~i~--G~nGsGKSTLl~~   45 (210)
T cd03269          24 EKGEIFGLL--GPNGAGKTTTIRM   45 (210)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 111
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=88.17  E-value=0.31  Score=48.91  Aligned_cols=21  Identities=33%  Similarity=0.362  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (235)
T cd03261          24 RRGEILAII--GPSGSGKSTLLR   44 (235)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 112
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=88.16  E-value=0.21  Score=50.53  Aligned_cols=16  Identities=38%  Similarity=0.291  Sum_probs=13.3

Q ss_pred             EEeEcCCccchhhhcc
Q psy13077        287 IAAAFPSACGKTNLAM  302 (630)
Q Consensus       287 f~~afpSg~GKTtLam  302 (630)
                      +.-+|+|||||||||.
T Consensus         2 igI~G~sGSGKTTla~   17 (220)
T cd02025           2 IGIAGSVAVGKSTTAR   17 (220)
T ss_pred             EEeeCCCCCCHHHHHH
Confidence            3456999999999985


No 113
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=88.10  E-value=0.32  Score=47.74  Aligned_cols=22  Identities=32%  Similarity=0.368  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||.-+
T Consensus        24 ~~G~~~~l~--G~nGsGKSTLl~~   45 (213)
T cd03262          24 KKGEVVVII--GPSGSGKSTLLRC   45 (213)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999653


No 114
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=88.02  E-value=0.31  Score=52.85  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=17.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        30 ~~Ge~~~ll--GpsGsGKSTLLr   50 (351)
T PRK11432         30 KQGTMVTLL--GPSGCGKTTVLR   50 (351)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568877788  999999999954


No 115
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=88.00  E-value=0.31  Score=48.21  Aligned_cols=22  Identities=32%  Similarity=0.362  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||..+
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~~   45 (222)
T cd03224          24 PEGEIVALL--GRNGAGKTTLLKT   45 (222)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 116
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=87.99  E-value=0.23  Score=49.51  Aligned_cols=16  Identities=31%  Similarity=0.335  Sum_probs=13.5

Q ss_pred             EEeEcCCccchhhhcc
Q psy13077        287 IAAAFPSACGKTNLAM  302 (630)
Q Consensus       287 f~~afpSg~GKTtLam  302 (630)
                      ++-+|+|||||||||.
T Consensus         2 i~i~G~sgsGKTtla~   17 (187)
T cd02024           2 VGISGVTNSGKTTLAK   17 (187)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3456999999999987


No 117
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=87.94  E-value=0.33  Score=47.71  Aligned_cols=21  Identities=29%  Similarity=0.485  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        25 ~~G~~~~i~--G~nGsGKSTLl~   45 (214)
T cd03292          25 SAGEFVFLV--GPSGAGKSTLLK   45 (214)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 118
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=87.91  E-value=0.32  Score=52.78  Aligned_cols=21  Identities=38%  Similarity=0.564  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||--
T Consensus        28 ~~Ge~~~l~--GpsGsGKSTLLr   48 (353)
T TIGR03265        28 KKGEFVCLL--GPSGCGKTTLLR   48 (353)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999954


No 119
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=87.88  E-value=0.44  Score=51.72  Aligned_cols=21  Identities=43%  Similarity=0.517  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .+|+..-+.  ||||||||||.-
T Consensus        26 ~~Ge~~~ll--GpsGsGKSTLLr   46 (353)
T PRK10851         26 PSGQMVALL--GPSGSGKTTLLR   46 (353)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888787  999999999965


No 120
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=87.85  E-value=0.3  Score=52.71  Aligned_cols=21  Identities=43%  Similarity=0.585  Sum_probs=19.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+.+.++  ||+|||||||++
T Consensus        53 p~G~iteI~--G~~GsGKTtLaL   73 (321)
T TIGR02012        53 PRGRIIEIY--GPESSGKTTLAL   73 (321)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHH
Confidence            789999999  999999999987


No 121
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=87.84  E-value=0.23  Score=48.48  Aligned_cols=37  Identities=19%  Similarity=0.143  Sum_probs=24.6

Q ss_pred             ccCcccccch-hccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        264 REGWLAEHML-ILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       264 ~eGwLaeHm~-i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|.++.-+. .+...-..|+...|.  ||+|||||||..
T Consensus         6 ~~g~~~~~~~~~l~~~v~~g~~i~I~--G~tGSGKTTll~   43 (186)
T cd01130           6 AQGTFSPLQAAYLWLAVEARKNILIS--GGTGSGKTTLLN   43 (186)
T ss_pred             HcCCCCHHHHHHHHHHHhCCCEEEEE--CCCCCCHHHHHH
Confidence            4566665553 222222457777777  999999999854


No 122
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=87.78  E-value=0.33  Score=48.88  Aligned_cols=22  Identities=32%  Similarity=0.558  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||.-+
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~~   47 (242)
T PRK11124         26 PQGETLVLL--GPSGAGKSSLLRV   47 (242)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 123
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.75  E-value=0.34  Score=49.09  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (250)
T PRK14247         27 PDNTITALM--GPSGSGKSTLLRV   48 (250)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999774


No 124
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=87.72  E-value=0.34  Score=47.38  Aligned_cols=21  Identities=29%  Similarity=0.252  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        22 ~~Ge~~~i~--G~nGsGKSTLl~   42 (206)
T TIGR03608        22 EKGKMYAII--GESGSGKSTLLN   42 (206)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999966


No 125
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=87.70  E-value=0.32  Score=53.26  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=17.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        38 ~~Ge~~~Ll--GpsGsGKSTLLr   58 (375)
T PRK09452         38 NNGEFLTLL--GPSGCGKTTVLR   58 (375)
T ss_pred             eCCCEEEEE--CCCCCcHHHHHH
Confidence            468877788  999999999965


No 126
>PRK09354 recA recombinase A; Provisional
Probab=87.67  E-value=0.31  Score=53.20  Aligned_cols=21  Identities=43%  Similarity=0.591  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+.+.++  ||+|||||||++
T Consensus        58 p~G~IteI~--G~~GsGKTtLal   78 (349)
T PRK09354         58 PRGRIVEIY--GPESSGKTTLAL   78 (349)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHH
Confidence            789999999  999999999998


No 127
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]
Probab=87.64  E-value=0.24  Score=52.52  Aligned_cols=21  Identities=43%  Similarity=0.619  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+-||  ||.||||||||+
T Consensus        58 ~~g~ItEiy--G~~gsGKT~lal   78 (279)
T COG0468          58 PRGRITEIY--GPESSGKTTLAL   78 (279)
T ss_pred             ccceEEEEe--cCCCcchhhHHH
Confidence            779999999  999999999998


No 128
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=87.63  E-value=0.3  Score=46.59  Aligned_cols=17  Identities=18%  Similarity=0.014  Sum_probs=13.8

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      +++..|++|||||||+.
T Consensus         5 ii~i~G~~GsGKsTl~~   21 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQCE   21 (188)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            44445999999999985


No 129
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=87.62  E-value=0.35  Score=48.45  Aligned_cols=21  Identities=29%  Similarity=0.444  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (243)
T TIGR01978        24 KKGEIHAIM--GPNGSGKSTLSK   44 (243)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 130
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.61  E-value=0.34  Score=48.14  Aligned_cols=22  Identities=36%  Similarity=0.597  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus        28 ~~G~~~~i~--G~nGsGKSTLl~~   49 (220)
T cd03293          28 EEGEFVALV--GPSGCGKSTLLRI   49 (220)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 131
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=87.58  E-value=0.36  Score=47.44  Aligned_cols=21  Identities=24%  Similarity=0.227  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        24 ~~G~~~~i~--G~nGsGKSTLl~   44 (208)
T cd03268          24 KKGEIYGFL--GPNGAGKTTTMK   44 (208)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 132
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=87.52  E-value=0.33  Score=51.07  Aligned_cols=21  Identities=14%  Similarity=0.025  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |++|||||+|++
T Consensus        93 ~~g~i~ei~--G~~g~GKT~l~~  113 (310)
T TIGR02236        93 ETQAITEVF--GEFGSGKTQICH  113 (310)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHH
Confidence            668889999  999999999987


No 133
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.51  E-value=0.37  Score=48.00  Aligned_cols=21  Identities=33%  Similarity=0.417  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||..
T Consensus        27 ~~G~~~~i~--G~nGsGKSTLl~   47 (229)
T cd03254          27 KPGETVAIV--GPTGAGKTTLIN   47 (229)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            678888888  999999999976


No 134
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=87.51  E-value=0.48  Score=50.95  Aligned_cols=22  Identities=32%  Similarity=0.422  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||+.+
T Consensus        45 ~~Ge~~~lv--G~sGsGKSTLlk~   66 (331)
T PRK15079         45 YEGETLGVV--GESGCGKSTFARA   66 (331)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            579888888  9999999999763


No 135
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=87.48  E-value=0.51  Score=50.98  Aligned_cols=21  Identities=33%  Similarity=0.219  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||..
T Consensus        21 ~~Gei~~l~--G~nGsGKSTLl~   41 (354)
T TIGR02142        21 PGQGVTAIF--GRSGSGKTTLIR   41 (354)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 136
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=87.44  E-value=0.3  Score=40.46  Aligned_cols=13  Identities=31%  Similarity=0.289  Sum_probs=11.9

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      .|+|||||||++-
T Consensus         5 ~G~~gsGKst~~~   17 (69)
T cd02019           5 TGGSGSGKSTVAK   17 (69)
T ss_pred             ECCCCCCHHHHHH
Confidence            4999999999987


No 137
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=87.43  E-value=0.36  Score=48.29  Aligned_cols=22  Identities=32%  Similarity=0.365  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||.-+
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~~   45 (236)
T cd03219          24 RPGEIHGLI--GPNGAGKTTLFNL   45 (236)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 138
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=87.43  E-value=0.54  Score=48.00  Aligned_cols=22  Identities=32%  Similarity=0.158  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        30 ~~Ge~~~i~--G~nGsGKSTLl~~   51 (258)
T PRK11701         30 YPGEVLGIV--GESGSGKTTLLNA   51 (258)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 139
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=87.39  E-value=0.38  Score=48.04  Aligned_cols=22  Identities=27%  Similarity=0.382  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||.-+
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~~   45 (230)
T TIGR03410        24 PKGEVTCVL--GRNGVGKTTLLKT   45 (230)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 140
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=87.37  E-value=0.39  Score=46.28  Aligned_cols=22  Identities=32%  Similarity=0.368  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus        26 ~~Ge~~~i~--G~nGsGKStLl~~   47 (178)
T cd03247          26 KQGEKIALL--GRSGSGKSTLLQL   47 (178)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            579888888  9999999999763


No 141
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=87.31  E-value=0.36  Score=52.44  Aligned_cols=21  Identities=33%  Similarity=0.591  Sum_probs=17.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        28 ~~Ge~~~ll--G~sGsGKSTLLr   48 (356)
T PRK11650         28 ADGEFIVLV--GPSGCGKSTLLR   48 (356)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568877777  999999999965


No 142
>PLN02165 adenylate isopentenyltransferase
Probab=87.27  E-value=0.41  Score=52.01  Aligned_cols=30  Identities=17%  Similarity=0.108  Sum_probs=21.7

Q ss_pred             cchhccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        271 HMLILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       271 Hm~i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |-+.-.+.++.|....++  ||+|||||+||.
T Consensus        32 ~~~~~~~~~~~g~iivIi--GPTGSGKStLA~   61 (334)
T PLN02165         32 MTSVAMEQNCKDKVVVIM--GATGSGKSRLSV   61 (334)
T ss_pred             ccccccccCCCCCEEEEE--CCCCCcHHHHHH
Confidence            333333456678766666  999999999997


No 143
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=87.20  E-value=0.39  Score=45.91  Aligned_cols=21  Identities=19%  Similarity=0.256  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||..
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (163)
T cd03216          24 RRGEVHALL--GENGAGKSTLMK   44 (163)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999966


No 144
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.20  E-value=0.38  Score=47.42  Aligned_cols=21  Identities=38%  Similarity=0.506  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||+|||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (213)
T cd03259          24 EPGEFLALL--GPSGCGKTTLLR   44 (213)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 145
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=87.19  E-value=0.38  Score=48.30  Aligned_cols=21  Identities=33%  Similarity=0.330  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        33 ~~Ge~~~l~--G~nGsGKSTLl~   53 (233)
T PRK11629         33 GEGEMMAIV--GSSGSGKSTLLH   53 (233)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 146
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=87.15  E-value=0.4  Score=45.98  Aligned_cols=21  Identities=33%  Similarity=0.452  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (166)
T cd03223          25 KPGDRLLIT--GPSGTGKSSLFR   45 (166)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 147
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=87.14  E-value=0.4  Score=47.40  Aligned_cols=22  Identities=23%  Similarity=0.288  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus        29 ~~Ge~~~i~--G~nGsGKSTLl~~   50 (218)
T cd03266          29 KPGEVTGLL--GPNGAGKTTTLRM   50 (218)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 148
>PRK09087 hypothetical protein; Validated
Probab=87.13  E-value=0.29  Score=49.77  Aligned_cols=20  Identities=35%  Similarity=0.405  Sum_probs=16.5

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +...|+.  ||||||||+|+.+
T Consensus        44 ~~~l~l~--G~~GsGKThLl~~   63 (226)
T PRK09087         44 SPVVVLA--GPVGSGKTHLASI   63 (226)
T ss_pred             CCeEEEE--CCCCCCHHHHHHH
Confidence            3457888  9999999999873


No 149
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=87.10  E-value=0.39  Score=47.95  Aligned_cols=21  Identities=24%  Similarity=0.129  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+...+.  ||||||||||.-
T Consensus        11 ~~Ge~~~l~--G~NGsGKSTLlk   31 (213)
T PRK15177         11 GYHEHIGIL--AAPGSGKTTLTR   31 (213)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 150
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=87.02  E-value=0.4  Score=47.46  Aligned_cols=22  Identities=32%  Similarity=0.324  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        29 ~~G~~~~i~--G~nGsGKSTLl~~   50 (221)
T TIGR02211        29 GKGEIVAIV--GSSGSGKSTLLHL   50 (221)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 151
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=87.01  E-value=0.41  Score=47.34  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+..-+.  |+||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (207)
T PRK13539         26 AAGEALVLT--GPNGSGKTTLLR   46 (207)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 152
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=87.01  E-value=0.41  Score=47.53  Aligned_cols=22  Identities=23%  Similarity=0.250  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~~   45 (220)
T cd03265          24 RRGEIFGLL--GPNGAGKTTTIKM   45 (220)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 153
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=86.96  E-value=0.41  Score=47.94  Aligned_cols=21  Identities=43%  Similarity=0.662  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~   51 (225)
T PRK10247         31 RAGEFKLIT--GPSGCGKSTLLK   51 (225)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 154
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=86.90  E-value=0.43  Score=45.84  Aligned_cols=21  Identities=38%  Similarity=0.445  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKStLl~   46 (173)
T cd03246          26 EPGESLAII--GPSGSGKSTLAR   46 (173)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 155
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=86.84  E-value=0.39  Score=47.81  Aligned_cols=21  Identities=33%  Similarity=0.480  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |+||+|||+|++
T Consensus        21 ~~g~i~~i~--G~~GsGKT~l~~   41 (225)
T PRK09361         21 ERGTITQIY--GPPGSGKTNICL   41 (225)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHH
Confidence            678889999  999999999988


No 156
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.84  E-value=0.42  Score=45.90  Aligned_cols=21  Identities=29%  Similarity=0.339  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKStLl~   44 (173)
T cd03230          24 EKGEIYGLL--GPNGAGKTTLIK   44 (173)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 157
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=86.76  E-value=0.38  Score=51.18  Aligned_cols=20  Identities=30%  Similarity=0.155  Sum_probs=16.5

Q ss_pred             CEEEEEeEcCCccchhhhcc
Q psy13077        283 QKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam  302 (630)
                      ....++-+|+|||||||||.
T Consensus        61 ~p~IIGIaG~~GSGKSTlar   80 (290)
T TIGR00554        61 IPYIISIAGSVAVGKSTTAR   80 (290)
T ss_pred             CCEEEEEECCCCCCHHHHHH
Confidence            34677778999999999984


No 158
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=86.71  E-value=0.43  Score=47.19  Aligned_cols=21  Identities=29%  Similarity=0.265  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        28 ~~G~~~~i~--G~nGsGKSTLl~   48 (220)
T cd03245          28 RAGEKVAII--GRVGSGKSTLLK   48 (220)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 159
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=86.65  E-value=0.33  Score=43.39  Aligned_cols=16  Identities=38%  Similarity=0.461  Sum_probs=13.9

Q ss_pred             EEEeEcCCccchhhhccc
Q psy13077        286 YIAAAFPSACGKTNLAML  303 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam~  303 (630)
                      ++.  |+||||||+||..
T Consensus         2 ~i~--G~~G~GKS~l~~~   17 (107)
T PF00910_consen    2 WIY--GPPGIGKSTLAKE   17 (107)
T ss_pred             EEE--CCCCCCHHHHHHH
Confidence            566  9999999999883


No 160
>KOG0060|consensus
Probab=86.64  E-value=0.39  Score=55.38  Aligned_cols=21  Identities=52%  Similarity=0.814  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+|+..+++  ||||||||+|--
T Consensus       459 ~~g~~LLIt--G~sG~GKtSLlR  479 (659)
T KOG0060|consen  459 PSGQNLLIT--GPSGCGKTSLLR  479 (659)
T ss_pred             cCCCeEEEE--CCCCCchhHHHH
Confidence            789999999  999999999943


No 161
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=86.63  E-value=0.93  Score=44.61  Aligned_cols=21  Identities=33%  Similarity=0.338  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        23 ~~Ge~~~l~--G~nGsGKSTLl~   43 (177)
T cd03222          23 KEGEVIGIV--GPNGTGKTTAVK   43 (177)
T ss_pred             CCCCEEEEE--CCCCChHHHHHH
Confidence            568888888  999999999854


No 162
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=86.62  E-value=0.45  Score=46.70  Aligned_cols=22  Identities=32%  Similarity=0.450  Sum_probs=19.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus        29 ~~G~~~~i~--G~nG~GKSTLl~~   50 (204)
T cd03250          29 PKGELVAIV--GPVGSGKSSLLSA   50 (204)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679899999  9999999999763


No 163
>cd03112 CobW_like The function of this protein family is unkown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage caused by mitomycin. YijA gene is a homologue of the CobW gene which encodes the cobalamin synthesis protein/P47K.
Probab=86.59  E-value=0.46  Score=45.48  Aligned_cols=54  Identities=19%  Similarity=0.211  Sum_probs=32.8

Q ss_pred             EEEEeEcCCccchhhhcc-cCCCCCCCeeEEeeccEEEEEECCC----ccEEEeccCCCee
Q psy13077        285 KYIAAAFPSACGKTNLAM-LNPTLPGYKVECVGDDIAWMKFDKE----GVLRAINPENGFF  340 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam-~~p~~pgwk~~lIGDDiaW~~~~~d----G~l~a~NpE~G~f  340 (630)
                      ..+.  |++|+|||||.. +-....|+++.+|-+|.+.+.+|..    .....+...+||-
T Consensus         3 ~~l~--G~~GsGKTtl~~~l~~~~~~~~~~~i~~~~G~~~~d~~~~~~~~~~v~~l~~GCi   61 (158)
T cd03112           3 TVLT--GFLGAGKTTLLNHILTEQHGRKIAVIENEFGEVGIDNQLVVDTDEEIIEMNNGCI   61 (158)
T ss_pred             EEEE--ECCCCCHHHHHHHHHhcccCCcEEEEecCCCccchhHHHHhCCCceEEEeCCCEe
Confidence            4555  999999999754 1122347788888888776654421    0112455566664


No 164
>PRK06217 hypothetical protein; Validated
Probab=86.54  E-value=0.38  Score=46.72  Aligned_cols=33  Identities=21%  Similarity=0.228  Sum_probs=20.9

Q ss_pred             EEEEeEcCCccchhhhcccCCCCCCCeeEEeecc-EEE
Q psy13077        285 KYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDD-IAW  321 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDD-iaW  321 (630)
                      ..+.  |+|||||||||-.-...-|  ...|.-| +.|
T Consensus         4 I~i~--G~~GsGKSTla~~L~~~l~--~~~~~~D~~~~   37 (183)
T PRK06217          4 IHIT--GASGSGTTTLGAALAERLD--IPHLDTDDYFW   37 (183)
T ss_pred             EEEE--CCCCCCHHHHHHHHHHHcC--CcEEEcCceee
Confidence            4455  9999999999873221113  4556555 567


No 165
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.48  E-value=0.46  Score=45.83  Aligned_cols=21  Identities=29%  Similarity=0.343  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        24 ~~G~~~~i~--G~nGsGKSTLl~   44 (178)
T cd03229          24 EAGEIVALL--GPSGSGKSTLLR   44 (178)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            578888888  999999999965


