Query         psy13098
Match_columns 81
No_of_seqs    120 out of 426
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 19:28:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13098.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13098hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0467|consensus              100.0 9.4E-36   2E-40  247.4   3.2   80    1-80    808-887 (887)
  2 KOG0469|consensus               99.7 9.3E-18   2E-22  137.7   3.6   58    2-77    785-842 (842)
  3 KOG0468|consensus               99.6 4.9E-17 1.1E-21  135.9   2.6   63    1-67    886-948 (971)
  4 PTZ00416 elongation factor 2;   99.6   1E-15 2.3E-20  127.8   4.3   57    1-75    778-834 (836)
  5 PLN00116 translation elongatio  99.6 1.4E-15 3.1E-20  126.9   4.2   59    1-77    785-843 (843)
  6 PRK07560 elongation factor EF-  98.9 6.2E-10 1.3E-14   91.9   3.3   49    1-73    681-729 (731)
  7 TIGR00490 aEF-2 translation el  98.8   4E-09 8.6E-14   87.2   3.2   41    1-63    679-719 (720)
  8 COG0480 FusA Translation elong  97.8 1.8E-05 3.8E-10   66.5   2.8   38    2-61    660-697 (697)
  9 smart00838 EFG_C Elongation fa  97.2  0.0001 2.2E-09   45.8   0.8   25    2-26     60-84  (85)
 10 TIGR00484 EF-G translation elo  96.6 0.00043 9.4E-09   57.1  -0.3   25    2-26    657-681 (689)
 11 PF00679 EFG_C:  Elongation fac  96.5  0.0004 8.6E-09   43.6  -1.1   25    2-26     62-86  (89)
 12 PRK12739 elongation factor G;   96.5 0.00073 1.6E-08   55.9   0.1   23    2-24    657-679 (691)
 13 PRK13351 elongation factor G;   96.4 0.00067 1.5E-08   55.8  -0.3   25    2-26    657-681 (687)
 14 PRK12740 elongation factor G;   96.3 0.00081 1.8E-08   55.0  -0.5   25    2-26    639-663 (668)
 15 PRK00007 elongation factor G;   96.0  0.0022 4.8E-08   53.2   0.4   24    2-25    660-683 (693)
 16 PRK10218 GTP-binding protein;   64.5     3.8 8.2E-05   34.3   1.4   23    2-24    456-479 (607)
 17 COG4851 CamS Protein involved   62.5     6.2 0.00013   31.6   2.2   37   21-62    187-224 (382)
 18 TIGR01394 TypA_BipA GTP-bindin  62.4     4.4 9.5E-05   33.7   1.4   23    2-24    452-474 (594)
 19 cd08325 CARD_CASP1-like Caspas  57.1     9.1  0.0002   23.9   1.9   29   30-58     31-60  (83)
 20 cd02164 PPAT_CoAS phosphopante  55.0     6.2 0.00013   27.0   1.0   48   17-65     71-119 (143)
 21 PRK05433 GTP-binding protein L  55.0     5.5 0.00012   33.1   0.8   20    2-21    462-481 (600)
 22 TIGR01393 lepA GTP-binding pro  53.6     6.3 0.00014   32.7   0.9   19    2-20    459-477 (595)
 23 COG2176 PolC DNA polymerase II  47.6      21 0.00045   33.2   3.2   31   43-80   1223-1253(1444)
 24 PF07537 CamS:  CamS sex pherom  47.3     8.1 0.00017   30.2   0.6   41   17-62    123-164 (319)
 25 PF07421 Pro-NT_NN:  Neurotensi  45.2     7.1 0.00015   28.3   0.0   15   14-28    114-128 (169)
 26 PF10041 DUF2277:  Uncharacteri  41.2      33 0.00071   22.0   2.6   21   26-55     11-31  (78)
 27 PF12544 LAM_C:  Lysine-2,3-ami  40.2      15 0.00033   25.5   1.0   16    1-16      4-19  (127)
 28 PRK05473 hypothetical protein;  33.8      43 0.00094   21.8   2.3   23   20-56     46-68  (86)
 29 PF07368 DUF1487:  Protein of u  33.5      42 0.00092   25.0   2.5   35   44-79     42-76  (215)
 30 PF04552 Sigma54_DBD:  Sigma-54  32.9      39 0.00084   23.8   2.2   35   28-63    120-154 (160)
 31 cd01671 CARD Caspase activatio  32.6      41 0.00088   19.7   2.0   30   30-60     28-57  (80)
 32 PF07980 SusD:  SusD family;  I  32.2      44 0.00095   23.0   2.3   19   47-65    151-169 (266)
 33 COG0813 DeoD Purine-nucleoside  31.6      28  0.0006   26.5   1.3    7   20-26     18-24  (236)
 34 cd08329 CARD_BIRC2_BIRC3 Caspa  31.5      49  0.0011   21.1   2.3   30   30-60     38-67  (94)
 35 PF06135 DUF965:  Bacterial pro  30.7      48   0.001   21.3   2.1   23   20-56     43-65  (79)
 36 PF00486 Trans_reg_C:  Transcri  29.7      71  0.0015   18.2   2.7   32   29-60     24-58  (77)
 37 PF13779 DUF4175:  Domain of un  29.3      56  0.0012   28.7   2.9   39   22-60    761-803 (820)
 38 PF06820 Phage_fiber_C:  Putati  29.3      28 0.00061   21.5   0.8   18   11-28     41-58  (64)
 39 PF15332 LIME1:  Lck-interactin  28.8      37 0.00081   25.6   1.6   49   12-61     89-145 (228)
 40 PF10937 DUF2638:  Protein of u  28.1      28  0.0006   23.4   0.7   24   13-37     83-106 (112)
 41 cd06909 M14_ASPA Aspartoacylas  27.9      17 0.00036   27.6  -0.4   22   10-31    226-248 (282)
 42 PLN02388 phosphopantetheine ad  27.5      30 0.00065   24.8   0.9   47   18-65     92-139 (177)
 43 COG1015 DeoB Phosphopentomutas  27.0      56  0.0012   26.6   2.4   40   16-63     88-127 (397)
 44 PF11267 DUF3067:  Protein of u  26.9      31 0.00067   23.0   0.8   53    5-62     23-82  (99)
 45 PF00619 CARD:  Caspase recruit  26.2      53  0.0012   19.4   1.7   29   30-58     31-59  (85)
 46 TIGR03875 RNA_lig_partner RNA   25.7      31 0.00068   25.7   0.7   26   44-69     89-116 (206)
 47 cd08330 CARD_ASC_NALP1 Caspase  24.8      74  0.0016   19.7   2.2   30   30-60     30-59  (82)
 48 PRK04358 hypothetical protein;  23.8      25 0.00054   26.4  -0.1   29   44-72     93-123 (217)
 49 PTZ00069 60S ribosomal protein  22.5      71  0.0015   25.2   2.1   46    5-53     56-101 (300)
 50 PF08745 UPF0278:  UPF0278 fami  22.4      29 0.00063   25.9   0.0   28   44-71     89-118 (205)
 51 PF13758 Prefoldin_3:  Prefoldi  21.6 1.4E+02   0.003   19.9   3.1   29   30-58     47-76  (99)
 52 PLN02882 aminoacyl-tRNA ligase  21.5      84  0.0018   28.5   2.6   24   46-69    995-1021(1159)
 53 PF01667 Ribosomal_S27e:  Ribos  20.5      41 0.00088   20.1   0.4   19    2-20      7-25  (55)