No 166
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=86.38  E-value=0.47  Score=45.85  Aligned_cols=21  Identities=29%  Similarity=0.324  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        23 ~~G~~~~l~--G~nGsGKStLl~   43 (180)
T cd03214          23 EAGEIVGIL--GPNGAGKSTLLK   43 (180)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 167
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=86.35  E-value=0.46  Score=48.79  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (255)
T PRK11248         25 ESGELLVVL--GPSGCGKTTLLN   45 (255)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999865


No 168
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=86.30  E-value=0.45  Score=48.97  Aligned_cols=18  Identities=22%  Similarity=0.134  Sum_probs=14.9

Q ss_pred             CEEEEEeEcCCccchhhhcc
Q psy13077        283 QKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam  302 (630)
                      ...+|.  ||+||||||||-
T Consensus        43 ~~vll~--GppGtGKTtlA~   60 (261)
T TIGR02881        43 LHMIFK--GNPGTGKTTVAR   60 (261)
T ss_pred             ceEEEE--cCCCCCHHHHHH
Confidence            345666  999999999995


No 169
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=86.30  E-value=0.48  Score=44.50  Aligned_cols=21  Identities=19%  Similarity=0.233  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKStLl~   44 (144)
T cd03221          24 NPGDRIGLV--GRNGAGKSTLLK   44 (144)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 170
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.29  E-value=0.45  Score=47.89  Aligned_cols=22  Identities=41%  Similarity=0.528  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~~   47 (239)
T cd03296          26 PSGELVALL--GPSGSGKTTLLRL   47 (239)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 171
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=86.27  E-value=0.47  Score=46.96  Aligned_cols=22  Identities=18%  Similarity=0.092  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||||||||||..+
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~~   47 (220)
T cd03263          26 YKGEIFGLL--GHNGAGKTTTLKM   47 (220)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 172
>PRK09183 transposase/IS protein; Provisional
Probab=86.26  E-value=0.41  Score=49.73  Aligned_cols=22  Identities=32%  Similarity=0.418  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..++.  ||+|||||+||..
T Consensus       100 ~~~~~v~l~--Gp~GtGKThLa~a  121 (259)
T PRK09183        100 ERNENIVLL--GPSGVGKTHLAIA  121 (259)
T ss_pred             hcCCeEEEE--eCCCCCHHHHHHH
Confidence            346778888  9999999999874


No 173
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=86.24  E-value=0.42  Score=50.70  Aligned_cols=21  Identities=14%  Similarity=-0.001  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |++|||||+|++
T Consensus       100 ~~g~vtei~--G~~GsGKT~l~~  120 (317)
T PRK04301        100 ETQSITEFY--GEFGSGKTQICH  120 (317)
T ss_pred             cCCcEEEEE--CCCCCCHhHHHH
Confidence            678899999  999999999988


No 174
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=86.24  E-value=0.44  Score=47.52  Aligned_cols=21  Identities=24%  Similarity=0.287  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|+...+.  |+||||||+|+.
T Consensus        18 ~~G~~~~i~--G~~G~GKT~l~~   38 (229)
T TIGR03881        18 PRGFFVAVT--GEPGTGKTIFCL   38 (229)
T ss_pred             cCCeEEEEE--CCCCCChHHHHH
Confidence            678888888  999999999986


No 175
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=86.24  E-value=0.41  Score=46.07  Aligned_cols=55  Identities=29%  Similarity=0.356  Sum_probs=30.6

Q ss_pred             EEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEECCCccEEEeccCCCeeEeccCCCCCCcHHHHhhc
Q psy13077        284 KKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFDKEGVLRAINPENGFFGVAPGTSNKTNPIAMKTV  358 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~NpE~G~fgk~~g~s~~~~P~i~~ai  358 (630)
                      +..+.  |++|||||||+-          .|.|.++-.    ..-.  ++++...+ --+||- .-.||..+.+|
T Consensus         3 rimli--G~~g~GKTTL~q----------~L~~~~~~~----~KTq--~i~~~~~~-IDTPGE-yiE~~~~y~aL   57 (143)
T PF10662_consen    3 RIMLI--GPSGSGKTTLAQ----------ALNGEEIRY----KKTQ--AIEYYDNT-IDTPGE-YIENPRFYHAL   57 (143)
T ss_pred             eEEEE--CCCCCCHHHHHH----------HHcCCCCCc----Cccc--eeEecccE-EECChh-heeCHHHHHHH
Confidence            45556  999999999976          344444422    1222  34433322 333333 23477777776


No 176
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=86.22  E-value=0.46  Score=49.06  Aligned_cols=21  Identities=38%  Similarity=0.539  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  ||||||||||.-
T Consensus        36 ~~Ge~~~I~--G~NGsGKSTLlk   56 (257)
T PRK11247         36 PAGQFVAVV--GRSGCGKSTLLR   56 (257)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 177
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=86.21  E-value=0.46  Score=47.36  Aligned_cols=21  Identities=24%  Similarity=0.263  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||..
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (232)
T cd03218          24 KQGEIVGLL--GPNGAGKTTTFY   44 (232)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 178
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=86.17  E-value=0.49  Score=46.47  Aligned_cols=21  Identities=29%  Similarity=0.327  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .+|+..-+.  |+||||||||.-
T Consensus        25 ~~Ge~~~l~--G~nGsGKSTLl~   45 (200)
T PRK13540         25 PAGGLLHLK--GSNGAGKTTLLK   45 (200)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999865


No 179
>PRK10908 cell division protein FtsE; Provisional
Probab=86.11  E-value=0.49  Score=47.07  Aligned_cols=21  Identities=24%  Similarity=0.377  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (222)
T PRK10908         26 RPGEMAFLT--GHSGAGKSTLLK   46 (222)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 180
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=86.08  E-value=0.63  Score=48.93  Aligned_cols=21  Identities=29%  Similarity=0.241  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        17 ~~Ge~~~l~--G~NGaGKSTLl~   37 (302)
T TIGR01188        17 REGEVFGFL--GPNGAGKTTTIR   37 (302)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 181
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=86.05  E-value=0.45  Score=48.29  Aligned_cols=21  Identities=19%  Similarity=0.249  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....+.  |++|||||+||+
T Consensus        19 ~~gs~~lI~--G~pGsGKT~la~   39 (237)
T TIGR03877        19 PERNVVLLS--GGPGTGKSIFSQ   39 (237)
T ss_pred             cCCeEEEEE--cCCCCCHHHHHH
Confidence            678888888  999999999997


No 182
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=86.03  E-value=0.48  Score=48.08  Aligned_cols=21  Identities=29%  Similarity=0.426  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||..
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (252)
T TIGR03005        24 AAGEKVALI--GPSGSGKSTILR   44 (252)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 183
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=86.02  E-value=0.47  Score=51.26  Aligned_cols=21  Identities=33%  Similarity=0.230  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        22 ~~Ge~~~l~--G~nGsGKSTLl~   42 (352)
T PRK11144         22 PAQGITAIF--GRSGAGKTSLIN   42 (352)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 184
>PRK14527 adenylate kinase; Provisional
Probab=85.91  E-value=0.49  Score=46.18  Aligned_cols=41  Identities=22%  Similarity=0.374  Sum_probs=26.1

Q ss_pred             hHhhhcCCHHHHHHHHHHHHHHHHHh-----h-CCCccHHHHHHHHH
Q psy13077        583 LEELFSFDKSFWEQEVQDLQRYFNEQ-----L-GADLPTAIQAEIDA  623 (630)
Q Consensus       583 ~~~~~~~d~~~w~~e~~~l~~~f~~~-----~-~~~lP~ei~~~l~~  623 (630)
                      .++.+.-.-+.|.+++..+.++|.++     + ++.-++++.+++..
T Consensus       142 ~~~~~~~R~~~y~~~~~~v~~~y~~~~~~~~id~~~~~~~v~~~i~~  188 (191)
T PRK14527        142 NEETVRRRQQVYREQTQPLVDYYEARGHLKRVDGLGTPDEVYARILK  188 (191)
T ss_pred             CHHHHHHHHHHHHHHhHHHHHHHHhcCCEEEEECCCCHHHHHHHHHH
Confidence            34556666688888888888888753     1 33445555555443


No 185
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=85.89  E-value=0.51  Score=46.47  Aligned_cols=21  Identities=33%  Similarity=0.509  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||..
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (213)
T cd03301          24 ADGEFVVLL--GPSGCGKTTTLR   44 (213)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 186
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=85.87  E-value=0.49  Score=46.76  Aligned_cols=22  Identities=14%  Similarity=0.107  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~~   52 (202)
T cd03233          31 KPGEMVLVL--GRPGSGCSTLLKA   52 (202)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 187
>PRK06620 hypothetical protein; Validated
Probab=85.85  E-value=0.49  Score=47.76  Aligned_cols=22  Identities=36%  Similarity=0.388  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |.....|+.  ||+|||||+|+.+
T Consensus        42 ~~~~~l~l~--Gp~G~GKThLl~a   63 (214)
T PRK06620         42 PYKFTLLIK--GPSSSGKTYLTKI   63 (214)
T ss_pred             CCcceEEEE--CCCCCCHHHHHHH
Confidence            433468999  9999999999874


No 188
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=85.80  E-value=0.51  Score=47.77  Aligned_cols=21  Identities=38%  Similarity=0.629  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (247)
T TIGR00972        25 PKNQVTALI--GPSGCGKSTLLR   45 (247)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            579888888  999999999975


No 189
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=85.79  E-value=0.49  Score=49.65  Aligned_cols=20  Identities=35%  Similarity=0.541  Sum_probs=17.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLA  301 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLa  301 (630)
                      ++|+..-+.  ||.|||||||-
T Consensus        26 ~~G~i~~ii--GpNG~GKSTLL   45 (258)
T COG1120          26 PKGEITGIL--GPNGSGKSTLL   45 (258)
T ss_pred             cCCcEEEEE--CCCCCCHHHHH
Confidence            678877777  99999999994


No 190
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=85.79  E-value=0.5  Score=47.10  Aligned_cols=22  Identities=23%  Similarity=0.300  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        34 ~~Ge~~~i~--G~nGsGKSTLl~~   55 (228)
T PRK10584         34 KRGETIALI--GESGSGKSTLLAI   55 (228)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 191
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=85.73  E-value=0.53  Score=44.69  Aligned_cols=21  Identities=24%  Similarity=0.159  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |++|||||||+-
T Consensus        20 ~~~~~i~l~--G~lGaGKTtl~~   40 (133)
T TIGR00150        20 DFGTVVLLK--GDLGAGKTTLVQ   40 (133)
T ss_pred             CCCCEEEEE--cCCCCCHHHHHH
Confidence            557777777  999999999976


No 192
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=85.71  E-value=0.5  Score=47.55  Aligned_cols=21  Identities=29%  Similarity=0.395  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus         9 ~~Ge~~~i~--G~nGsGKSTLl~   29 (230)
T TIGR01184         9 QQGEFISLI--GHSGCGKSTLLN   29 (230)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999865


No 193
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=85.67  E-value=0.49  Score=51.56  Aligned_cols=21  Identities=38%  Similarity=0.561  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||..
T Consensus        27 ~~Ge~~~l~--G~nGsGKSTLL~   47 (369)
T PRK11000         27 HEGEFVVFV--GPSGCGKSTLLR   47 (369)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999965


No 194
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.67  E-value=0.5  Score=48.24  Aligned_cols=22  Identities=36%  Similarity=0.600  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus        36 ~~Ge~~~l~--G~nGsGKSTLl~~   57 (259)
T PRK14274         36 PENEVTAII--GPSGCGKSTFIKT   57 (259)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            569888888  9999999999764


No 195
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=85.62  E-value=0.5  Score=47.95  Aligned_cols=21  Identities=29%  Similarity=0.148  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~   47 (253)
T TIGR02323        27 YPGEVLGIV--GESGSGKSTLLG   47 (253)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999865


No 196
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=85.61  E-value=0.53  Score=46.34  Aligned_cols=21  Identities=33%  Similarity=0.390  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        25 ~~Ge~~~l~--G~nGsGKSTLl~   45 (204)
T PRK13538         25 NAGELVQIE--GPNGAGKTSLLR   45 (204)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 197
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=85.58  E-value=0.53  Score=46.76  Aligned_cols=21  Identities=24%  Similarity=0.286  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        35 ~~Ge~~~i~--G~nGsGKSTLl~   55 (214)
T PRK13543         35 DAGEALLVQ--GDNGAGKTTLLR   55 (214)
T ss_pred             CCCCEEEEE--cCCCCCHHHHHH
Confidence            468888888  999999999965


No 198
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=85.57  E-value=0.54  Score=46.81  Aligned_cols=21  Identities=24%  Similarity=0.382  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        38 ~~Ge~~~i~--G~nGsGKSTLl~   58 (226)
T cd03248          38 HPGEVTALV--GPSGSGKSTVVA   58 (226)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 199
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=85.57  E-value=0.53  Score=47.48  Aligned_cols=21  Identities=29%  Similarity=0.317  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (242)
T cd03295          25 AKGEFLVLI--GPSGSGKTTTMK   45 (242)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 200
>PRK06893 DNA replication initiation factor; Validated
Probab=85.39  E-value=0.41  Score=48.49  Aligned_cols=18  Identities=28%  Similarity=0.165  Sum_probs=15.8

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+.  ||||||||+|+.+
T Consensus        41 ~l~l~--G~~G~GKThL~~a   58 (229)
T PRK06893         41 FFYIW--GGKSSGKSHLLKA   58 (229)
T ss_pred             eEEEE--CCCCCCHHHHHHH
Confidence            56888  9999999999884


No 201
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.36  E-value=0.55  Score=47.65  Aligned_cols=22  Identities=32%  Similarity=0.483  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||..+
T Consensus        28 ~~Ge~~~l~--G~nGsGKSTLl~~   49 (253)
T PRK14267         28 PQNGVFALM--GPSGCGKSTLLRT   49 (253)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 202
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=85.34  E-value=0.53  Score=51.34  Aligned_cols=21  Identities=33%  Similarity=0.409  Sum_probs=17.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||--
T Consensus        29 ~~Ge~~~ll--GpsGsGKSTLLr   49 (362)
T TIGR03258        29 EAGELLALI--GKSGCGKTTLLR   49 (362)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568777777  999999999854


No 203
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=85.31  E-value=0.55  Score=45.92  Aligned_cols=21  Identities=29%  Similarity=0.447  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |++|||||||.-
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (195)
T PRK13541         24 LPSAITYIK--GANGCGKSSLLR   44 (195)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 204
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=85.29  E-value=0.44  Score=47.47  Aligned_cols=42  Identities=2%  Similarity=-0.005  Sum_probs=27.3

Q ss_pred             ceeccCCccCCCCCCCChHHHHHHHHHHHHhhccCCCcEEEEe
Q psy13077        480 KVIMHDPFAMRPFFGYNFGDYLKHWLSMEQRTNAKLPKVFHVN  522 (630)
Q Consensus       480 g~~~~dP~a~~PF~~y~~g~Y~~~wl~lg~~~~~~~pkif~VN  522 (630)
                      ..+.-|+...+ .....+..+......|-+.+++....++.+.
T Consensus       117 ~~vVIDsls~l-~~~~~~~~~r~~l~~l~~~l~~~~~t~llt~  158 (226)
T PF06745_consen  117 DRVVIDSLSAL-LLYDDPEELRRFLRALIKFLKSRGVTTLLTS  158 (226)
T ss_dssp             SEEEEETHHHH-TTSSSGGGHHHHHHHHHHHHHHTTEEEEEEE
T ss_pred             CEEEEECHHHH-hhcCCHHHHHHHHHHHHHHHHHCCCEEEEEE
Confidence            45556888776 6667777766666666676666665555555


No 205
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=85.21  E-value=0.59  Score=44.82  Aligned_cols=21  Identities=38%  Similarity=0.461  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||+|||||||.-
T Consensus        26 ~~G~~~~l~--G~nGsGKstLl~   46 (171)
T cd03228          26 KPGEKVAIV--GPSGSGKSTLLK   46 (171)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 206
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=85.19  E-value=0.55  Score=47.46  Aligned_cols=21  Identities=38%  Similarity=0.381  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||..
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~   47 (250)
T PRK11264         27 KPGEVVAII--GPSGSGKTTLLR   47 (250)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 207
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=85.18  E-value=0.43  Score=42.66  Aligned_cols=19  Identities=32%  Similarity=0.322  Sum_probs=12.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      +...++.  |++|||||+++.
T Consensus         4 ~~~~~i~--G~~G~GKT~~~~   22 (131)
T PF13401_consen    4 QRILVIS--GPPGSGKTTLIK   22 (131)
T ss_dssp             ---EEEE--E-TTSSHHHHHH
T ss_pred             CcccEEE--cCCCCCHHHHHH
Confidence            3445666  999999999977


No 208
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.18  E-value=0.55  Score=47.71  Aligned_cols=22  Identities=32%  Similarity=0.560  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        30 ~~Ge~~~i~--G~nGsGKSTLl~~   51 (253)
T PRK14261         30 PKNRVTALI--GPSGCGKSTLLRC   51 (253)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 209
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=85.14  E-value=0.46  Score=54.18  Aligned_cols=22  Identities=41%  Similarity=0.552  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||+.+
T Consensus       374 ~~G~~vaIv--G~SGsGKSTL~~l  395 (588)
T PRK11174        374 PAGQRIALV--GPSGAGKTSLLNA  395 (588)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999888  9999999999875


No 210
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=85.05  E-value=0.58  Score=45.30  Aligned_cols=22  Identities=32%  Similarity=0.167  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        24 ~~G~~~~i~--G~nGsGKSTLl~~   45 (182)
T cd03215          24 RAGEIVGIA--GLVGNGQTELAEA   45 (182)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 211
>PRK05439 pantothenate kinase; Provisional
Probab=85.04  E-value=0.58  Score=50.30  Aligned_cols=22  Identities=27%  Similarity=0.129  Sum_probs=18.6

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .+....++.||+|||||||||.
T Consensus        83 ~~~~~iIgIaG~~gsGKSTla~  104 (311)
T PRK05439         83 QKVPFIIGIAGSVAVGKSTTAR  104 (311)
T ss_pred             CCCCEEEEEECCCCCCHHHHHH
Confidence            3566788888999999999986


No 212
>PLN03046 D-glycerate 3-kinase; Provisional
Probab=85.03  E-value=0.51  Score=53.02  Aligned_cols=50  Identities=26%  Similarity=0.268  Sum_probs=33.6

Q ss_pred             eeehhhhhhhhhccCc----ccccchhccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        252 CFALRIGSTIAKREGW----LAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       252 ~~alrias~~a~~eGw----LaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .+.-|+-.+..|---|    |+.|..-.+ .+.+-+..++..+|+||||||||+.
T Consensus       177 ~~~~~~~~~ylPl~~w~~~~i~~h~~~~~-~~~~~~PlIIGIsG~qGSGKSTLa~  230 (460)
T PLN03046        177 PQKARIYHYYIPVFIWCEDQIAEHRSKFK-DGDDIPPLVIGFSAPQGCGKTTLVF  230 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhc-CCCCCCCEEEEEECCCCCCHHHHHH
Confidence            4456677777777777    777875321 1111145777778999999999975


No 213
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=85.02  E-value=0.58  Score=47.59  Aligned_cols=21  Identities=24%  Similarity=0.395  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~   51 (254)
T PRK14273         31 LKNSITALI--GPSGCGKSTFLR   51 (254)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888898  999999999964


No 214
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=85.01  E-value=0.57  Score=47.94  Aligned_cols=22  Identities=32%  Similarity=0.443  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||.-+
T Consensus        37 ~~Ge~~~i~--G~nGsGKSTLl~~   58 (260)
T PRK10744         37 AKNQVTAFI--GPSGCGKSTLLRT   58 (260)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 215
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=85.00  E-value=0.55  Score=50.28  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||+.
T Consensus        31 ~~Ge~~~lv--G~sGsGKSTL~~   51 (326)
T PRK11022         31 KQGEVVGIV--GESGSGKSVSSL   51 (326)
T ss_pred             CCCCEEEEE--CCCCChHHHHHH
Confidence            678887777  999999999976


No 216
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=84.98  E-value=0.57  Score=47.43  Aligned_cols=22  Identities=27%  Similarity=0.446  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||.-+
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~~   52 (252)
T CHL00131         31 NKGEIHAIM--GPNGSGKSTLSKV   52 (252)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999653


No 217
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=84.94  E-value=0.52  Score=46.08  Aligned_cols=17  Identities=47%  Similarity=0.454  Sum_probs=13.5

Q ss_pred             EEeEcCCccchhhhccc
Q psy13077        287 IAAAFPSACGKTNLAML  303 (630)
Q Consensus       287 f~~afpSg~GKTtLam~  303 (630)
                      |.-+||||||||.||.+
T Consensus         6 ~ll~GpsGvGKT~la~~   22 (171)
T PF07724_consen    6 FLLAGPSGVGKTELAKA   22 (171)
T ss_dssp             EEEESSTTSSHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            33349999999999874


No 218
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=84.93  E-value=0.58  Score=47.35  Aligned_cols=22  Identities=23%  Similarity=0.188  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||..+
T Consensus        29 ~~Ge~~~i~--G~nGsGKSTLl~~   50 (252)
T PRK14239         29 YPNEITALI--GPSGSGKSTLLRS   50 (252)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 219
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=84.93  E-value=0.56  Score=49.05  Aligned_cols=24  Identities=25%  Similarity=0.285  Sum_probs=20.8

Q ss_pred             ccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        277 ITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       277 v~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++=|.|...-++  |+||||||||..
T Consensus        16 ~~ip~g~~~~vt--GvSGsGKStL~~   39 (261)
T cd03271          16 VDIPLGVLTCVT--GVSGSGKSSLIN   39 (261)
T ss_pred             eeccCCcEEEEE--CCCCCchHHHHH
Confidence            444889888888  999999999986


No 220
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=84.85  E-value=0.44  Score=44.62  Aligned_cols=13  Identities=38%  Similarity=0.498  Sum_probs=11.7

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      .||||||||||+.
T Consensus         5 ~GpsGsGKstl~~   17 (137)
T cd00071           5 SGPSGVGKSTLLK   17 (137)
T ss_pred             ECCCCCCHHHHHH
Confidence            4999999999976


No 221
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=84.85  E-value=0.61  Score=46.24  Aligned_cols=21  Identities=38%  Similarity=0.669  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (218)
T cd03290          25 PTGQLTMIV--GQVGCGKSSLLL   45 (218)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999964


No 222
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.83  E-value=0.58  Score=47.51  Aligned_cols=22  Identities=36%  Similarity=0.552  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~~   49 (252)
T PRK14256         28 PENSVTAII--GPSGCGKSTVLRS   49 (252)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            569888888  9999999999763


No 223
>PLN02318 phosphoribulokinase/uridine kinase
Probab=84.80  E-value=0.6  Score=54.47  Aligned_cols=21  Identities=29%  Similarity=0.241  Sum_probs=18.0

Q ss_pred             CEEEEEeEcCCccchhhhccc
Q psy13077        283 QKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam~  303 (630)
                      +...++-+|||||||||||..
T Consensus        64 ~riIIGIaGpSGSGKTTLAk~   84 (656)
T PLN02318         64 GIILVGVAGPSGAGKTVFTEK   84 (656)
T ss_pred             CeEEEEEECCCCCcHHHHHHH
Confidence            467888889999999999873


No 224
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.78  E-value=0.6  Score=48.11  Aligned_cols=22  Identities=36%  Similarity=0.481  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus        33 ~~Ge~~~I~--G~nGsGKSTLl~~   54 (269)
T PRK13648         33 PKGQWTSIV--GHNGSGKSTIAKL   54 (269)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 225
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=84.77  E-value=0.58  Score=50.09  Aligned_cols=22  Identities=27%  Similarity=0.297  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        31 ~~Ge~~~iv--G~sGsGKSTLl~~   52 (330)
T PRK15093         31 TEGEIRGLV--GESGSGKSLIAKA   52 (330)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888788  9999999999763


No 226
>PRK14737 gmk guanylate kinase; Provisional
Probab=84.73  E-value=0.58  Score=46.24  Aligned_cols=19  Identities=16%  Similarity=0.120  Sum_probs=14.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      +...++.  ||||+|||||+-
T Consensus         4 ~~~ivl~--GpsG~GK~tl~~   22 (186)
T PRK14737          4 PKLFIIS--SVAGGGKSTIIQ   22 (186)
T ss_pred             CeEEEEE--CCCCCCHHHHHH
Confidence            4455555  999999999975


No 227
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=84.67  E-value=0.59  Score=47.70  Aligned_cols=22  Identities=23%  Similarity=0.314  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~~   49 (258)
T PRK14241         28 EPRSVTAFI--GPSGCGKSTVLRT   49 (258)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 228
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.64  E-value=0.6  Score=48.32  Aligned_cols=21  Identities=14%  Similarity=0.219  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        31 ~~Ge~~~l~--G~nGsGKSTLl~   51 (280)
T PRK13649         31 EDGSYTAFI--GHTGSGKSTIMQ   51 (280)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 229
>PTZ00035 Rad51 protein; Provisional
Probab=84.63  E-value=0.55  Score=50.77  Aligned_cols=21  Identities=24%  Similarity=0.138  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |+||||||+|++
T Consensus       116 ~~G~iteI~--G~~GsGKT~l~~  136 (337)
T PTZ00035        116 ETGSITELF--GEFRTGKTQLCH  136 (337)
T ss_pred             CCCeEEEEE--CCCCCchhHHHH
Confidence            678899999  999999999987


No 230
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.58  E-value=0.61  Score=48.09  Aligned_cols=21  Identities=24%  Similarity=0.333  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~   45 (271)
T PRK13638         25 SLSPVTGLV--GANGCGKSTLFM   45 (271)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 231
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=84.56  E-value=0.55  Score=46.42  Aligned_cols=18  Identities=39%  Similarity=0.285  Sum_probs=13.8

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..+.-+|+||||||||..
T Consensus         7 ~ii~ivG~sgsGKTTLi~   24 (173)
T PRK10751          7 PLLAIAAWSGTGKTTLLK   24 (173)
T ss_pred             eEEEEECCCCChHHHHHH
Confidence            345555999999999844


No 232
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.50  E-value=0.64  Score=46.44  Aligned_cols=21  Identities=33%  Similarity=0.539  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (234)
T cd03251          26 PAGETVALV--GPSGSGKSTLVN   46 (234)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 233
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=84.49  E-value=0.58  Score=50.25  Aligned_cols=22  Identities=27%  Similarity=0.246  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        40 ~~Ge~~~iv--G~sGsGKSTL~~~   61 (330)
T PRK09473         40 RAGETLGIV--GESGSGKSQTAFA   61 (330)
T ss_pred             cCCCEEEEE--CCCCchHHHHHHH
Confidence            568888888  9999999999763


No 234
>PLN02796 D-glycerate 3-kinase
Probab=84.48  E-value=0.63  Score=50.82  Aligned_cols=19  Identities=37%  Similarity=0.649  Sum_probs=15.8

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ..+++-+|+||||||||+.
T Consensus       100 pliIGI~G~sGSGKSTLa~  118 (347)
T PLN02796        100 PLVIGISAPQGCGKTTLVF  118 (347)
T ss_pred             CEEEEEECCCCCcHHHHHH
Confidence            3666667999999999976


No 235
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=84.46  E-value=0.59  Score=46.68  Aligned_cols=22  Identities=36%  Similarity=0.243  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||.-+
T Consensus        31 ~~Ge~~~l~--G~nGsGKSTLlk~   52 (226)
T cd03234          31 ESGQVMAIL--GSSGSGKTTLLDA   52 (226)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHHH
Confidence            568887788  9999999999763


No 236
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=84.45  E-value=0.64  Score=47.73  Aligned_cols=22  Identities=27%  Similarity=0.292  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||.-+
T Consensus        23 ~~Ge~~~i~--G~NGsGKSTLlk~   44 (246)
T cd03237          23 SESEVIGIL--GPNGIGKTTFIKM   44 (246)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            358888888  9999999999653


No 237
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=84.43  E-value=0.62  Score=47.26  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        30 ~~Ge~~~i~--G~nGsGKSTLl~~   51 (253)
T PRK14242         30 EQNQVTALI--GPSGCGKSTFLRC   51 (253)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 238
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=84.42  E-value=0.65  Score=46.13  Aligned_cols=22  Identities=27%  Similarity=0.324  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        32 ~~Ge~~~l~--G~nGsGKSTLl~~   53 (224)
T TIGR02324        32 NAGECVALS--GPSGAGKSTLLKS   53 (224)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 239
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=84.42  E-value=0.52  Score=43.71  Aligned_cols=14  Identities=21%  Similarity=0.159  Sum_probs=12.5

Q ss_pred             EcCCccchhhhccc
Q psy13077        290 AFPSACGKTNLAML  303 (630)
Q Consensus       290 afpSg~GKTtLam~  303 (630)
                      .|++||||||+|..
T Consensus         5 ~G~~GsGKST~a~~   18 (150)
T cd02021           5 MGVSGSGKSTVGKA   18 (150)
T ss_pred             EcCCCCCHHHHHHH
Confidence            39999999999884


No 240
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=84.41  E-value=0.56  Score=51.07  Aligned_cols=21  Identities=24%  Similarity=-0.040  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |++|||||+|++
T Consensus       124 ~~G~ItEI~--G~~GsGKTql~l  144 (344)
T PLN03187        124 ETRCITEAF--GEFRSGKTQLAH  144 (344)
T ss_pred             CCCeEEEEe--cCCCCChhHHHH
Confidence            678899999  999999999987


No 241
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.41  E-value=0.63  Score=48.07  Aligned_cols=22  Identities=32%  Similarity=0.599  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus        37 ~~Ge~~~l~--G~nGsGKSTLl~~   58 (269)
T PRK14259         37 PRGKVTALI--GPSGCGKSTVLRS   58 (269)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 242
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=84.41  E-value=0.66  Score=45.62  Aligned_cols=22  Identities=27%  Similarity=0.333  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        32 ~~G~~~~i~--G~nGsGKSTLl~~   53 (207)
T cd03369          32 KAGEKIGIV--GRTGAGKSTLILA   53 (207)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 243
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=84.36  E-value=0.65  Score=45.41  Aligned_cols=21  Identities=29%  Similarity=0.374  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (198)
T TIGR01189        24 NAGEALQVT--GPNGIGKTTLLR   44 (198)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 244
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=84.36  E-value=0.64  Score=47.05  Aligned_cols=22  Identities=32%  Similarity=0.465  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (250)
T PRK14240         27 EENQVTALI--GPSGCGKSTFLRT   48 (250)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 245
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=84.36  E-value=0.65  Score=46.74  Aligned_cols=22  Identities=32%  Similarity=0.374  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        25 ~~Ge~~~l~--G~nGsGKSTLl~~   46 (240)
T PRK09493         25 DQGEVVVII--GPSGSGKSTLLRC   46 (240)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 246
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=84.36  E-value=0.62  Score=46.72  Aligned_cols=22  Identities=32%  Similarity=0.607  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        27 ~~Ge~~~l~--G~nGsGKSTLl~~   48 (238)
T cd03249          27 PPGKTVALV--GSSGCGKSTVVSL   48 (238)
T ss_pred             cCCCEEEEE--eCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 247
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=84.28  E-value=0.65  Score=47.93  Aligned_cols=22  Identities=45%  Similarity=0.563  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||.-+
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~~   52 (269)
T PRK11831         31 PRGKITAIM--GPSGIGKTTLLRL   52 (269)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 248
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=84.23  E-value=0.5  Score=43.54  Aligned_cols=17  Identities=24%  Similarity=0.163  Sum_probs=14.0

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      .++.  |++||||||||..
T Consensus         2 i~l~--G~~GsGKstla~~   18 (154)
T cd00464           2 IVLI--GMMGAGKTTVGRL   18 (154)
T ss_pred             EEEE--cCCCCCHHHHHHH
Confidence            3455  9999999999973


No 249
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.10  E-value=0.66  Score=47.07  Aligned_cols=22  Identities=23%  Similarity=0.323  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        29 ~~Ge~~~I~--G~nGsGKSTLl~~   50 (251)
T PRK14244         29 YKREVTAFI--GPSGCGKSTFLRC   50 (251)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            458888888  9999999999764


No 250
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=84.08  E-value=0.66  Score=47.31  Aligned_cols=22  Identities=18%  Similarity=0.105  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus        27 ~~Ge~~~l~--G~nGsGKSTLl~~   48 (254)
T PRK10418         27 QRGRVLALV--GGSGSGKSLTCAA   48 (254)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888898  9999999999764


No 251
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=84.05  E-value=0.68  Score=46.41  Aligned_cols=21  Identities=33%  Similarity=0.442  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        23 ~~Ge~~~l~--G~nGsGKSTLl~   43 (232)
T PRK10771         23 ERGERVAIL--GPSGAGKSTLLN   43 (232)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 252
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=84.04  E-value=0.66  Score=47.81  Aligned_cols=21  Identities=38%  Similarity=0.376  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        37 ~~Ge~~~i~--G~NGsGKSTLl~   57 (267)
T PRK15112         37 REGQTLAII--GENGSGKSTLAK   57 (267)
T ss_pred             cCCCEEEEE--cCCCCCHHHHHH
Confidence            568888888  999999999965


No 253
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=84.02  E-value=0.68  Score=46.89  Aligned_cols=22  Identities=41%  Similarity=0.424  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (250)
T PRK14262         27 FKNQITAII--GPSGCGKTTLLRS   48 (250)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 254
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=84.01  E-value=0.68  Score=46.13  Aligned_cols=20  Identities=15%  Similarity=0.145  Sum_probs=16.4

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .|+...++  ||||||||||.-
T Consensus        24 ~g~~~~lt--GpNg~GKSTllr   43 (199)
T cd03283          24 KKNGILIT--GSNMSGKSTFLR   43 (199)
T ss_pred             CCcEEEEE--CCCCCChHHHHH
Confidence            36777777  999999999943


No 255
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=84.00  E-value=0.65  Score=48.43  Aligned_cols=22  Identities=14%  Similarity=0.252  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        35 ~~Ge~~~l~--G~nGsGKSTLl~~   56 (289)
T PRK13645         35 KKNKVTCVI--GTTGSGKSTMIQL   56 (289)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 256
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=83.95  E-value=0.61  Score=52.65  Aligned_cols=21  Identities=29%  Similarity=0.468  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.+.  |++||||||||+
T Consensus        19 p~g~~~Li~--G~pGsGKT~la~   39 (484)
T TIGR02655        19 PIGRSTLVS--GTSGTGKTLFSI   39 (484)
T ss_pred             CCCeEEEEE--cCCCCCHHHHHH
Confidence            789889999  999999999998


No 257
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=83.94  E-value=0.68  Score=47.79  Aligned_cols=21  Identities=24%  Similarity=0.276  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        33 ~~Ge~~~l~--G~nGsGKSTLl~   53 (271)
T PRK13632         33 NEGEYVAIL--GHNGSGKSTISK   53 (271)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999954


No 258
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=83.94  E-value=0.55  Score=44.24  Aligned_cols=20  Identities=25%  Similarity=0.228  Sum_probs=12.3

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +++..++.  |++|||||+|..
T Consensus        23 ~~~~~ll~--G~~G~GKT~ll~   42 (185)
T PF13191_consen   23 SPRNLLLT--GESGSGKTSLLR   42 (185)
T ss_dssp             ----EEE---B-TTSSHHHHHH
T ss_pred             CCcEEEEE--CCCCCCHHHHHH
Confidence            34556666  999999999976


No 259
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=83.79  E-value=0.52  Score=42.90  Aligned_cols=15  Identities=33%  Similarity=0.445  Sum_probs=12.9

Q ss_pred             EeEcCCccchhhhcc
Q psy13077        288 AAAFPSACGKTNLAM  302 (630)
Q Consensus       288 ~~afpSg~GKTtLam  302 (630)
                      +-+|++||||||+|.
T Consensus         3 ~i~G~~GsGKst~a~   17 (147)
T cd02020           3 AIDGPAGSGKSTVAK   17 (147)
T ss_pred             EEECCCCCCHHHHHH
Confidence            445999999999987


No 260
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.77  E-value=0.64  Score=45.78  Aligned_cols=19  Identities=32%  Similarity=0.333  Sum_probs=15.7

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .| ...+.  ||||||||||..
T Consensus        25 ~g-~~~i~--G~nGsGKSTLl~   43 (211)
T cd03264          25 PG-MYGLL--GPNGAGKTTLMR   43 (211)
T ss_pred             CC-cEEEE--CCCCCCHHHHHH
Confidence            47 66666  999999999975


No 261
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=83.77  E-value=0.69  Score=47.43  Aligned_cols=21  Identities=29%  Similarity=0.339  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (258)
T PRK13548         26 RPGEVVAIL--GPNGAGKSTLLR   46 (258)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 262
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.75  E-value=0.68  Score=45.31  Aligned_cols=22  Identities=27%  Similarity=0.234  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||.-+
T Consensus        31 ~~Ge~~~l~--G~nGsGKSTLl~~   52 (192)
T cd03232          31 KPGTLTALM--GESGAGKTTLLDV   52 (192)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 263
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=83.73  E-value=0.7  Score=47.27  Aligned_cols=22  Identities=27%  Similarity=0.306  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||.-+
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~~   49 (262)
T PRK09984         28 HHGEMVALL--GPSGSGKSTLLRH   49 (262)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 264
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.72  E-value=0.71  Score=47.71  Aligned_cols=21  Identities=33%  Similarity=0.256  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||..
T Consensus        48 ~~Ge~~~l~--G~nGsGKSTLl~   68 (269)
T cd03294          48 REGEIFVIM--GLSGSGKSTLLR   68 (269)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999966


No 265
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=83.67  E-value=0.73  Score=45.60  Aligned_cols=21  Identities=29%  Similarity=0.360  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~   48 (221)
T cd03244          28 KPGEKVGIV--GRTGSGKSSLLL   48 (221)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 266
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=83.64  E-value=0.71  Score=48.08  Aligned_cols=22  Identities=18%  Similarity=0.194  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||.-+
T Consensus        25 ~~Ge~~~l~--G~nGsGKSTLl~~   46 (272)
T PRK13547         25 EPGRVTALL--GRNGAGKSTLLKA   46 (272)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999753


No 267
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=83.63  E-value=0.72  Score=47.54  Aligned_cols=21  Identities=19%  Similarity=0.232  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||..
T Consensus        44 ~~Ge~~~I~--G~nGsGKSTLl~   64 (267)
T PRK14237         44 EKNKITALI--GPSGSGKSTYLR   64 (267)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 268
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=83.60  E-value=0.69  Score=46.91  Aligned_cols=22  Identities=23%  Similarity=0.193  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||.-+
T Consensus        29 ~~Ge~~~l~--G~nGsGKSTLl~~   50 (255)
T PRK11300         29 REQEIVSLI--GPNGAGKTTVFNC   50 (255)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999663


No 269
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=83.59  E-value=0.73  Score=46.16  Aligned_cols=22  Identities=27%  Similarity=0.292  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus         4 ~~Ge~~~l~--G~nGsGKSTLl~~   25 (223)
T TIGR03771         4 DKGELLGLL--GPNGAGKTTLLRA   25 (223)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHHH
Confidence            358888888  9999999999763


No 270
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=83.57  E-value=0.67  Score=52.74  Aligned_cols=22  Identities=32%  Similarity=0.460  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||.-+
T Consensus       367 ~~G~~~aIv--G~sGsGKSTLl~l  388 (582)
T PRK11176        367 PAGKTVALV--GRSGSGKSTIANL  388 (582)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679998888  9999999999763


No 271
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=83.54  E-value=0.71  Score=47.07  Aligned_cols=21  Identities=24%  Similarity=0.208  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        29 ~~Ge~~~l~--G~nGsGKSTLl~   49 (257)
T PRK10619         29 NAGDVISII--GSSGSGKSTFLR   49 (257)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            578888888  999999999976


No 272
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=83.53  E-value=0.69  Score=48.06  Aligned_cols=20  Identities=40%  Similarity=0.610  Sum_probs=18.3

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .|++..++  |++|||||||+.
T Consensus        15 ~Gqr~~I~--G~~G~GKTTLlr   34 (249)
T cd01128          15 KGQRGLIV--APPKAGKTTLLQ   34 (249)
T ss_pred             CCCEEEEE--CCCCCCHHHHHH
Confidence            58899999  999999999976


No 273
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=83.53  E-value=0.73  Score=46.44  Aligned_cols=22  Identities=27%  Similarity=0.391  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~~   46 (248)
T PRK09580         25 RPGEVHAIM--GPNGSGKSTLSAT   46 (248)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999663


No 274
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=83.52  E-value=0.55  Score=42.60  Aligned_cols=15  Identities=40%  Similarity=0.607  Sum_probs=12.8

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      .++  |+||||||||+.
T Consensus         3 ~i~--G~~G~GKT~l~~   17 (165)
T cd01120           3 LVF--GPTGSGKTTLAL   17 (165)
T ss_pred             eEe--CCCCCCHHHHHH
Confidence            455  999999999986


No 275
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=83.50  E-value=0.63  Score=49.89  Aligned_cols=21  Identities=24%  Similarity=0.187  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|..+.++  |++|||||+|++
T Consensus        94 ~~G~iteI~--G~~GsGKTql~l  114 (313)
T TIGR02238        94 ESMSITEVF--GEFRCGKTQLSH  114 (313)
T ss_pred             cCCeEEEEE--CCCCCCcCHHHH
Confidence            678899999  999999999997


No 276
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=83.49  E-value=0.74  Score=47.33  Aligned_cols=22  Identities=36%  Similarity=0.649  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  ||||||||||..+
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~~   52 (265)
T PRK10253         31 PDGHFTAII--GPNGCGKSTLLRT   52 (265)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888898  9999999999763


No 277
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=83.47  E-value=0.73  Score=47.35  Aligned_cols=21  Identities=38%  Similarity=0.509  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||..
T Consensus        35 ~~Ge~~~i~--G~nGsGKSTLl~   55 (265)
T TIGR02769        35 EEGETVGLL--GRSGCGKSTLAR   55 (265)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 278
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=83.45  E-value=0.72  Score=47.62  Aligned_cols=22  Identities=36%  Similarity=0.520  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...++  |+||||||||..+
T Consensus        36 ~~Ge~~~i~--G~nGsGKSTLl~~   57 (268)
T PRK10419         36 KSGETVALL--GRSGCGKSTLARL   57 (268)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 279
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=83.45  E-value=0.74  Score=46.31  Aligned_cols=21  Identities=29%  Similarity=0.414  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||..
T Consensus        26 ~~Ge~~~l~--G~nGsGKSTLl~   46 (242)
T TIGR03411        26 DPGELRVII--GPNGAGKTTMMD   46 (242)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999964


No 280
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=83.40  E-value=0.74  Score=44.49  Aligned_cols=22  Identities=23%  Similarity=0.259  Sum_probs=17.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|....++  |+|||||||||..
T Consensus        16 ~~~~~i~i~--G~~GsGKstla~~   37 (184)
T TIGR00455        16 HRGVVIWLT--GLSGSGKSTIANA   37 (184)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHHH
Confidence            446666666  9999999999863


No 281
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=83.37  E-value=0.76  Score=46.11  Aligned_cols=22  Identities=18%  Similarity=0.172  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||+|||||.-+
T Consensus        10 ~~Ge~~~i~--G~nGsGKSTLl~~   31 (230)
T TIGR02770        10 KRGEVLALV--GESGSGKSLTCLA   31 (230)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 282
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=83.33  E-value=0.74  Score=46.30  Aligned_cols=21  Identities=24%  Similarity=0.148  Sum_probs=19.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....+.  |++|||||+|+.
T Consensus        23 ~~g~~~~i~--G~~GsGKt~l~~   43 (234)
T PRK06067         23 PFPSLILIE--GDHGTGKSVLSQ   43 (234)
T ss_pred             cCCcEEEEE--CCCCCChHHHHH
Confidence            778888888  999999999998


No 283
>PRK04328 hypothetical protein; Provisional
Probab=83.32  E-value=0.72  Score=47.44  Aligned_cols=21  Identities=19%  Similarity=0.249  Sum_probs=19.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|...++.  |++|||||+|++
T Consensus        21 p~gs~ili~--G~pGsGKT~l~~   41 (249)
T PRK04328         21 PERNVVLLS--GGPGTGKSIFSQ   41 (249)
T ss_pred             cCCcEEEEE--cCCCCCHHHHHH
Confidence            778888888  999999999988


No 284
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=83.32  E-value=0.76  Score=46.62  Aligned_cols=21  Identities=48%  Similarity=0.657  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        28 ~~G~~~~i~--G~nGsGKSTLl~   48 (251)
T PRK14249         28 PERQITAII--GPSGCGKSTLLR   48 (251)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999966


No 285
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.30  E-value=0.79  Score=43.07  Aligned_cols=21  Identities=24%  Similarity=0.341  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+...+.  |++|+|||||.-
T Consensus        23 ~~g~~~~i~--G~nGsGKStll~   43 (157)
T cd00267          23 KAGEIVALV--GPNGSGKSTLLR   43 (157)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            578888898  999999999966


No 286
>PRK15453 phosphoribulokinase; Provisional
Probab=83.27  E-value=0.63  Score=49.66  Aligned_cols=18  Identities=28%  Similarity=0.253  Sum_probs=14.8

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..+..+|.|||||||+|.
T Consensus         6 piI~ItG~SGsGKTTva~   23 (290)
T PRK15453          6 PIIAVTGSSGAGTTTVKR   23 (290)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            455566999999999986


No 287
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=83.25  E-value=0.74  Score=46.23  Aligned_cols=21  Identities=24%  Similarity=0.232  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        29 ~~Ge~~~i~--G~nGsGKSTLl~   49 (237)
T PRK11614         29 NQGEIVTLI--GANGAGKTTLLG   49 (237)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 288
>PRK05973 replicative DNA helicase; Provisional
Probab=83.24  E-value=0.69  Score=47.89  Aligned_cols=21  Identities=24%  Similarity=0.302  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+.+.++  |++|||||+|++
T Consensus        62 ~~Gsl~LIa--G~PG~GKT~lal   82 (237)
T PRK05973         62 KPGDLVLLG--ARPGHGKTLLGL   82 (237)
T ss_pred             CCCCEEEEE--eCCCCCHHHHHH
Confidence            678888888  999999999998


No 289
>PLN02772 guanylate kinase
Probab=83.24  E-value=1.8  Score=48.14  Aligned_cols=76  Identities=17%  Similarity=0.332  Sum_probs=38.5

Q ss_pred             CCCCcceEEEEcCCCCeEEEEccccccccccccceeehhhhhhhhh-ccCcccccchhcc--ccCCCCCEEEEEeEcCCc
Q psy13077        218 PCDPERTIILHKPAANEIVSYGSGYGGNSLLGKKCFALRIGSTIAK-REGWLAEHMLILG--ITNPEGQKKYIAAAFPSA  294 (630)
Q Consensus       218 pcn~e~~~I~~~~~~r~i~s~Gs~YgGnall~KK~~alrias~~a~-~eGwLaeHm~i~g--v~~p~G~~~~f~~afpSg  294 (630)
                      ||..- ..+++  .+..|++++-|=+-|   ----| |.+-.-..+ ++-.|.|--....  +.+..++..+|.  ||||
T Consensus        75 ~r~Gh-Sa~v~--~~~rilv~~~~~~~~---~~~w~-l~~~t~~~~~~~~~~~~eV~~~~~~~~~~~~k~iVls--GPSG  145 (398)
T PLN02772         75 PCKGY-SAVVL--NKDRILVIKKGSAPD---DSIWF-LEVDTPFVREQKKLLGTEVVAWSKGVRGNAEKPIVIS--GPSG  145 (398)
T ss_pred             CCCcc-eEEEE--CCceEEEEeCCCCCc---cceEE-EEcCCHHHHhhcccccceeeecccCCCCCCCcEEEEE--CCCC
Confidence            44433 34444  344555555443434   11123 444433333 2344554443222  333345555555  9999


Q ss_pred             cchhhhcc
Q psy13077        295 CGKTNLAM  302 (630)
Q Consensus       295 ~GKTtLam  302 (630)
                      +||+||.-
T Consensus       146 vGKsTL~~  153 (398)
T PLN02772        146 VGKGTLIS  153 (398)
T ss_pred             CCHHHHHH
Confidence            99999865


No 290
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=83.16  E-value=0.71  Score=51.15  Aligned_cols=21  Identities=29%  Similarity=0.263  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        52 ~~Gei~~Lv--G~NGsGKSTLLr   72 (400)
T PRK10070         52 EEGEIFVIM--GLSGSGKSTMVR   72 (400)
T ss_pred             cCCCEEEEE--CCCCchHHHHHH
Confidence            678888888  999999999965


No 291
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=83.16  E-value=0.78  Score=45.14  Aligned_cols=21  Identities=29%  Similarity=0.412  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (201)
T cd03231          24 AAGEALQVT--GPNGSGKTTLLR   44 (201)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 292
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=83.15  E-value=0.77  Score=47.46  Aligned_cols=21  Identities=24%  Similarity=0.293  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        31 ~~Ge~~~l~--G~nGsGKSTLl~   51 (272)
T PRK15056         31 PGGSIAALV--GVNGSGKSTLFK   51 (272)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 293
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=83.15  E-value=0.74  Score=46.91  Aligned_cols=21  Identities=33%  Similarity=0.626  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+-.|+.  ||||.|||||--
T Consensus        26 ~~Gef~fl~--GpSGAGKSTllk   46 (223)
T COG2884          26 PKGEFVFLT--GPSGAGKSTLLK   46 (223)
T ss_pred             cCceEEEEE--CCCCCCHHHHHH
Confidence            679888888  999999999853


No 294
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=83.06  E-value=0.79  Score=45.17  Aligned_cols=20  Identities=25%  Similarity=0.225  Sum_probs=17.0

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +...++.  |++|||||+||..
T Consensus        38 ~~~lll~--G~~G~GKT~la~~   57 (226)
T TIGR03420        38 DRFLYLW--GESGSGKSHLLQA   57 (226)
T ss_pred             CCeEEEE--CCCCCCHHHHHHH
Confidence            4568888  9999999999973


No 295
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=83.00  E-value=0.8  Score=45.56  Aligned_cols=21  Identities=24%  Similarity=0.330  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (223)
T TIGR03740        24 PKNSVYGLL--GPNGAGKSTLLK   44 (223)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 296
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=83.00  E-value=0.79  Score=46.05  Aligned_cols=20  Identities=15%  Similarity=0.220  Sum_probs=15.8

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .|+...|.  ||+|||||||.-
T Consensus        22 ~~~~~~i~--GpNGsGKStll~   41 (243)
T cd03272          22 SPKHNVVV--GRNGSGKSNFFA   41 (243)
T ss_pred             CCCcEEEE--CCCCCCHHHHHH
Confidence            45566677  999999999943


No 297
>KOG1970|consensus
Probab=82.99  E-value=0.65  Score=53.38  Aligned_cols=38  Identities=18%  Similarity=0.392  Sum_probs=27.3

Q ss_pred             hhccCcccccchhccccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        262 AKREGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       262 a~~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      .--+-||- ||+-.. .+-.++..+++  |||||||||+--.
T Consensus        92 ~eVk~WL~-~~~~~~-~~l~~~iLLlt--GPsGcGKSTtvkv  129 (634)
T KOG1970|consen   92 SEVKQWLK-QVAEFT-PKLGSRILLLT--GPSGCGKSTTVKV  129 (634)
T ss_pred             HHHHHHHH-HHHHhc-cCCCceEEEEe--CCCCCCchhHHHH
Confidence            34567988 887331 22346789999  9999999998653


No 298
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=82.91  E-value=0.61  Score=44.14  Aligned_cols=30  Identities=23%  Similarity=0.238  Sum_probs=19.0

Q ss_pred             EEEEeEcCCccchhhhcccCC-CC--CCCeeEEee
Q psy13077        285 KYIAAAFPSACGKTNLAMLNP-TL--PGYKVECVG  316 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~~p-~~--pgwk~~lIG  316 (630)
                      .++.  |+|||||||||..-- .+  +|+++.++.
T Consensus         2 i~i~--G~~GsGKSTla~~L~~~l~~~g~~~~~i~   34 (149)
T cd02027           2 IWLT--GLSGSGKSTIARALEEKLFQRGRPVYVLD   34 (149)
T ss_pred             EEEE--cCCCCCHHHHHHHHHHHHHHcCCCEEEEc
Confidence            3555  999999999987311 11  355555443


No 299
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=82.89  E-value=0.73  Score=53.75  Aligned_cols=22  Identities=36%  Similarity=0.400  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||+-+
T Consensus       477 ~~Ge~vaIv--G~sGsGKSTLlkl  498 (686)
T TIGR03797       477 EPGEFVAIV--GPSGSGKSTLLRL  498 (686)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679898888  9999999999874


No 300
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=82.89  E-value=0.72  Score=44.34  Aligned_cols=21  Identities=48%  Similarity=0.732  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...|+  |+||+||||+++
T Consensus        30 ~~g~l~~i~--g~~g~GKT~~~~   50 (193)
T PF13481_consen   30 PRGELTLIA--GPPGSGKTTLAL   50 (193)
T ss_dssp             -TTSEEEEE--ECSTSSHHHHHH
T ss_pred             cCCeEEEEE--eCCCCCHHHHHH
Confidence            568889999  999999999977


No 301
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=82.88  E-value=0.77  Score=49.62  Aligned_cols=21  Identities=29%  Similarity=0.351  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|+..-..  ||||||||||--
T Consensus        26 ~~Ge~vaLl--GpSGaGKsTlLR   46 (345)
T COG1118          26 KSGELVALL--GPSGAGKSTLLR   46 (345)
T ss_pred             cCCcEEEEE--CCCCCcHHHHHH
Confidence            689887777  999999999854


No 302
>PRK07429 phosphoribulokinase; Provisional
Probab=82.88  E-value=0.82  Score=49.38  Aligned_cols=21  Identities=29%  Similarity=0.403  Sum_probs=17.3

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...+.-+|+||||||||+-
T Consensus         6 ~~~~IIgI~G~SGSGKSTla~   26 (327)
T PRK07429          6 DRPVLLGVAGDSGCGKTTFLR   26 (327)
T ss_pred             CCCEEEEEECCCCCCHHHHHH
Confidence            456777778999999999876


No 303
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=82.78  E-value=0.72  Score=48.44  Aligned_cols=36  Identities=25%  Similarity=0.289  Sum_probs=22.4

Q ss_pred             CCCEEEEEeEcCCccchhhhcccCC-CC--C-C-CeeEEeecc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAMLNP-TL--P-G-YKVECVGDD  318 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam~~p-~~--p-g-wk~~lIGDD  318 (630)
                      .++...|.  ||+|+||||++..-. .+  . | ++|-+|--|
T Consensus       193 ~~~vi~~v--GptGvGKTTt~~kLa~~~~~~~g~~~V~li~~D  233 (282)
T TIGR03499       193 QGGVIALV--GPTGVGKTTTLAKLAARFVLEHGNKKVALITTD  233 (282)
T ss_pred             CCeEEEEE--CCCCCCHHHHHHHHHHHHHHHcCCCeEEEEECC
Confidence            45556666  999999999977211 11  1 3 566666544


No 304
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=82.77  E-value=0.82  Score=46.34  Aligned_cols=22  Identities=23%  Similarity=0.378  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||..+
T Consensus        29 ~~Ge~~~l~--G~nGsGKSTLl~~   50 (252)
T PRK14255         29 NQNEITALI--GPSGCGKSTYLRT   50 (252)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 305
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=82.73  E-value=0.8  Score=47.50  Aligned_cols=22  Identities=32%  Similarity=0.452  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        44 ~~Ge~~~Ii--G~nGsGKSTLl~~   65 (274)
T PRK14265         44 PAKKIIAFI--GPSGCGKSTLLRC   65 (274)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 306
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=82.70  E-value=0.81  Score=47.68  Aligned_cols=22  Identities=23%  Similarity=0.376  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        31 ~~Ge~~~I~--G~nGaGKSTLl~~   52 (282)
T PRK13640         31 PRGSWTALI--GHNGSGKSTISKL   52 (282)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHHH
Confidence            568888888  9999999999763


No 307
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=82.67  E-value=0.82  Score=46.99  Aligned_cols=21  Identities=24%  Similarity=0.395  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        45 ~~Ge~~~i~--G~nGsGKSTLl~   65 (268)
T PRK14248         45 EKHAVTALI--GPSGCGKSTFLR   65 (268)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999964


No 308
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=82.65  E-value=0.82  Score=46.18  Aligned_cols=21  Identities=24%  Similarity=0.233  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        45 ~~Ge~~~i~--G~NGsGKSTLl~   65 (236)
T cd03267          45 EKGEIVGFI--GPNGAGKTTTLK   65 (236)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999964


No 309
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=82.64  E-value=0.84  Score=45.80  Aligned_cols=22  Identities=27%  Similarity=0.419  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        46 ~~Ge~~~i~--G~nGsGKSTLl~~   67 (224)
T cd03220          46 PRGERIGLI--GRNGAGKSTLLRL   67 (224)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 310
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=82.63  E-value=0.81  Score=47.30  Aligned_cols=22  Identities=32%  Similarity=0.532  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        49 ~~Ge~~~I~--G~nGsGKSTLl~~   70 (272)
T PRK14236         49 PKNRVTAFI--GPSGCGKSTLLRC   70 (272)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 311
>PRK14530 adenylate kinase; Provisional
Probab=82.63  E-value=0.76  Score=45.76  Aligned_cols=45  Identities=20%  Similarity=0.318  Sum_probs=31.8

Q ss_pred             hhhHhhhcCCHHHHHHHHHHHHHHHHHh-----h-CCCccHHHHHHHHHHH
Q psy13077        581 VDLEELFSFDKSFWEQEVQDLQRYFNEQ-----L-GADLPTAIQAEIDALK  625 (630)
Q Consensus       581 ~~~~~~~~~d~~~w~~e~~~l~~~f~~~-----~-~~~lP~ei~~~l~~~~  625 (630)
                      -+.++.+..+-..|.++.+.+.++|.++     + +..-++++++.+.+..
T Consensus       161 dD~~e~i~~Rl~~y~~~~~~v~~~y~~~~~~~~id~~~~~~~v~~~i~~~l  211 (215)
T PRK14530        161 DDTEETVRERLDVFEENTEPVIEHYRDQGVLVEVDGEQTPDEVWADIQDAI  211 (215)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHhCCcEEEEECCCCHHHHHHHHHHHH
Confidence            4567778888889999999999999752     1 4445566666655443


No 312
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=82.61  E-value=0.65  Score=46.06  Aligned_cols=17  Identities=29%  Similarity=0.216  Sum_probs=14.5

Q ss_pred             EEeEcCCccchhhhccc
Q psy13077        287 IAAAFPSACGKTNLAML  303 (630)
Q Consensus       287 f~~afpSg~GKTtLam~  303 (630)
                      ++-+||+||||||.|-+
T Consensus         3 ItIsG~pGsG~TTva~~   19 (179)
T COG1102           3 ITISGLPGSGKTTVARE   19 (179)
T ss_pred             EEeccCCCCChhHHHHH
Confidence            45679999999999974


No 313
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=82.59  E-value=0.84  Score=46.06  Aligned_cols=21  Identities=33%  Similarity=0.445  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...++  |+||||||||.-
T Consensus        24 ~~Ge~~~l~--G~nGsGKSTLl~   44 (237)
T TIGR00968        24 PTGSLVALL--GPSGSGKSTLLR   44 (237)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999954


No 314
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=82.59  E-value=0.83  Score=46.24  Aligned_cols=22  Identities=36%  Similarity=0.539  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||..+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (249)
T PRK14253         27 PARQVTALI--GPSGCGKSTLLRC   48 (249)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 315
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=82.59  E-value=0.81  Score=45.28  Aligned_cols=22  Identities=36%  Similarity=0.465  Sum_probs=19.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||..+
T Consensus        22 ~~Ge~~~i~--G~nGsGKSTLl~~   43 (213)
T TIGR01277        22 ADGEIVAIM--GPSGAGKSTLLNL   43 (213)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 316
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=82.58  E-value=0.52  Score=47.66  Aligned_cols=46  Identities=20%  Similarity=0.130  Sum_probs=28.2

Q ss_pred             hhhhhhhhhccCcccccch--hccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        255 LRIGSTIAKREGWLAEHML--ILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       255 lrias~~a~~eGwLaeHm~--i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+.-|++..+++.++.|..  +....+......|++  |+||+|||.|.+
T Consensus         5 ~tFdnfv~g~~N~~a~~~~~~ia~~~~~~~~~l~l~--G~~G~GKTHLL~   52 (219)
T PF00308_consen    5 YTFDNFVVGESNELAYAAAKAIAENPGERYNPLFLY--GPSGLGKTHLLQ   52 (219)
T ss_dssp             -SCCCS--TTTTHHHHHHHHHHHHSTTTSSSEEEEE--ESTTSSHHHHHH
T ss_pred             CccccCCcCCcHHHHHHHHHHHHhcCCCCCCceEEE--CCCCCCHHHHHH
Confidence            3445666666677777664  222112222468888  999999999966


No 317
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.58  E-value=0.85  Score=45.62  Aligned_cols=21  Identities=38%  Similarity=0.572  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||+|||||||..
T Consensus        25 ~~Ge~~~l~--G~nGsGKSTLl~   45 (236)
T cd03253          25 PAGKKVAIV--GPSGSGKSTILR   45 (236)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 318
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=82.57  E-value=0.84  Score=46.88  Aligned_cols=22  Identities=23%  Similarity=0.347  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        28 ~~Ge~~~I~--G~NGsGKSTLl~~   49 (251)
T PRK09544         28 KPGKILTLL--GPNGAGKSTLVRV   49 (251)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 319
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=82.49  E-value=0.86  Score=44.73  Aligned_cols=21  Identities=33%  Similarity=0.387  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        33 ~~Ge~~~l~--G~nGsGKStLl~   53 (194)
T cd03213          33 KPGELTAIM--GPSGAGKSTLLN   53 (194)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 320
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.45  E-value=0.87  Score=45.73  Aligned_cols=21  Identities=43%  Similarity=0.555  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKSTLl~   44 (232)
T cd03300          24 KEGEFFTLL--GPSGCGKTTLLR   44 (232)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 321
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=82.45  E-value=0.8  Score=49.32  Aligned_cols=21  Identities=29%  Similarity=0.325  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        29 ~~Gei~~ii--G~nGsGKSTLlk   49 (343)
T PRK11153         29 PAGEIFGVI--GASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999975


No 322
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=82.45  E-value=0.72  Score=47.93  Aligned_cols=17  Identities=35%  Similarity=0.370  Sum_probs=14.9

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ..+|+  ||+|||||+||.
T Consensus        32 ~~ll~--Gp~G~GKT~la~   48 (305)
T TIGR00635        32 HLLLY--GPPGLGKTTLAH   48 (305)
T ss_pred             eEEEE--CCCCCCHHHHHH
Confidence            46777  999999999987


No 323
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=82.39  E-value=0.84  Score=47.21  Aligned_cols=22  Identities=32%  Similarity=0.439  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        48 ~~Ge~~~I~--G~nGsGKSTLl~~   69 (271)
T PRK14238         48 HENEVTAII--GPSGCGKSTYIKT   69 (271)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 324
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=82.39  E-value=1.2  Score=45.62  Aligned_cols=21  Identities=33%  Similarity=0.419  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||..
T Consensus        45 ~~Ge~~~i~--G~nGsGKSTLl~   65 (257)
T cd03288          45 KPGQKVGIC--GRTGSGKSSLSL   65 (257)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 325
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=82.36  E-value=0.87  Score=47.09  Aligned_cols=21  Identities=29%  Similarity=0.284  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        24 ~~Ge~~~Iv--G~nGsGKSTLlk   44 (255)
T cd03236          24 REGQVLGLV--GPNGIGKSTALK   44 (255)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 326
>TIGR01192 chvA glucan exporter ATP-binding protein. This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related.
Probab=82.26  E-value=0.9  Score=52.23  Aligned_cols=22  Identities=41%  Similarity=0.481  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||..+
T Consensus       359 ~~G~~~~iv--G~sGsGKSTL~~l  380 (585)
T TIGR01192       359 KAGQTVAIV--GPTGAGKTTLINL  380 (585)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            569999999  9999999999764


No 327
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=82.26  E-value=0.81  Score=51.51  Aligned_cols=22  Identities=36%  Similarity=0.593  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||.-+
T Consensus       346 ~~G~~~~iv--G~sGsGKSTL~~l  367 (529)
T TIGR02857       346 PPGERVALV--GPSGAGKSTLLNL  367 (529)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999999  9999999999764


No 328
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=82.26  E-value=0.81  Score=45.75  Aligned_cols=21  Identities=33%  Similarity=0.396  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...++  |++|||||+|++
T Consensus        11 ~~G~l~lI~--G~~G~GKT~~~~   31 (242)
T cd00984          11 QPGDLIIIA--ARPSMGKTAFAL   31 (242)
T ss_pred             CCCeEEEEE--eCCCCCHHHHHH
Confidence            678888888  999999999987


No 329
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=82.23  E-value=0.92  Score=44.47  Aligned_cols=19  Identities=26%  Similarity=0.340  Sum_probs=16.6

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      +++..|+  |+||+|||||.-
T Consensus        35 ~k~~vl~--G~SGvGKSSLiN   53 (161)
T PF03193_consen   35 GKTSVLL--GQSGVGKSSLIN   53 (161)
T ss_dssp             TSEEEEE--CSTTSSHHHHHH
T ss_pred             CCEEEEE--CCCCCCHHHHHH
Confidence            4788888  999999999964


No 330
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=82.18  E-value=0.89  Score=46.35  Aligned_cols=22  Identities=23%  Similarity=0.303  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        20 ~~Gei~~l~--G~nGsGKSTLl~~   41 (248)
T PRK03695         20 RAGEILHLV--GPNGAGKSTLLAR   41 (248)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 331
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=82.18  E-value=0.88  Score=46.36  Aligned_cols=22  Identities=32%  Similarity=0.612  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        26 ~~Ge~~~l~--G~nGsGKSTLl~~   47 (255)
T PRK11231         26 PTGKITALI--GPNGCGKSTLLKC   47 (255)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 332
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=82.12  E-value=0.89  Score=47.18  Aligned_cols=21  Identities=38%  Similarity=0.673  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        29 ~~Ge~~~i~--G~nGsGKSTLl~   49 (274)
T PRK13647         29 PEGSKTALL--GPNGAGKSTLLL   49 (274)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999965


No 333
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=82.09  E-value=0.8  Score=49.44  Aligned_cols=25  Identities=40%  Similarity=0.555  Sum_probs=18.9

Q ss_pred             ccccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        275 LGITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       275 ~gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +|+.-|.|  .++.  ||+|||||+||-.
T Consensus       151 ~g~~~p~g--vLL~--GppGtGKT~laka  175 (364)
T TIGR01242       151 VGIEPPKG--VLLY--GPPGTGKTLLAKA  175 (364)
T ss_pred             cCCCCCce--EEEE--CCCCCCHHHHHHH
Confidence            45555655  6777  9999999999863


No 334
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=82.01  E-value=0.83  Score=50.15  Aligned_cols=26  Identities=38%  Similarity=0.500  Sum_probs=19.8

Q ss_pred             hccccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        274 ILGITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       274 i~gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      .+|+..|.|  .++.  ||+|||||+||-.
T Consensus       159 ~~g~~~p~g--vLL~--GppGtGKT~lAka  184 (389)
T PRK03992        159 EVGIEPPKG--VLLY--GPPGTGKTLLAKA  184 (389)
T ss_pred             hcCCCCCCc--eEEE--CCCCCChHHHHHH
Confidence            345655655  7777  9999999999863


No 335
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=82.00  E-value=0.91  Score=46.72  Aligned_cols=22  Identities=32%  Similarity=0.526  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        34 ~~Ge~~~i~--G~nGsGKSTLl~~   55 (264)
T PRK14243         34 PKNQITAFI--GPSGCGKSTILRC   55 (264)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999764


No 336
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=81.96  E-value=0.84  Score=52.21  Aligned_cols=22  Identities=36%  Similarity=0.459  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++..+.  |+||||||||.-+
T Consensus       359 ~~G~~v~Iv--G~sGsGKSTLl~l  380 (588)
T PRK13657        359 KPGQTVAIV--GPTGAGKSTLINL  380 (588)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            569998888  9999999999764


No 337
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=81.88  E-value=0.65  Score=48.73  Aligned_cols=15  Identities=33%  Similarity=0.494  Sum_probs=12.7

Q ss_pred             EeEcCCccchhhhcc
Q psy13077        288 AAAFPSACGKTNLAM  302 (630)
Q Consensus       288 ~~afpSg~GKTtLam  302 (630)
                      .-+|+||||||||+.
T Consensus         3 gI~G~sGsGKSTl~~   17 (273)
T cd02026           3 GVAGDSGCGKSTFLR   17 (273)
T ss_pred             EEECCCCCCHHHHHH
Confidence            345999999999986


No 338
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=81.87  E-value=1.2  Score=50.43  Aligned_cols=19  Identities=21%  Similarity=0.202  Sum_probs=17.0

Q ss_pred             CCCCEEEEEeEcCCccchhhh
Q psy13077        280 PEGQKKYIAAAFPSACGKTNL  300 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtL  300 (630)
                      ..|+..-+.  ||||||||||
T Consensus        33 ~~Ge~~~ii--G~nGsGKSTL   51 (529)
T PRK15134         33 EAGETLALV--GESGSGKSVT   51 (529)
T ss_pred             eCCCEEEEE--CCCCCcHHHH
Confidence            468888888  9999999999


No 339
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=81.81  E-value=0.79  Score=45.39  Aligned_cols=16  Identities=19%  Similarity=0.316  Sum_probs=13.0

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..|+  ||+|||||||..
T Consensus         4 ilI~--GptGSGKTTll~   19 (198)
T cd01131           4 VLVT--GPTGSGKSTTLA   19 (198)
T ss_pred             EEEE--CCCCCCHHHHHH
Confidence            4455  999999999965


No 340
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=81.69  E-value=0.86  Score=51.78  Aligned_cols=22  Identities=32%  Similarity=0.489  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||.-+
T Consensus       347 ~~G~~~aiv--G~sGsGKSTL~~l  368 (547)
T PRK10522        347 KRGELLFLI--GGNGSGKSTLAML  368 (547)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679998888  9999999999874


No 341
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=81.67  E-value=0.77  Score=53.76  Aligned_cols=22  Identities=36%  Similarity=0.297  Sum_probs=19.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||+.+
T Consensus       498 ~~G~~vaIv--G~SGsGKSTLlkl  519 (708)
T TIGR01193       498 KMNSKTTIV--GMSGSGKSTLAKL  519 (708)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999888  9999999999874


No 342
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=81.66  E-value=0.9  Score=49.26  Aligned_cols=21  Identities=33%  Similarity=0.360  Sum_probs=17.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        29 ~~Gei~gIi--G~sGaGKSTLlr   49 (343)
T TIGR02314        29 PAGQIYGVI--GASGAGKSTLIR   49 (343)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568877777  999999999965


No 343
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=81.63  E-value=1.2  Score=51.74  Aligned_cols=21  Identities=19%  Similarity=0.132  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus       348 ~~Ge~~~lv--G~nGsGKSTLlk  368 (623)
T PRK10261        348 WPGETLSLV--GESGSGKSTTGR  368 (623)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            579888888  999999999965


No 344
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.63  E-value=0.94  Score=45.88  Aligned_cols=21  Identities=29%  Similarity=0.461  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~   48 (251)
T PRK14251         28 EEKELTALI--GPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 345
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.61  E-value=0.93  Score=47.16  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||.-+
T Consensus        45 ~~Ge~~~I~--G~nGsGKSTLl~~   66 (276)
T PRK14271         45 PARAVTSLM--GPTGSGKTTFLRT   66 (276)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 346
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=81.52  E-value=0.86  Score=44.99  Aligned_cols=17  Identities=35%  Similarity=0.471  Sum_probs=13.9

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      +.+|.  ||||+||||+|-
T Consensus         2 riiil--G~pGaGK~T~A~   18 (178)
T COG0563           2 RILIL--GPPGAGKSTLAK   18 (178)
T ss_pred             eEEEE--CCCCCCHHHHHH
Confidence            35666  999999999987


No 347
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=81.52  E-value=0.97  Score=45.56  Aligned_cols=22  Identities=27%  Similarity=0.256  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||..+
T Consensus        23 ~~Ge~~~i~--G~nG~GKStLl~~   44 (235)
T cd03299          23 ERGDYFVIL--GPTGSGKSVLLET   44 (235)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 348
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=81.50  E-value=0.94  Score=46.17  Aligned_cols=22  Identities=32%  Similarity=0.460  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||.-+
T Consensus        25 ~~Ge~~~i~--G~nGsGKSTLl~~   46 (256)
T TIGR03873        25 PPGSLTGLL--GPNGSGKSTLLRL   46 (256)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 349
>PRK03839 putative kinase; Provisional
Probab=81.49  E-value=0.84  Score=43.87  Aligned_cols=17  Identities=29%  Similarity=0.284  Sum_probs=13.8

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      .+++  |++||||||++-.
T Consensus         3 I~l~--G~pGsGKsT~~~~   19 (180)
T PRK03839          3 IAIT--GTPGVGKTTVSKL   19 (180)
T ss_pred             EEEE--CCCCCCHHHHHHH
Confidence            4455  9999999999873


No 350
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.48  E-value=0.96  Score=45.90  Aligned_cols=21  Identities=29%  Similarity=0.441  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||+|||||..
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~   48 (251)
T PRK14270         28 YENKITALI--GPSGCGKSTFLR   48 (251)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            569888888  999999999976


No 351
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=81.47  E-value=0.99  Score=45.03  Aligned_cols=20  Identities=15%  Similarity=0.178  Sum_probs=16.9

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ++-.++.  |++|||||+|+..
T Consensus        42 ~~~~~l~--G~~G~GKT~La~a   61 (227)
T PRK08903         42 DRFFYLW--GEAGSGRSHLLQA   61 (227)
T ss_pred             CCeEEEE--CCCCCCHHHHHHH
Confidence            4567888  9999999999873


No 352
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.43  E-value=0.96  Score=47.27  Aligned_cols=21  Identities=29%  Similarity=0.350  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        63 ~~Ge~~~l~--G~nGsGKSTLl~   83 (286)
T PRK14275         63 LSKYVTAII--GPSGCGKSTFLR   83 (286)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 353
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=81.30  E-value=0.97  Score=47.59  Aligned_cols=21  Identities=24%  Similarity=0.320  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        28 ~~Ge~~~l~--G~NGaGKSTLl~   48 (303)
T TIGR01288        28 ARGECFGLL--GPNGAGKSTIAR   48 (303)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 354
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=81.30  E-value=1  Score=44.81  Aligned_cols=21  Identities=33%  Similarity=0.414  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        29 ~~G~~~~I~--G~nGsGKStLl~   49 (220)
T TIGR02982        29 NPGEIVILT--GPSGSGKTTLLT   49 (220)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 355
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=81.26  E-value=0.96  Score=44.01  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=15.2

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+..++.  ||||+|||||+.
T Consensus         2 ~r~ivl~--Gpsg~GK~tl~~   20 (184)
T smart00072        2 RRPIVLS--GPSGVGKGTLLA   20 (184)
T ss_pred             CcEEEEE--CCCCCCHHHHHH
Confidence            4455566  999999999976


No 356
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=81.24  E-value=0.97  Score=47.03  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~   51 (279)
T PRK13650         31 KQGEWLSII--GHNGSGKSTTVR   51 (279)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999966


No 357
>KOG0635|consensus
Probab=81.20  E-value=0.94  Score=44.71  Aligned_cols=23  Identities=30%  Similarity=0.325  Sum_probs=20.4

Q ss_pred             CCCCCEEEEEeEcCCccchhhhccc
Q psy13077        279 NPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       279 ~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.+|=+.+++  |+||+||+|||..
T Consensus        28 ~qkGcviWiT--GLSgSGKStlACa   50 (207)
T KOG0635|consen   28 KQKGCVIWIT--GLSGSGKSTLACA   50 (207)
T ss_pred             cCCCcEEEEe--ccCCCCchhHHHH
Confidence            4678899999  9999999999983


No 358
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.17  E-value=1  Score=45.60  Aligned_cols=22  Identities=27%  Similarity=0.519  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (250)
T PRK14266         27 PKNSVTALI--GPSGCGKSTFIRT   48 (250)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999753


No 359
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.17  E-value=1  Score=46.07  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        36 ~~Ge~~~i~--G~nGsGKSTLl~~   57 (258)
T PRK14268         36 PKNSVTALI--GPSGCGKSTFIRC   57 (258)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 360
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.12  E-value=1  Score=46.25  Aligned_cols=21  Identities=33%  Similarity=0.474  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        40 ~~Ge~~~i~--G~nGsGKSTLl~   60 (265)
T PRK14252         40 HEKQVTALI--GPSGCGKSTFLR   60 (265)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999975


No 361
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=81.12  E-value=1.3  Score=46.92  Aligned_cols=21  Identities=24%  Similarity=0.207  Sum_probs=17.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||+|||||||.-
T Consensus        31 ~~Gei~gll--GpNGaGKSTLl~   51 (306)
T PRK13537         31 QRGECFGLL--GPNGAGKTTTLR   51 (306)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHH
Confidence            568877777  999999999965


No 362
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=81.11  E-value=1  Score=46.42  Aligned_cols=22  Identities=32%  Similarity=0.493  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        43 ~~Ge~~~i~--G~nGsGKSTLl~~   64 (267)
T PRK14235         43 PEKTVTAFI--GPSGCGKSTFLRC   64 (267)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            458888888  9999999999763


No 363
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.08  E-value=1  Score=46.11  Aligned_cols=22  Identities=27%  Similarity=0.387  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+...+.  |+||||||||.-+
T Consensus        31 ~~Ge~~~l~--G~nGsGKSTLlk~   52 (259)
T PRK14260         31 YRNKVTAII--GPSGCGKSTFIKT   52 (259)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999653


No 364
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=81.08  E-value=0.8  Score=41.92  Aligned_cols=13  Identities=46%  Similarity=0.524  Sum_probs=11.8

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      .||+|||||+|+.
T Consensus         5 ~G~~G~GKt~l~~   17 (139)
T PF07728_consen    5 VGPPGTGKTTLAR   17 (139)
T ss_dssp             EESSSSSHHHHHH
T ss_pred             ECCCCCCHHHHHH
Confidence            3999999999986


No 365
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.01  E-value=1  Score=45.52  Aligned_cols=22  Identities=32%  Similarity=0.501  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTLl~~   49 (252)
T PRK14272         28 QRGTVNALI--GPSGCGKTTFLRA   49 (252)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999763


No 366
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=81.00  E-value=0.94  Score=53.78  Aligned_cols=22  Identities=41%  Similarity=0.496  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |.|++.-+.  |.||||||||+-+
T Consensus       497 ~~Ge~vaIv--G~SGsGKSTL~KL  518 (709)
T COG2274         497 PPGEKVAIV--GRSGSGKSTLLKL  518 (709)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679888888  9999999999875


No 367
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.96  E-value=1  Score=47.07  Aligned_cols=21  Identities=24%  Similarity=0.282  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~   51 (286)
T PRK13646         31 EQGKYYAIV--GQTGSGKSTLIQ   51 (286)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 368
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.91  E-value=1  Score=45.56  Aligned_cols=21  Identities=19%  Similarity=0.336  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||+|||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (246)
T PRK14269         26 EQNKITALI--GASGCGKSTFLR   46 (246)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 369
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.91  E-value=1  Score=47.06  Aligned_cols=21  Identities=38%  Similarity=0.631  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        63 ~~Ge~~~I~--G~nGsGKSTLl~   83 (285)
T PRK14254         63 PENQVTAMI--GPSGCGKSTFLR   83 (285)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 370
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=80.79  E-value=0.98  Score=51.25  Aligned_cols=22  Identities=41%  Similarity=0.490  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||..+
T Consensus       342 ~~G~~~~iv--G~sGsGKSTL~~l  363 (544)
T TIGR01842       342 QAGEALAII--GPSGSGKSTLARL  363 (544)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            579899999  9999999999764


No 371
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.66  E-value=1.1  Score=46.78  Aligned_cols=21  Identities=33%  Similarity=0.279  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGaGKSTLl~   51 (279)
T PRK13635         31 YEGEWVAIV--GHNGSGKSTLAK   51 (279)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            468888888  999999999964


No 372
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=80.65  E-value=1.1  Score=44.07  Aligned_cols=21  Identities=29%  Similarity=0.452  Sum_probs=18.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||.-
T Consensus        24 ~~Ge~~~i~--G~nGsGKStLl~   44 (200)
T cd03217          24 KKGEVHALM--GPNGSGKSTLAK   44 (200)
T ss_pred             CCCcEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999855


No 373
>PRK14531 adenylate kinase; Provisional
Probab=80.59  E-value=0.96  Score=43.97  Aligned_cols=17  Identities=24%  Similarity=0.266  Sum_probs=14.6

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ..+++  ||+||||||+|.
T Consensus         4 ~i~i~--G~pGsGKsT~~~   20 (183)
T PRK14531          4 RLLFL--GPPGAGKGTQAA   20 (183)
T ss_pred             EEEEE--CCCCCCHHHHHH
Confidence            46666  999999999987


No 374
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=80.59  E-value=1  Score=51.60  Aligned_cols=22  Identities=27%  Similarity=0.276  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||.-+
T Consensus       365 ~~Ge~iaIv--G~SGsGKSTLl~l  386 (592)
T PRK10790        365 PSRGFVALV--GHTGSGKSTLASL  386 (592)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999999  9999999999764


No 375
>PRK02496 adk adenylate kinase; Provisional
Probab=80.57  E-value=0.95  Score=43.68  Aligned_cols=17  Identities=24%  Similarity=0.280  Sum_probs=14.0

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      .+|+  ||+||||||+|..
T Consensus         4 i~i~--G~pGsGKst~a~~   20 (184)
T PRK02496          4 LIFL--GPPGAGKGTQAVV   20 (184)
T ss_pred             EEEE--CCCCCCHHHHHHH
Confidence            4555  9999999999873


No 376
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.54  E-value=1.5  Score=45.75  Aligned_cols=22  Identities=23%  Similarity=0.191  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||||||||.-+
T Consensus        30 ~~Ge~~~i~--G~nGaGKSTLl~~   51 (283)
T PRK13636         30 KKGEVTAIL--GGNGAGKSTLFQN   51 (283)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999653


No 377
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.51  E-value=1.1  Score=48.04  Aligned_cols=22  Identities=23%  Similarity=0.256  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        50 ~~Ge~~~I~--G~nGsGKSTLl~~   71 (320)
T PRK13631         50 EKNKIYFII--GNSGSGKSTLVTH   71 (320)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 378
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.47  E-value=1.1  Score=46.96  Aligned_cols=21  Identities=19%  Similarity=0.213  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGaGKSTLl~   51 (287)
T PRK13637         31 EDGEFVGLI--GHTGSGKSTLIQ   51 (287)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999965


No 379
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=80.46  E-value=0.99  Score=55.09  Aligned_cols=31  Identities=32%  Similarity=0.394  Sum_probs=25.0

Q ss_pred             ccch-hccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        270 EHML-ILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       270 eHm~-i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +|=+ ++-++=|.++-+.|+  |+|||||||||+
T Consensus         9 ~hNLKni~v~iP~~~l~v~T--GvSGSGKSSLaf   40 (924)
T TIGR00630         9 EHNLKNIDVEIPRDKLVVIT--GLSGSGKSSLAF   40 (924)
T ss_pred             cccccccccccCCCceEEEe--cCCCCCchhHHH
Confidence            3444 455666999999999  999999999997


No 380
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=80.43  E-value=1.1  Score=43.39  Aligned_cols=19  Identities=32%  Similarity=0.380  Sum_probs=15.6

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++..++.  ||||+|||||+-
T Consensus         2 ~r~ivl~--Gpsg~GK~~l~~   20 (183)
T PF00625_consen    2 RRPIVLV--GPSGSGKSTLAK   20 (183)
T ss_dssp             SSEEEEE--SSTTSSHHHHHH
T ss_pred             CCEEEEE--CCCCCCHHHHHH
Confidence            4556666  999999999976


No 381
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=80.41  E-value=1  Score=49.95  Aligned_cols=24  Identities=42%  Similarity=0.555  Sum_probs=17.8

Q ss_pred             cccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        276 GITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       276 gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |+.-|.|  .++.  ||+|||||+||..
T Consensus       175 Gl~~pkg--vLL~--GppGTGKT~LAka  198 (398)
T PTZ00454        175 GIDPPRG--VLLY--GPPGTGKTMLAKA  198 (398)
T ss_pred             CCCCCce--EEEE--CCCCCCHHHHHHH
Confidence            4444444  7777  9999999999863


No 382
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]
Probab=80.37  E-value=1  Score=52.38  Aligned_cols=21  Identities=33%  Similarity=0.381  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..++.  |+||||||||--
T Consensus       417 ~~G~~llI~--G~SG~GKTsLlR  437 (604)
T COG4178         417 RPGERLLIT--GESGAGKTSLLR  437 (604)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            468999999  999999999954


No 383
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=80.37  E-value=0.99  Score=49.75  Aligned_cols=21  Identities=24%  Similarity=0.259  Sum_probs=17.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++|....|.  ||+|+|||||+.
T Consensus       135 ~~g~ii~lv--GptGvGKTTtia  155 (374)
T PRK14722        135 ERGGVFALM--GPTGVGKTTTTA  155 (374)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            457677777  999999999977


No 384
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=80.32  E-value=1.1  Score=47.73  Aligned_cols=20  Identities=15%  Similarity=-0.052  Sum_probs=16.0

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      .+...++  |+|||||||++..
T Consensus         6 ~~~i~i~--G~~GsGKtt~~~~   25 (288)
T PRK05416          6 MRLVIVT--GLSGAGKSVALRA   25 (288)
T ss_pred             ceEEEEE--CCCCCcHHHHHHH
Confidence            4456666  9999999999883


No 385
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=80.20  E-value=1  Score=52.59  Aligned_cols=22  Identities=32%  Similarity=0.294  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||.-+
T Consensus       489 ~~G~~iaIv--G~sGsGKSTLlkl  510 (694)
T TIGR03375       489 RPGEKVAII--GRIGSGKSTLLKL  510 (694)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679998888  9999999999764


No 386
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=80.11  E-value=1  Score=52.65  Aligned_cols=22  Identities=32%  Similarity=0.394  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  |+||||||||..+
T Consensus       503 ~~Ge~vaIv--G~sGsGKSTLlkl  524 (710)
T TIGR03796       503 QPGQRVALV--GGSGSGKSTIAKL  524 (710)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999898  9999999999864


No 387
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.09  E-value=1.1  Score=46.92  Aligned_cols=22  Identities=18%  Similarity=0.194  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        30 ~~Ge~v~i~--G~nGsGKSTLl~~   51 (288)
T PRK13643         30 KKGSYTALI--GHTGSGKSTLLQH   51 (288)
T ss_pred             cCCCEEEEE--CCCCChHHHHHHH
Confidence            578888888  9999999999763


No 388
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=80.08  E-value=1.1  Score=51.35  Aligned_cols=22  Identities=36%  Similarity=0.409  Sum_probs=19.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  ||||||||||..+
T Consensus       339 ~~G~~~~iv--G~sGsGKSTLl~l  360 (569)
T PRK10789        339 KPGQMLGIC--GPTGSGKSTLLSL  360 (569)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            569899898  9999999999763


No 389
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.03  E-value=1.1  Score=45.34  Aligned_cols=22  Identities=32%  Similarity=0.430  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  |+||+|||||.-+
T Consensus        27 ~~Ge~~~i~--G~nGsGKSTLl~~   48 (250)
T PRK14245         27 EEKSVVAFI--GPSGCGKSTFLRL   48 (250)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHHH
Confidence            468888888  9999999999764


No 390
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=79.96  E-value=0.99  Score=45.10  Aligned_cols=32  Identities=38%  Similarity=0.440  Sum_probs=19.1

Q ss_pred             EEeEcCCccchhhhcc-cC--CCCCCCeeEEeecc
Q psy13077        287 IAAAFPSACGKTNLAM-LN--PTLPGYKVECVGDD  318 (630)
Q Consensus       287 f~~afpSg~GKTtLam-~~--p~~pgwk~~lIGDD  318 (630)
                      ++-.||+|+||||+++ |.  -...|++|.+|-=|
T Consensus         4 i~lvGptGvGKTTt~aKLAa~~~~~~~~v~lis~D   38 (196)
T PF00448_consen    4 IALVGPTGVGKTTTIAKLAARLKLKGKKVALISAD   38 (196)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHHHHTT--EEEEEES
T ss_pred             EEEECCCCCchHhHHHHHHHHHhhccccceeecCC
Confidence            3445999999999876 10  00126777777655


No 391
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=79.96  E-value=1.1  Score=47.52  Aligned_cols=21  Identities=24%  Similarity=0.214  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~v~ii--G~nGsGKSTLl~   51 (305)
T PRK13651         31 NQGEFIAII--GQTGSGKTTFIE   51 (305)
T ss_pred             eCCCEEEEE--CCCCCcHHHHHH
Confidence            468888888  999999999965


No 392
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=79.93  E-value=1.1  Score=46.04  Aligned_cols=21  Identities=38%  Similarity=0.564  Sum_probs=19.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....+.  |++|||||++++
T Consensus        21 p~g~~~lI~--G~pGsGKT~f~~   41 (260)
T COG0467          21 PRGSVVLIT--GPPGTGKTIFAL   41 (260)
T ss_pred             cCCcEEEEE--cCCCCcHHHHHH
Confidence            889999999  999999999998


No 393
>PRK00698 tmk thymidylate kinase; Validated
Probab=79.91  E-value=1.1  Score=43.46  Aligned_cols=17  Identities=18%  Similarity=0.198  Sum_probs=13.7

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      +++--|++||||||++.
T Consensus         5 ~I~ieG~~gsGKsT~~~   21 (205)
T PRK00698          5 FITIEGIDGAGKSTQIE   21 (205)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            44444999999999986


No 394
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. PRK catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=79.90  E-value=0.91  Score=48.17  Aligned_cols=15  Identities=27%  Similarity=0.244  Sum_probs=12.9

Q ss_pred             EeEcCCccchhhhcc
Q psy13077        288 AAAFPSACGKTNLAM  302 (630)
Q Consensus       288 ~~afpSg~GKTtLam  302 (630)
                      .-+|+|||||||++.
T Consensus         3 gItG~SGSGKTTv~~   17 (277)
T cd02029           3 AVTGSSGAGTTTVKR   17 (277)
T ss_pred             EEECCCCCCHHHHHH
Confidence            445999999999986


No 395
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=79.89  E-value=1.1  Score=50.51  Aligned_cols=21  Identities=33%  Similarity=0.233  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        24 ~~Ge~~~ii--G~nGsGKSTLl~   44 (520)
T TIGR03269        24 EEGEVLGIL--GRSGAGKSVLMH   44 (520)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 396
>PF08423 Rad51:  Rad51;  InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51. It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
Probab=79.87  E-value=0.95  Score=47.01  Aligned_cols=21  Identities=38%  Similarity=0.494  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|..+-++  |+||||||.|+|
T Consensus        36 ~~g~itEi~--G~~gsGKTql~l   56 (256)
T PF08423_consen   36 PTGSITEIV--GESGSGKTQLCL   56 (256)
T ss_dssp             ETTSEEEEE--ESTTSSHHHHHH
T ss_pred             CCCcEEEEE--EecccccchHHH
Confidence            568899999  999999999976


No 397
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.82  E-value=1.2  Score=45.72  Aligned_cols=22  Identities=27%  Similarity=0.398  Sum_probs=18.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||.-+
T Consensus        31 ~~Ge~~~I~--G~nGsGKSTLl~~   52 (261)
T PRK14258         31 YQSKVTAII--GPSGCGKSTFLKC   52 (261)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 398
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=79.75  E-value=1.1  Score=50.87  Aligned_cols=22  Identities=32%  Similarity=0.427  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+...+.  |+||||||||..+
T Consensus       364 ~~Ge~i~Iv--G~sGsGKSTLlkl  385 (576)
T TIGR02204       364 RPGETVALV--GPSGAGKSTLFQL  385 (576)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            569999999  9999999999773


No 399
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=79.72  E-value=0.92  Score=43.17  Aligned_cols=13  Identities=31%  Similarity=0.378  Sum_probs=11.9

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      +|++|||||+|++
T Consensus         5 ~G~~G~GKT~l~~   17 (187)
T cd01124           5 SGGPGTGKTTFAL   17 (187)
T ss_pred             EcCCCCCHHHHHH
Confidence            3999999999987


No 400
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=79.69  E-value=1.4  Score=47.42  Aligned_cols=37  Identities=19%  Similarity=0.034  Sum_probs=26.5

Q ss_pred             CCCEEEEEeEcCCccchhhhcccCC---CCCCCeeEEeeccE
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAMLNP---TLPGYKVECVGDDI  319 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam~~p---~~pgwk~~lIGDDi  319 (630)
                      .|....|.  ||+|+||||++..-.   ...|.+|-+++-|.
T Consensus       113 ~~~vi~lv--GpnGsGKTTt~~kLA~~l~~~g~~V~Li~~D~  152 (318)
T PRK10416        113 KPFVILVV--GVNGVGKTTTIGKLAHKYKAQGKKVLLAAGDT  152 (318)
T ss_pred             CCeEEEEE--CCCCCcHHHHHHHHHHHHHhcCCeEEEEecCc
Confidence            46566666  999999999876211   12467899999886


No 401
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.63  E-value=1.2  Score=46.69  Aligned_cols=21  Identities=29%  Similarity=0.338  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~i~--G~nGsGKSTLl~   51 (290)
T PRK13634         31 PSGSYVAII--GHTGSGKSTLLQ   51 (290)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999965


No 402
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=79.57  E-value=1.5  Score=47.05  Aligned_cols=34  Identities=29%  Similarity=0.282  Sum_probs=22.4

Q ss_pred             ccccchhccccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        268 LAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       268 LaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |..+++=..+..|.-..+-+|  |+||+|||||--+
T Consensus        10 lG~~~l~a~~~~p~~GvTAlF--G~SGsGKTslin~   43 (352)
T COG4148          10 LGNFALDANFTLPARGITALF--GPSGSGKTSLINM   43 (352)
T ss_pred             cCceEEEEeccCCCCceEEEe--cCCCCChhhHHHH
Confidence            344454334556762366677  8999999999653


No 403
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=79.48  E-value=1.2  Score=39.08  Aligned_cols=16  Identities=31%  Similarity=0.214  Sum_probs=12.8

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      .++.  |++|+|||||--
T Consensus         2 I~V~--G~~g~GKTsLi~   17 (119)
T PF08477_consen    2 IVVL--GDSGVGKTSLIR   17 (119)
T ss_dssp             EEEE--CSTTSSHHHHHH
T ss_pred             EEEE--CcCCCCHHHHHH
Confidence            4555  999999999943


No 404
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=79.45  E-value=1.1  Score=52.71  Aligned_cols=22  Identities=32%  Similarity=0.433  Sum_probs=19.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  ||||||||||.-+
T Consensus       505 ~~Ge~vaIv--G~SGsGKSTLl~l  526 (711)
T TIGR00958       505 HPGEVVALV--GPSGSGKSTVAAL  526 (711)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            679999898  9999999999764


No 405
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=79.41  E-value=1.2  Score=51.18  Aligned_cols=22  Identities=32%  Similarity=0.510  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  ||||||||||.-+
T Consensus       364 ~~G~~~aiv--G~sGsGKSTL~~l  385 (574)
T PRK11160        364 KAGEKVALL--GRTGCGKSTLLQL  385 (574)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            679898888  9999999998763


No 406
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.35  E-value=1.2  Score=46.08  Aligned_cols=22  Identities=23%  Similarity=0.365  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ..|+..-+.  ||||||||||.-+
T Consensus        26 ~~Ge~~~l~--G~nGsGKSTLl~~   47 (275)
T PRK13639         26 EKGEMVALL--GPNGAGKSTLFLH   47 (275)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999663


No 407
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=79.34  E-value=1.2  Score=43.82  Aligned_cols=23  Identities=30%  Similarity=0.384  Sum_probs=16.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +..+-..++-||++||||||++.
T Consensus        11 ~~~~P~~~i~aG~~GsGKSt~~~   33 (199)
T PF06414_consen   11 PQEKPTLIIIAGQPGSGKSTLAR   33 (199)
T ss_dssp             --SS-EEEEEES-TTSTTHHHHH
T ss_pred             cccCCEEEEEeCCCCCCHHHHHH
Confidence            44556777778999999999987


No 408
>PRK06526 transposase; Provisional
Probab=79.33  E-value=1  Score=46.77  Aligned_cols=19  Identities=32%  Similarity=0.415  Sum_probs=16.0

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++-.++.  ||+|||||+||.
T Consensus        98 ~~nlll~--Gp~GtGKThLa~  116 (254)
T PRK06526         98 KENVVFL--GPPGTGKTHLAI  116 (254)
T ss_pred             CceEEEE--eCCCCchHHHHH
Confidence            3457777  999999999988


No 409
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=79.31  E-value=1.1  Score=54.70  Aligned_cols=27  Identities=22%  Similarity=0.272  Sum_probs=23.1

Q ss_pred             hccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        274 ILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       274 i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++-|.=|.++-+.|+  |+|||||||||+
T Consensus        18 ni~v~iP~~~l~v~T--GvSGSGKSSLaf   44 (943)
T PRK00349         18 NIDLDIPRDKLVVFT--GLSGSGKSSLAF   44 (943)
T ss_pred             ccccccCCCceEEEe--cCCCCCchhHHH
Confidence            445566999999999  999999999997


No 410
>CHL00181 cbbX CbbX; Provisional
Probab=79.22  E-value=1.3  Score=46.69  Aligned_cols=20  Identities=25%  Similarity=0.288  Sum_probs=16.1

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |-...|.  ||+||||||+|.+
T Consensus        59 ~~~ill~--G~pGtGKT~lAr~   78 (287)
T CHL00181         59 GLHMSFT--GSPGTGKTTVALK   78 (287)
T ss_pred             CceEEEE--CCCCCCHHHHHHH
Confidence            4446666  9999999999884


No 411
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=79.13  E-value=1.2  Score=50.17  Aligned_cols=21  Identities=24%  Similarity=0.108  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus       287 ~~Ge~~~l~--G~NGsGKSTLlk  307 (510)
T PRK09700        287 CRGEILGFA--GLVGSGRTELMN  307 (510)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            569888888  999999999965


No 412
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=79.06  E-value=3.9  Score=41.74  Aligned_cols=51  Identities=25%  Similarity=0.294  Sum_probs=35.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc----cCCCCCCCeeEEeeccEEEEEECCCccEEEec
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM----LNPTLPGYKVECVGDDIAWMKFDKEGVLRAIN  334 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam----~~p~~pgwk~~lIGDDiaW~~~~~dG~l~a~N  334 (630)
                      .+||+.-+.  |.||+||+|+--    |.-|..|  .-.|++++-=++.|.||.|.+.+
T Consensus        30 ~~GdVisII--GsSGSGKSTfLRCiN~LE~P~~G--~I~v~geei~~k~~~~G~l~~ad   84 (256)
T COG4598          30 NAGDVISII--GSSGSGKSTFLRCINFLEKPSAG--SIRVNGEEIRLKRDKDGQLKPAD   84 (256)
T ss_pred             CCCCEEEEe--cCCCCchhHHHHHHHhhcCCCCc--eEEECCeEEEeeeCCCCCeeeCC
Confidence            568998888  999999999742    3333456  45555554347779999865543


No 413
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=79.05  E-value=1.3  Score=46.09  Aligned_cols=21  Identities=24%  Similarity=0.259  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        34 ~~Ge~~~l~--G~nGsGKSTLl~   54 (280)
T PRK13633         34 KKGEFLVIL--GRNGSGKSTIAK   54 (280)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999965


No 414
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=79.00  E-value=1.3  Score=43.03  Aligned_cols=18  Identities=17%  Similarity=0.381  Sum_probs=14.9

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..++.  |++|||||||+-+
T Consensus         6 ~I~li--G~~GaGKStl~~~   23 (172)
T PRK05057          6 NIFLV--GPMGAGKSTIGRQ   23 (172)
T ss_pred             EEEEE--CCCCcCHHHHHHH
Confidence            45566  9999999999874


No 415
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=78.89  E-value=1.2  Score=44.15  Aligned_cols=19  Identities=32%  Similarity=0.422  Sum_probs=15.2

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .| ...+.  ||||||||||.-
T Consensus        22 ~g-~~~i~--G~nGsGKStll~   40 (197)
T cd03278          22 PG-LTAIV--GPNGSGKSNIID   40 (197)
T ss_pred             CC-cEEEE--CCCCCCHHHHHH
Confidence            46 56666  999999999965


No 416
>PRK08727 hypothetical protein; Validated
Probab=78.88  E-value=1.3  Score=45.04  Aligned_cols=18  Identities=39%  Similarity=0.615  Sum_probs=15.5

Q ss_pred             CEEEEEeEcCCccchhhhcc
Q psy13077        283 QKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam  302 (630)
                      +-.++.  |+||||||.|+.
T Consensus        42 ~~l~l~--G~~G~GKThL~~   59 (233)
T PRK08727         42 DWLYLS--GPAGTGKTHLAL   59 (233)
T ss_pred             CeEEEE--CCCCCCHHHHHH
Confidence            457777  999999999987


No 417
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=78.79  E-value=1.2  Score=47.28  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=16.0

Q ss_pred             CEEEEEeEcCCccchhhhccc
Q psy13077        283 QKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam~  303 (630)
                      +..+|.  ||+|||||+||..
T Consensus        52 ~~~ll~--GppG~GKT~la~~   70 (328)
T PRK00080         52 DHVLLY--GPPGLGKTTLANI   70 (328)
T ss_pred             CcEEEE--CCCCccHHHHHHH
Confidence            356777  9999999999874


No 418
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=78.78  E-value=1.3  Score=45.90  Aligned_cols=22  Identities=23%  Similarity=0.218  Sum_probs=19.0

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  ||+|||||||..+
T Consensus        48 ~~Ge~~~li--G~NGsGKSTLlk~   69 (264)
T PRK13546         48 YEGDVIGLV--GINGSGKSTLSNI   69 (264)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999763


No 419
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=78.70  E-value=1.3  Score=49.98  Aligned_cols=21  Identities=19%  Similarity=0.200  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        29 ~~Ge~~~li--G~nGsGKSTLl~   49 (510)
T PRK09700         29 YPGEIHALL--GENGAGKSTLMK   49 (510)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999964


No 420
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=78.67  E-value=1.3  Score=45.65  Aligned_cols=22  Identities=27%  Similarity=0.502  Sum_probs=19.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ++|+...+.  |++|||||||..+
T Consensus        28 ~~Ge~~~i~--G~nGsGKSTL~~~   49 (235)
T COG1122          28 EKGERVLLI--GPNGSGKSTLLKL   49 (235)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHHH
Confidence            678888888  9999999999874


No 421
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=78.66  E-value=1.1  Score=50.98  Aligned_cols=23  Identities=39%  Similarity=0.443  Sum_probs=19.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcccC
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAMLN  304 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~~  304 (630)
                      +.|++.-+.  ||||||||||+.+-
T Consensus       353 ~~Ge~vaiV--G~sGsGKSTl~~LL  375 (567)
T COG1132         353 EPGEKVAIV--GPSGSGKSTLIKLL  375 (567)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHHH
Confidence            668888888  99999999998854


No 422
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=78.66  E-value=1  Score=43.05  Aligned_cols=16  Identities=13%  Similarity=0.146  Sum_probs=13.3

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      .+++  |++||||||+|.
T Consensus         2 i~i~--G~pGsGKst~a~   17 (183)
T TIGR01359         2 VFVL--GGPGSGKGTQCA   17 (183)
T ss_pred             EEEE--CCCCCCHHHHHH
Confidence            3456  999999999976


No 423
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=78.66  E-value=1.3  Score=51.17  Aligned_cols=22  Identities=32%  Similarity=0.336  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+.+-+.  |+||||||||..+
T Consensus       345 ~~g~~talv--G~SGaGKSTLl~l  366 (559)
T COG4988         345 KAGQLTALV--GASGAGKSTLLNL  366 (559)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            568888888  9999999999653


No 424
>PF13173 AAA_14:  AAA domain
Probab=78.63  E-value=1.4  Score=40.33  Aligned_cols=19  Identities=26%  Similarity=0.280  Sum_probs=15.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      ++...+.  ||-+||||||+.
T Consensus         2 ~~~~~l~--G~R~vGKTtll~   20 (128)
T PF13173_consen    2 RKIIILT--GPRGVGKTTLLK   20 (128)
T ss_pred             CCeEEEE--CCCCCCHHHHHH
Confidence            4567777  999999999975


No 425
>PHA00729 NTP-binding motif containing protein
Probab=78.61  E-value=1.4  Score=45.52  Aligned_cols=18  Identities=28%  Similarity=0.209  Sum_probs=14.7

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..+++  |++||||||||+.
T Consensus        19 nIlIt--G~pGvGKT~LA~a   36 (226)
T PHA00729         19 SAVIF--GKQGSGKTTYALK   36 (226)
T ss_pred             EEEEE--CCCCCCHHHHHHH
Confidence            35555  9999999999983


No 426
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=78.55  E-value=1.3  Score=49.55  Aligned_cols=21  Identities=24%  Similarity=0.230  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        27 ~~Ge~~~li--G~nGsGKSTLl~   47 (490)
T PRK10938         27 NAGDSWAFV--GANGSGKSALAR   47 (490)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            569888888  999999999964


No 427
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=78.54  E-value=1.2  Score=43.76  Aligned_cols=20  Identities=35%  Similarity=0.501  Sum_probs=15.9

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ++-.++.  |++|||||.||+.
T Consensus        47 ~~~l~l~--G~~G~GKThLa~a   66 (178)
T PF01695_consen   47 GENLILY--GPPGTGKTHLAVA   66 (178)
T ss_dssp             --EEEEE--ESTTSSHHHHHHH
T ss_pred             CeEEEEE--hhHhHHHHHHHHH
Confidence            4558888  9999999999883


No 428
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=78.52  E-value=1.2  Score=42.22  Aligned_cols=18  Identities=28%  Similarity=0.564  Sum_probs=14.9

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..++.  |++||||||++..
T Consensus         4 ~i~~~--G~~GsGKst~~~~   21 (171)
T PRK03731          4 PLFLV--GARGCGKTTVGMA   21 (171)
T ss_pred             eEEEE--CCCCCCHHHHHHH
Confidence            45666  9999999999874


No 429
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.
Probab=78.41  E-value=1.3  Score=50.13  Aligned_cols=22  Identities=27%  Similarity=0.317  Sum_probs=19.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++..+.  |+||||||||..+
T Consensus       356 ~~G~~v~Iv--G~sGsGKSTLl~l  377 (571)
T TIGR02203       356 EPGETVALV--GRSGSGKSTLVNL  377 (571)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHHH
Confidence            568899999  9999999999764


No 430
>PF06068 TIP49:  TIP49 C-terminus;  InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins. The N-terminal domain contains the AAA ATPase, central region IPR003959 from INTERPRO domain. In zebrafish, the liebeskummer (lik) mutation, causes development of hyperplastic embryonic hearts. lik encodes Reptin, a component of a DNA-stimulated ATPase complex. Beta-catenin and Pontin, a DNA-stimulated ATPase that is often part of complexes with Reptin, are in the same genetic pathways. The Reptin/Pontin ratio serves to regulate heart growth during development, at least in part via the beta-catenin pathway []. TBP-interacting protein 49 (TIP49) was originally identified as a TBP-binding protein, and two related proteins are encoded by individual genes, tip49a and b. Although the function of this gene family has not been elucidated, they are supposed to play a critical role in nuclear events because they interact with various kinds of nuclear factors and have DNA helicase activities. TIP49a has been suggested to act as an autoantigen in some patients with autoimmune diseases [].; GO: 0003678 DNA helicase activity, 0005524 ATP binding; PDB: 2XSZ_E 2CQA_A 2C9O_C.
Probab=78.32  E-value=1.1  Score=49.51  Aligned_cols=60  Identities=7%  Similarity=0.133  Sum_probs=28.8

Q ss_pred             cCCCCCcCCCCCCchhhhHhhhcCCHHHHHH-HHHHHHHHHHHhhCCCccHHHHHHHHHHHH
Q psy13077        566 IPKPEALITTNLASDVDLEELFSFDKSFWEQ-EVQDLQRYFNEQLGADLPTAIQAEIDALKQ  626 (630)
Q Consensus       566 iP~~~~l~~~Gl~~~~~~~~~~~~d~~~w~~-e~~~l~~~f~~~~~~~lP~ei~~~l~~~~~  626 (630)
                      |-..+...-.|+| --++.|++-+...-|.+ |++++-+.=.+.-+-.+.++.++.|.++-.
T Consensus       321 irGt~~~sphGiP-~DlLDRllII~t~py~~~ei~~Il~iR~~~E~v~i~~~al~~L~~ig~  381 (398)
T PF06068_consen  321 IRGTDIISPHGIP-LDLLDRLLIIRTKPYSEEEIKQILKIRAKEEDVEISEDALDLLTKIGV  381 (398)
T ss_dssp             -BTTS-EEETT---HHHHTTEEEEEE----HHHHHHHHHHHHHHCT--B-HHHHHHHHHHHH
T ss_pred             ccCccCcCCCCCC-cchHhhcEEEECCCCCHHHHHHHHHhhhhhhcCcCCHHHHHHHHHHhh
Confidence            4444444468888 34556888887777754 344443322223456788888888887654


No 431
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=78.29  E-value=1.2  Score=49.94  Aligned_cols=25  Identities=40%  Similarity=0.562  Sum_probs=18.5

Q ss_pred             ccccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        275 LGITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       275 ~gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +|+..|.|  .++.  ||+|||||+||-+
T Consensus       212 ~gi~~p~g--VLL~--GPPGTGKT~LAra  236 (438)
T PTZ00361        212 IGIKPPKG--VILY--GPPGTGKTLLAKA  236 (438)
T ss_pred             cCCCCCcE--EEEE--CCCCCCHHHHHHH
Confidence            45544544  6677  9999999999863


No 432
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=78.27  E-value=1.2  Score=51.12  Aligned_cols=33  Identities=30%  Similarity=0.532  Sum_probs=22.0

Q ss_pred             ccCcccccchhccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        264 REGWLAEHMLILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       264 ~eGwLaeHm~i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      -+.||-.+.+  +  ....+..++.  |||||||||+.-
T Consensus        31 V~~wl~~~~~--~--~~~~~iLlLt--GP~G~GKtttv~   63 (519)
T PF03215_consen   31 VRSWLEEMFS--G--SSPKRILLLT--GPSGCGKTTTVK   63 (519)
T ss_pred             HHHHHHHHhc--c--CCCcceEEEE--CCCCCCHHHHHH
Confidence            4567766554  2  1234456666  999999999865


No 433
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.
Probab=78.24  E-value=1.3  Score=50.54  Aligned_cols=22  Identities=36%  Similarity=0.650  Sum_probs=19.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|++.-+.  ||||||||||..+
T Consensus       366 ~~G~~~aiv--G~sGsGKSTl~~l  387 (555)
T TIGR01194       366 AQGDIVFIV--GENGCGKSTLAKL  387 (555)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHHH
Confidence            679999999  9999999999874


No 434
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=78.22  E-value=0.89  Score=54.34  Aligned_cols=44  Identities=27%  Similarity=0.373  Sum_probs=30.3

Q ss_pred             cccCCCCCEEEEEeEcCCccchhhhcccCCCCCCCeeEEeeccEEEEEEC
Q psy13077        276 GITNPEGQKKYIAAAFPSACGKTNLAMLNPTLPGYKVECVGDDIAWMKFD  325 (630)
Q Consensus       276 gv~~p~G~~~~f~~afpSg~GKTtLam~~p~~pgwk~~lIGDDiaW~~~~  325 (630)
                      |+.+|+-=.--|+.+||||+|||-||-.-.      ..+-||+.+-||||
T Consensus       513 GL~dp~rPigsFlF~GPTGVGKTELAkaLA------~~Lfg~e~aliR~D  556 (786)
T COG0542         513 GLGDPNRPIGSFLFLGPTGVGKTELAKALA------EALFGDEQALIRID  556 (786)
T ss_pred             CCCCCCCCceEEEeeCCCcccHHHHHHHHH------HHhcCCCccceeec
Confidence            566665323344445999999999987323      36667777999986


No 435
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=78.14  E-value=1.4  Score=45.68  Aligned_cols=21  Identities=24%  Similarity=0.404  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||+|||||.-
T Consensus        28 ~~Ge~~~i~--G~NGsGKSTLl~   48 (277)
T PRK13652         28 PRNSRIAVI--GPNGAGKSTLFR   48 (277)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            569888888  999999999965


No 436
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=78.09  E-value=1.4  Score=49.40  Aligned_cols=21  Identities=29%  Similarity=0.381  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus       284 ~~Ge~~~i~--G~NGsGKSTLl~  304 (490)
T PRK10938        284 NPGEHWQIV--GPNGAGKSTLLS  304 (490)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 437
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=78.08  E-value=1.4  Score=45.33  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        32 ~~Ge~~~i~--G~nGsGKSTLl~   52 (261)
T PRK14263         32 RKNEITGFI--GPSGCGKSTVLR   52 (261)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 438
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=78.07  E-value=1.4  Score=43.88  Aligned_cols=19  Identities=21%  Similarity=0.244  Sum_probs=15.9

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |+...+.  ||+|||||||.-
T Consensus        28 ~~~~~i~--G~NGsGKSTll~   46 (213)
T cd03279          28 NGLFLIC--GPTGAGKSTILD   46 (213)
T ss_pred             cCEEEEE--CCCCCCHHHHHH
Confidence            6677777  999999999944


No 439
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.07  E-value=1.3  Score=43.67  Aligned_cols=19  Identities=26%  Similarity=0.134  Sum_probs=15.6

Q ss_pred             CEEEEEeEcCCccchhhhccc
Q psy13077        283 QKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam~  303 (630)
                      +..-+.  ||||||||||.-+
T Consensus        24 e~~~i~--G~nGsGKSTLl~~   42 (214)
T cd03297          24 EVTGIF--GASGAGKSTLLRC   42 (214)
T ss_pred             eeEEEE--CCCCCCHHHHHHH
Confidence            566666  9999999999763


No 440
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=78.04  E-value=1.4  Score=52.92  Aligned_cols=32  Identities=31%  Similarity=0.375  Sum_probs=27.3

Q ss_pred             cccch-hccccCCCCCEEEEEeEcCCccchhhhcc
Q psy13077        269 AEHML-ILGITNPEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       269 aeHm~-i~gv~~p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      -+|.+ ++-+.-|.++-..|+  |+||+||++||.
T Consensus        12 rehNLKNi~l~iPr~klvV~T--GlSGSGKSSLAF   44 (935)
T COG0178          12 REHNLKNIDLEIPRNKLVVIT--GLSGSGKSSLAF   44 (935)
T ss_pred             hhcccccccccccCCcEEEEe--cCCCCCchhhhh
Confidence            36777 666777999889999  999999999986


No 441
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=78.04  E-value=1.4  Score=45.64  Aligned_cols=21  Identities=24%  Similarity=0.208  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  |+||||||||.-
T Consensus        31 ~~Ge~~~I~--G~nGsGKSTLl~   51 (277)
T PRK13642         31 TKGEWVSII--GQNGSGKSTTAR   51 (277)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            468888888  999999999965


No 442
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=77.84  E-value=1.4  Score=45.64  Aligned_cols=21  Identities=29%  Similarity=0.328  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||.-
T Consensus        26 ~~Ge~~~i~--G~nGsGKSTLl~   46 (274)
T PRK13644         26 KKGEYIGII--GKNGSGKSTLAL   46 (274)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 443
>PRK04040 adenylate kinase; Provisional
Probab=77.81  E-value=1.3  Score=43.82  Aligned_cols=16  Identities=19%  Similarity=0.127  Sum_probs=13.3

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..++  |++||||||++.
T Consensus         5 i~v~--G~pG~GKtt~~~   20 (188)
T PRK04040          5 VVVT--GVPGVGKTTVLN   20 (188)
T ss_pred             EEEE--eCCCCCHHHHHH
Confidence            4445  999999999987


No 444
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=77.80  E-value=1.3  Score=45.87  Aligned_cols=13  Identities=23%  Similarity=0.153  Sum_probs=12.1

Q ss_pred             EcCCccchhhhcc
Q psy13077        290 AFPSACGKTNLAM  302 (630)
Q Consensus       290 afpSg~GKTtLam  302 (630)
                      .|++||||||+|.
T Consensus         8 ~G~pGSGKSTla~   20 (300)
T PHA02530          8 VGVPGSGKSTWAR   20 (300)
T ss_pred             EcCCCCCHHHHHH
Confidence            4999999999987


No 445
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=77.76  E-value=1.3  Score=46.60  Aligned_cols=18  Identities=22%  Similarity=0.141  Sum_probs=14.8

Q ss_pred             CCEEEEEeEcCCccchhhhc
Q psy13077        282 GQKKYIAAAFPSACGKTNLA  301 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLa  301 (630)
                      +--.+|.  ||+|||||++|
T Consensus        58 ~~~vll~--G~pGTGKT~lA   75 (284)
T TIGR02880        58 TLHMSFT--GNPGTGKTTVA   75 (284)
T ss_pred             CceEEEE--cCCCCCHHHHH
Confidence            3346677  99999999999


No 446
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=77.74  E-value=1.4  Score=46.50  Aligned_cols=21  Identities=19%  Similarity=0.221  Sum_probs=17.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||+|||||||.-
T Consensus        26 ~~Gei~~l~--G~NGaGKTTLl~   46 (301)
T TIGR03522        26 QKGRIVGFL--GPNGAGKSTTMK   46 (301)
T ss_pred             eCCeEEEEE--CCCCCCHHHHHH
Confidence            568887777  999999999954


No 447
>PRK13947 shikimate kinase; Provisional
Probab=77.74  E-value=1.3  Score=41.80  Aligned_cols=17  Identities=18%  Similarity=0.001  Sum_probs=14.1

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      .++.  |++||||||+|-.
T Consensus         4 I~l~--G~~GsGKst~a~~   20 (171)
T PRK13947          4 IVLI--GFMGTGKTTVGKR   20 (171)
T ss_pred             EEEE--cCCCCCHHHHHHH
Confidence            4555  9999999999874


No 448
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=77.74  E-value=1.4  Score=45.94  Aligned_cols=21  Identities=24%  Similarity=0.248  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||+|||||.-
T Consensus        31 ~~Ge~~~ii--G~NGaGKSTLl~   51 (287)
T PRK13641         31 EEGSFVALV--GHTGSGKSTLMQ   51 (287)
T ss_pred             eCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 449
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=77.58  E-value=1.1  Score=42.30  Aligned_cols=16  Identities=31%  Similarity=0.202  Sum_probs=11.4

Q ss_pred             EEEEeEcCCccchhhhcc
Q psy13077        285 KYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam  302 (630)
                      ..|+  |..+||||||+.
T Consensus         2 I~i~--G~~stGKTTL~~   17 (163)
T PF13521_consen    2 IVIT--GGPSTGKTTLIE   17 (163)
T ss_dssp             EEEE----TTSHHHHHHH
T ss_pred             EEEE--CCCCCCHHHHHH
Confidence            3455  999999999987


No 450
>TIGR00017 cmk cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors.
Probab=77.53  E-value=1.3  Score=44.85  Aligned_cols=18  Identities=39%  Similarity=0.438  Sum_probs=14.3

Q ss_pred             EEEeEcCCccchhhhccc
Q psy13077        286 YIAAAFPSACGKTNLAML  303 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam~  303 (630)
                      .++-.|||||||||++-+
T Consensus         4 ~i~i~G~~GsGKst~~~~   21 (217)
T TIGR00017         4 IIAIDGPSGAGKSTVAKA   21 (217)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            345559999999999873


No 451
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=77.43  E-value=1.5  Score=50.18  Aligned_cols=21  Identities=24%  Similarity=0.135  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus        31 ~~Ge~~~ii--G~NGsGKSTLlk   51 (556)
T PRK11819         31 FPGAKIGVL--GLNGAGKSTLLR   51 (556)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            579888888  999999999965


No 452
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=77.38  E-value=1.4  Score=49.54  Aligned_cols=21  Identities=14%  Similarity=0.173  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        28 ~~Ge~~~l~--G~NGsGKSTLl~   48 (501)
T PRK10762         28 YPGRVMALV--GENGAGKSTMMK   48 (501)
T ss_pred             cCCeEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999954


No 453
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=77.37  E-value=1.2  Score=43.10  Aligned_cols=17  Identities=29%  Similarity=0.280  Sum_probs=11.4

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ..++.  ||.|||||++.+
T Consensus        19 ~~~i~--GpPGTGKT~~l~   35 (236)
T PF13086_consen   19 ITLIQ--GPPGTGKTTTLA   35 (236)
T ss_dssp             -EEEE---STTSSHHHHHH
T ss_pred             CEEEE--CCCCCChHHHHH
Confidence            35555  999999997654


No 454
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=77.32  E-value=1.5  Score=48.44  Aligned_cols=21  Identities=29%  Similarity=0.257  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||..
T Consensus        48 ~~Gei~~I~--G~nGsGKSTLlr   68 (382)
T TIGR03415        48 EEGEICVLM--GLSGSGKSSLLR   68 (382)
T ss_pred             cCCCEEEEE--CCCCCcHHHHHH
Confidence            568888888  999999999975


No 455
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=77.12  E-value=1.6  Score=46.01  Aligned_cols=21  Identities=33%  Similarity=0.406  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||..
T Consensus        61 ~~Ge~~~li--G~NGsGKSTLl~   81 (282)
T cd03291          61 EKGEMLAIT--GSTGSGKTSLLM   81 (282)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999976


No 456
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=77.09  E-value=1.6  Score=46.14  Aligned_cols=21  Identities=33%  Similarity=0.572  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  |+||||||||..
T Consensus        69 ~~Ge~~~Iv--G~nGsGKSTLl~   89 (305)
T PRK14264         69 PEKSVTALI--GPSGCGKSTFLR   89 (305)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            468888899  999999999975


No 457
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=77.08  E-value=1.5  Score=49.43  Aligned_cols=21  Identities=38%  Similarity=0.328  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  ||||||||||.-
T Consensus       308 ~~Ge~~~l~--G~NGsGKSTLl~  328 (520)
T TIGR03269       308 KEGEIFGIV--GTSGAGKTTLSK  328 (520)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 458
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=77.07  E-value=1.1  Score=44.85  Aligned_cols=17  Identities=24%  Similarity=0.292  Sum_probs=14.0

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ..+++  |+|||||||+|.
T Consensus         5 ~i~i~--G~~G~GKst~a~   21 (197)
T PRK12339          5 IHFIG--GIPGVGKTSISG   21 (197)
T ss_pred             EEEEE--CCCCCCHHHHHH
Confidence            44445  999999999988


No 459
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=77.01  E-value=1.2  Score=47.85  Aligned_cols=19  Identities=32%  Similarity=0.401  Sum_probs=15.8

Q ss_pred             CEEEEEeEcCCccchhhhccc
Q psy13077        283 QKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       283 ~~~~f~~afpSg~GKTtLam~  303 (630)
                      |-.+|+  ||.|.||||||++
T Consensus        53 DHvLl~--GPPGlGKTTLA~I   71 (332)
T COG2255          53 DHVLLF--GPPGLGKTTLAHI   71 (332)
T ss_pred             CeEEee--CCCCCcHHHHHHH
Confidence            345677  9999999999995


No 460
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=76.98  E-value=1.5  Score=49.55  Aligned_cols=21  Identities=19%  Similarity=0.369  Sum_probs=18.4

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  ||||||||||.-
T Consensus        25 ~~Ge~~~li--G~NGsGKSTLl~   45 (530)
T PRK15064         25 GGGNRYGLI--GANGCGKSTFMK   45 (530)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 461
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=76.93  E-value=1.5  Score=49.60  Aligned_cols=21  Identities=19%  Similarity=0.235  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus       310 ~~Ge~~~i~--G~nGsGKSTLlk  330 (529)
T PRK15134        310 RPGETLGLV--GESGSGKSTTGL  330 (529)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 462
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=76.73  E-value=1.5  Score=49.15  Aligned_cols=21  Identities=19%  Similarity=0.186  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        25 ~~Ge~~~li--G~nGsGKSTLl~   45 (500)
T TIGR02633        25 RPGECVGLC--GENGAGKSTLMK   45 (500)
T ss_pred             eCCcEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999964


No 463
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=76.53  E-value=1.5  Score=50.85  Aligned_cols=22  Identities=27%  Similarity=0.264  Sum_probs=18.8

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      +.|+..-+.  |+||||||||..+
T Consensus        40 ~~Ge~~~lv--G~nGsGKSTLl~~   61 (623)
T PRK10261         40 QRGETLAIV--GESGSGKSVTALA   61 (623)
T ss_pred             CCCCEEEEE--CCCCChHHHHHHH
Confidence            568888888  9999999999863


No 464
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=76.46  E-value=1.6  Score=49.33  Aligned_cols=21  Identities=19%  Similarity=0.229  Sum_probs=18.2

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        35 ~~Ge~~~li--G~NGsGKSTLl~   55 (510)
T PRK15439         35 HAGEVHALL--GGNGAGKSTLMK   55 (510)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 465
>PRK08356 hypothetical protein; Provisional
Probab=76.40  E-value=1.6  Score=42.87  Aligned_cols=18  Identities=28%  Similarity=0.298  Sum_probs=14.1

Q ss_pred             EEEeEcCCccchhhhccc
Q psy13077        286 YIAAAFPSACGKTNLAML  303 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam~  303 (630)
                      .++-.||+||||||+|-.
T Consensus         7 ~i~~~G~~gsGK~t~a~~   24 (195)
T PRK08356          7 IVGVVGKIAAGKTTVAKF   24 (195)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            344459999999999873


No 466
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=76.35  E-value=1.5  Score=49.44  Aligned_cols=21  Identities=19%  Similarity=0.238  Sum_probs=17.9

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||||||||||.-
T Consensus        29 ~~Ge~~~l~--G~nGsGKSTLl~   49 (506)
T PRK13549         29 RAGEIVSLC--GENGAGKSTLMK   49 (506)
T ss_pred             eCCeEEEEE--CCCCCCHHHHHH
Confidence            468888888  999999999964


No 467
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=76.33  E-value=1.7  Score=44.05  Aligned_cols=17  Identities=29%  Similarity=0.155  Sum_probs=14.6

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ...+.  |++|||||||+.
T Consensus        45 ~~~l~--G~~G~GKTtl~~   61 (269)
T TIGR03015        45 FILIT--GEVGAGKTTLIR   61 (269)
T ss_pred             EEEEE--cCCCCCHHHHHH
Confidence            56666  999999999987


No 468
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=76.32  E-value=1.6  Score=48.87  Aligned_cols=21  Identities=14%  Similarity=0.085  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        22 ~~Ge~~~li--G~nGsGKSTLl~   42 (491)
T PRK10982         22 RPHSIHALM--GENGAGKSTLLK   42 (491)
T ss_pred             cCCcEEEEE--CCCCCCHHHHHH
Confidence            578888888  999999999964


No 469
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=76.25  E-value=1.7  Score=43.36  Aligned_cols=21  Identities=29%  Similarity=0.437  Sum_probs=18.7

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.|....+.  |++|+|||+|++
T Consensus        14 ~~g~~~li~--G~~G~GKt~~~~   34 (224)
T TIGR03880        14 PEGHVIVVI--GEYGTGKTTFSL   34 (224)
T ss_pred             CCCeEEEEE--CCCCCCHHHHHH
Confidence            668888888  999999999988


No 470
>PRK14532 adenylate kinase; Provisional
Probab=76.22  E-value=1.5  Score=42.30  Aligned_cols=17  Identities=29%  Similarity=0.194  Sum_probs=13.8

Q ss_pred             EEEEeEcCCccchhhhccc
Q psy13077        285 KYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       285 ~~f~~afpSg~GKTtLam~  303 (630)
                      .+++  ||+||||||+|..
T Consensus         3 i~~~--G~pGsGKsT~a~~   19 (188)
T PRK14532          3 LILF--GPPAAGKGTQAKR   19 (188)
T ss_pred             EEEE--CCCCCCHHHHHHH
Confidence            3455  9999999999873


No 471
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=76.20  E-value=1.7  Score=44.32  Aligned_cols=17  Identities=24%  Similarity=0.151  Sum_probs=13.7

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      ...+.  ||||||||||.-
T Consensus        27 ~~~Iv--G~NGsGKStll~   43 (251)
T cd03273          27 FNAIT--GLNGSGKSNILD   43 (251)
T ss_pred             eEEEE--CCCCCCHHHHHH
Confidence            45555  999999999954


No 472
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=76.13  E-value=1.5  Score=40.97  Aligned_cols=16  Identities=25%  Similarity=0.148  Sum_probs=12.8

Q ss_pred             EEeEcCCccchhhhcc
Q psy13077        287 IAAAFPSACGKTNLAM  302 (630)
Q Consensus       287 f~~afpSg~GKTtLam  302 (630)
                      ++-.|++|||||||..
T Consensus        17 v~i~G~~g~GKStLl~   32 (173)
T cd04155          17 ILILGLDNAGKTTILK   32 (173)
T ss_pred             EEEEccCCCCHHHHHH
Confidence            3334999999999966


No 473
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=76.05  E-value=1.8  Score=46.62  Aligned_cols=21  Identities=24%  Similarity=0.407  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  |+||||||||..
T Consensus       106 ~~Ge~v~Iv--G~~GsGKSTLl~  126 (329)
T PRK14257        106 KRNKVTAFI--GPSGCGKSTFLR  126 (329)
T ss_pred             cCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999976


No 474
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=76.04  E-value=1.4  Score=45.85  Aligned_cols=19  Identities=26%  Similarity=0.177  Sum_probs=14.5

Q ss_pred             eEEEeccCCCCCCceEeec
Q psy13077        437 AIIFGGRRPQGVPLVYESF  455 (630)
Q Consensus       437 aIiFg~rd~~glPpV~e~~  455 (630)
                      .+||+......+||--++.
T Consensus       130 s~i~l~Q~~~~lp~~iR~n  148 (241)
T PF04665_consen  130 SIIFLSQSYFHLPPNIRSN  148 (241)
T ss_pred             EEEEEeeecccCCHHHhhc
Confidence            5788888888888866554


No 475
>PRK13975 thymidylate kinase; Provisional
Probab=76.03  E-value=1.6  Score=42.21  Aligned_cols=17  Identities=35%  Similarity=0.223  Sum_probs=13.6

Q ss_pred             EEeEcCCccchhhhccc
Q psy13077        287 IAAAFPSACGKTNLAML  303 (630)
Q Consensus       287 f~~afpSg~GKTtLam~  303 (630)
                      ++--|+.||||||++.+
T Consensus         5 I~ieG~~GsGKtT~~~~   21 (196)
T PRK13975          5 IVFEGIDGSGKTTQAKL   21 (196)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            33349999999999873


No 476
>PRK01184 hypothetical protein; Provisional
Probab=76.02  E-value=1.6  Score=42.09  Aligned_cols=14  Identities=14%  Similarity=0.183  Sum_probs=12.2

Q ss_pred             EcCCccchhhhccc
Q psy13077        290 AFPSACGKTNLAML  303 (630)
Q Consensus       290 afpSg~GKTtLam~  303 (630)
                      .||+||||||+|.+
T Consensus         7 ~G~~GsGKsT~a~~   20 (184)
T PRK01184          7 VGMPGSGKGEFSKI   20 (184)
T ss_pred             ECCCCCCHHHHHHH
Confidence            39999999999774


No 477
>PRK06921 hypothetical protein; Provisional
Probab=75.91  E-value=1.7  Score=45.48  Aligned_cols=21  Identities=19%  Similarity=0.121  Sum_probs=17.8

Q ss_pred             CCCEEEEEeEcCCccchhhhccc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      .+...+|.  |++|||||.|+..
T Consensus       116 ~~~~l~l~--G~~G~GKThLa~a  136 (266)
T PRK06921        116 RKNSIALL--GQPGSGKTHLLTA  136 (266)
T ss_pred             CCCeEEEE--CCCCCcHHHHHHH
Confidence            35678888  9999999999873


No 478
>PRK06761 hypothetical protein; Provisional
Probab=75.66  E-value=1.6  Score=46.33  Aligned_cols=31  Identities=10%  Similarity=0.136  Sum_probs=19.9

Q ss_pred             CCCCChHHHHHHHHHHHHhhccCCCcEEEEe
Q psy13077        492 FFGYNFGDYLKHWLSMEQRTNAKLPKVFHVN  522 (630)
Q Consensus       492 F~~y~~g~Y~~~wl~lg~~~~~~~pkif~VN  522 (630)
                      +++.+...=..|..++.+-+..-.|.++++.
T Consensus       159 ~~~~~~~~i~~y~~~l~~~i~~l~p~l~yl~  189 (282)
T PRK06761        159 KYGAQKEKITNYVMKLAKIIENLNPMLFYLE  189 (282)
T ss_pred             HcCCCHHHHHHHHHHHHHHHhccCcEEEEec
Confidence            4444555545555556666666779999887


No 479
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=75.66  E-value=1.7  Score=49.05  Aligned_cols=24  Identities=38%  Similarity=0.495  Sum_probs=18.2

Q ss_pred             cccCCCCCEEEEEeEcCCccchhhhccc
Q psy13077        276 GITNPEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       276 gv~~p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |..-|.|  .++.  ||+|||||+||..
T Consensus        84 g~~~~~g--iLL~--GppGtGKT~la~a  107 (495)
T TIGR01241        84 GAKIPKG--VLLV--GPPGTGKTLLAKA  107 (495)
T ss_pred             CCCCCCc--EEEE--CCCCCCHHHHHHH
Confidence            3344555  7788  9999999999863


No 480
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=75.61  E-value=2.4  Score=47.02  Aligned_cols=36  Identities=33%  Similarity=0.382  Sum_probs=25.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc----cCCCCCCCeeEEeecc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM----LNPTLPGYKVECVGDD  318 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam----~~p~~pgwk~~lIGDD  318 (630)
                      +.|+..-+.  ||+|||||||.-    +.++..| ++.+-|.+
T Consensus        27 ~~Geiv~li--GpNGaGKSTLLk~LaGll~p~sG-~I~l~G~~   66 (402)
T PRK09536         27 REGSLVGLV--GPNGAGKTTLLRAINGTLTPTAG-TVLVAGDD   66 (402)
T ss_pred             CCCCEEEEE--CCCCchHHHHHHHHhcCCCCCCc-EEEECCEE
Confidence            578888888  999999999843    2233456 45555544


No 481
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=75.52  E-value=1.7  Score=48.62  Aligned_cols=35  Identities=23%  Similarity=0.134  Sum_probs=21.8

Q ss_pred             CCEEEEEeEcCCccchhhhcccCC-----CCCCCeeEEeecc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAMLNP-----TLPGYKVECVGDD  318 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~~p-----~~pgwk~~lIGDD  318 (630)
                      |+...|.  ||+|+||||+++.-.     ...|.+|-+|--|
T Consensus       221 ~~~i~~v--GptGvGKTTt~~kLA~~~~~~~~g~~V~li~~D  260 (424)
T PRK05703        221 GGVVALV--GPTGVGKTTTLAKLAARYALLYGKKKVALITLD  260 (424)
T ss_pred             CcEEEEE--CCCCCCHHHHHHHHHHHHHHhcCCCeEEEEECC
Confidence            5555555  999999999766211     0124566666544


No 482
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=75.47  E-value=1.8  Score=49.04  Aligned_cols=21  Identities=29%  Similarity=0.303  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+...+.  ||||||||||.-
T Consensus       343 ~~Ge~~~l~--G~NGsGKSTLl~  363 (530)
T PRK15064        343 EAGERLAII--GENGVGKTTLLR  363 (530)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999965


No 483
>PRK04182 cytidylate kinase; Provisional
Probab=75.47  E-value=1.6  Score=41.10  Aligned_cols=17  Identities=41%  Similarity=0.542  Sum_probs=13.6

Q ss_pred             EEeEcCCccchhhhccc
Q psy13077        287 IAAAFPSACGKTNLAML  303 (630)
Q Consensus       287 f~~afpSg~GKTtLam~  303 (630)
                      ++-.|++||||||+|..
T Consensus         3 I~i~G~~GsGKstia~~   19 (180)
T PRK04182          3 ITISGPPGSGKTTVARL   19 (180)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            33449999999999874


No 484
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=75.38  E-value=1.4  Score=42.18  Aligned_cols=26  Identities=19%  Similarity=0.358  Sum_probs=18.3

Q ss_pred             hhHhhhcCCHHHHHHHHHHHHHHHHH
Q psy13077        582 DLEELFSFDKSFWEQEVQDLQRYFNE  607 (630)
Q Consensus       582 ~~~~~~~~d~~~w~~e~~~l~~~f~~  607 (630)
                      +.++.+.-.-+.|.+....+.++|.+
T Consensus       153 d~~~~i~~R~~~y~~~~~~i~~~~~~  178 (194)
T cd01428         153 DNEETIKKRLEVYKEQTAPLIDYYKK  178 (194)
T ss_pred             CCHHHHHHHHHHHHHhHHHHHHHHHh
Confidence            44566666777777777888877763


No 485
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=75.25  E-value=1.6  Score=45.17  Aligned_cols=20  Identities=40%  Similarity=0.463  Sum_probs=16.8

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |.-.++.  ||+|||||+||..
T Consensus        21 g~~vLL~--G~~GtGKT~lA~~   40 (262)
T TIGR02640        21 GYPVHLR--GPAGTGKTTLAMH   40 (262)
T ss_pred             CCeEEEE--cCCCCCHHHHHHH
Confidence            5567777  9999999999984


No 486
>PRK08181 transposase; Validated
Probab=75.22  E-value=1.6  Score=45.91  Aligned_cols=20  Identities=30%  Similarity=0.400  Sum_probs=16.7

Q ss_pred             CCEEEEEeEcCCccchhhhccc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam~  303 (630)
                      ++-.+|.  ||+|||||.||..
T Consensus       106 ~~nlll~--Gp~GtGKTHLa~A  125 (269)
T PRK08181        106 GANLLLF--GPPGGGKSHLAAA  125 (269)
T ss_pred             CceEEEE--ecCCCcHHHHHHH
Confidence            4457888  9999999999873


No 487
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=75.20  E-value=1.9  Score=43.89  Aligned_cols=22  Identities=41%  Similarity=0.526  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhccc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam~  303 (630)
                      |.|+..-+.  ||||+||+||--|
T Consensus        23 ~~ge~vAi~--GpSGaGKSTLLnL   44 (231)
T COG3840          23 PAGEIVAIL--GPSGAGKSTLLNL   44 (231)
T ss_pred             cCCcEEEEE--CCCCccHHHHHHH
Confidence            678877777  9999999999654


No 488
>PRK13342 recombination factor protein RarA; Reviewed
Probab=75.15  E-value=1.7  Score=47.93  Aligned_cols=18  Identities=33%  Similarity=0.377  Sum_probs=15.2

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      ..+|.  ||+||||||||.+
T Consensus        38 ~ilL~--GppGtGKTtLA~~   55 (413)
T PRK13342         38 SMILW--GPPGTGKTTLARI   55 (413)
T ss_pred             eEEEE--CCCCCCHHHHHHH
Confidence            56666  9999999999974


No 489
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=75.10  E-value=1.8  Score=50.31  Aligned_cols=21  Identities=14%  Similarity=0.275  Sum_probs=18.5

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus        27 ~~Ge~v~Lv--G~NGsGKSTLLr   47 (635)
T PRK11147         27 EDNERVCLV--GRNGAGKSTLMK   47 (635)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            568888888  999999999975


No 490
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=75.01  E-value=1.7  Score=46.60  Aligned_cols=17  Identities=47%  Similarity=0.581  Sum_probs=14.1

Q ss_pred             EEEeEcCCccchhhhcc
Q psy13077        286 YIAAAFPSACGKTNLAM  302 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam  302 (630)
                      .++-+||||||||+||.
T Consensus         6 ~i~i~GptgsGKt~la~   22 (307)
T PRK00091          6 VIVIVGPTASGKTALAI   22 (307)
T ss_pred             EEEEECCCCcCHHHHHH
Confidence            44445999999999998


No 491
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=74.97  E-value=1.8  Score=48.76  Aligned_cols=21  Identities=14%  Similarity=0.101  Sum_probs=18.1

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      ..|+..-+.  ||+|||||||.-
T Consensus       277 ~~Ge~~~ii--G~NGsGKSTLlk  297 (501)
T PRK11288        277 RAGEIVGLF--GLVGAGRSELMK  297 (501)
T ss_pred             eCCcEEEEE--cCCCCCHHHHHH
Confidence            568888888  999999999854


No 492
>cd01125 repA Hexameric Replicative Helicase RepA.  RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
Probab=74.76  E-value=1.6  Score=44.09  Aligned_cols=19  Identities=26%  Similarity=0.483  Sum_probs=15.7

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |.+..++  ||+|||||+|++
T Consensus         1 g~~~ll~--g~~G~GKS~lal   19 (239)
T cd01125           1 GYVSALV--APGGTGKSSLLL   19 (239)
T ss_pred             CceeEEE--cCCCCCHHHHHH
Confidence            4456666  999999999988


No 493
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=74.61  E-value=1.6  Score=49.94  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=14.2

Q ss_pred             EEEeEcCCccchhhhccc
Q psy13077        286 YIAAAFPSACGKTNLAML  303 (630)
Q Consensus       286 ~f~~afpSg~GKTtLam~  303 (630)
                      .++-.|||||||||+|..
T Consensus       286 ii~i~G~sgsGKst~a~~  303 (512)
T PRK13477        286 IIAIDGPAGAGKSTVTRA  303 (512)
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            344459999999999873


No 494
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.
Probab=74.60  E-value=1.9  Score=49.12  Aligned_cols=21  Identities=24%  Similarity=0.135  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...+.  |+||||||||.-
T Consensus        29 ~~Ge~~~li--G~NGsGKSTLl~   49 (552)
T TIGR03719        29 FPGAKIGVL--GLNGAGKSTLLR   49 (552)
T ss_pred             CCCCEEEEE--CCCCCCHHHHHH
Confidence            579888888  999999999965


No 495
>PRK04296 thymidine kinase; Provisional
Probab=74.59  E-value=1.6  Score=43.03  Aligned_cols=19  Identities=16%  Similarity=0.214  Sum_probs=16.2

Q ss_pred             CCEEEEEeEcCCccchhhhcc
Q psy13077        282 GQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       282 G~~~~f~~afpSg~GKTtLam  302 (630)
                      |...+++  ||.|+||||+++
T Consensus         2 g~i~lit--G~~GsGKTT~~l   20 (190)
T PRK04296          2 AKLEFIY--GAMNSGKSTELL   20 (190)
T ss_pred             cEEEEEE--CCCCCHHHHHHH
Confidence            4567778  999999999987


No 496
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=74.53  E-value=1.6  Score=45.60  Aligned_cols=17  Identities=24%  Similarity=0.276  Sum_probs=14.4

Q ss_pred             EEEEEeEcCCccchhhhcc
Q psy13077        284 KKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam  302 (630)
                      -.+|.  ||+||||||||.
T Consensus        38 ~lll~--Gp~GtGKT~la~   54 (337)
T PRK12402         38 HLLVQ--GPPGSGKTAAVR   54 (337)
T ss_pred             eEEEE--CCCCCCHHHHHH
Confidence            36666  999999999985


No 497
>PLN03025 replication factor C subunit; Provisional
Probab=74.49  E-value=1.9  Score=45.81  Aligned_cols=18  Identities=22%  Similarity=0.301  Sum_probs=14.9

Q ss_pred             EEEEEeEcCCccchhhhccc
Q psy13077        284 KKYIAAAFPSACGKTNLAML  303 (630)
Q Consensus       284 ~~~f~~afpSg~GKTtLam~  303 (630)
                      -.+|.  ||+||||||+|..
T Consensus        36 ~lll~--Gp~G~GKTtla~~   53 (319)
T PLN03025         36 NLILS--GPPGTGKTTSILA   53 (319)
T ss_pred             eEEEE--CCCCCCHHHHHHH
Confidence            35666  9999999999974


No 498
>TIGR02239 recomb_RAD51 DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
Probab=74.42  E-value=1.8  Score=46.45  Aligned_cols=21  Identities=29%  Similarity=0.157  Sum_probs=18.6

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+...++  |++|||||+|++
T Consensus        94 ~~g~i~~i~--G~~g~GKT~l~~  114 (316)
T TIGR02239        94 ETGSITEIF--GEFRTGKTQLCH  114 (316)
T ss_pred             CCCeEEEEE--CCCCCCcCHHHH
Confidence            568888888  999999999987


No 499
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=74.34  E-value=1.8  Score=48.41  Aligned_cols=21  Identities=19%  Similarity=0.102  Sum_probs=18.3

Q ss_pred             CCCCEEEEEeEcCCccchhhhcc
Q psy13077        280 PEGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       280 p~G~~~~f~~afpSg~GKTtLam  302 (630)
                      +.|+..-+.  ||||||||||.-
T Consensus       272 ~~Ge~~~l~--G~nGsGKSTLl~  292 (491)
T PRK10982        272 HKGEILGIA--GLVGAKRTDIVE  292 (491)
T ss_pred             eCCcEEEEe--cCCCCCHHHHHH
Confidence            568888888  999999999954


No 500
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=74.33  E-value=2  Score=43.41  Aligned_cols=20  Identities=30%  Similarity=0.408  Sum_probs=15.1

Q ss_pred             CCCEEEEEeEcCCccchhhhcc
Q psy13077        281 EGQKKYIAAAFPSACGKTNLAM  302 (630)
Q Consensus       281 ~G~~~~f~~afpSg~GKTtLam  302 (630)
                      .|.-..+.  ||||+|||||.-
T Consensus         3 ~G~l~vls--gPSG~GKsTl~k   22 (191)
T COG0194           3 KGLLIVLS--GPSGVGKSTLVK   22 (191)
T ss_pred             CceEEEEE--CCCCCCHHHHHH
Confidence            46445555  999999999954


Done!