No 1  
>KOG0467|consensus
Probab=100.00  E-value=9.4e-36  Score=247.38  Aligned_cols=80  Identities=54%  Similarity=0.850  Sum_probs=78.3

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCcccccCcchhhHHhhhhc
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKLVAHAEKQRTVKRN   80 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr~L~k~   80 (81)
                      ||-.|||.|+|||+||||++++.||||+|+|+||+++||+++|..|+||.||++|||||||.++||||++|||||||+||
T Consensus       808 iRK~TSG~A~pQLvFShwEvId~DPFWvPtTEEEleefGekADs~N~ArkYMdaVRRRKGLfVEEkIVE~AEKQRTLkkn  887 (887)
T KOG0467|consen  808 IRKGTSGAASPQLVFSHWEVIDEDPFWVPTTEEELEEFGEKADSENIARKYMDAVRRRKGLFVEEKIVEHAEKQRTLKKN  887 (887)
T ss_pred             HhhccccccchhhhccccEEecCCCccCCCcHHHHHHhhhcccchhHHHHHHHHHHhhcCCchHHHHhhhHHhhcccccC
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999998


No 2  
>KOG0469|consensus
Probab=99.69  E-value=9.3e-18  Score=137.73  Aligned_cols=58  Identities=21%  Similarity=0.261  Sum_probs=55.3

Q ss_pred             CcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCcccccCcchhhHHhh
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKLVAHAEKQRTV   77 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr~L   77 (81)
                      |..|+|||||||+||||++|||||+                ++.|.+.++|..+||||||  +|.++...+|.++|
T Consensus       785 rs~t~GqAfpq~vFdHws~lpgdp~----------------dp~sk~~~iV~~~RKrkgl--ke~~P~~~~y~Dkl  842 (842)
T KOG0469|consen  785 RSNTGGQAFPQMVFDHWSILPGDPL----------------DPTSKPGQIVLATRKRKGL--KEGVPDLDEYLDKL  842 (842)
T ss_pred             hcccCCccccceeeeccccCCCCCC----------------CCCccchHHHHHHHHhcCC--CCCCCChHHHhhcC
Confidence            6789999999999999999999999                7899999999999999999  89999999999876


No 3  
>KOG0468|consensus
Probab=99.65  E-value=4.9e-17  Score=135.89  Aligned_cols=63  Identities=22%  Similarity=0.300  Sum_probs=55.2

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCccccc
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKL   67 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~eki   67 (81)
                      .|++|+||||||++|+||++|||||++...    .....+|++.+++||+||.++||||||.++..+
T Consensus       886 LR~hTqGqa~C~~vF~HW~~VPGDpLDKsi----~i~~Lep~p~~~LaReFmiKTRRRKGlsedvS~  948 (971)
T KOG0468|consen  886 LRVHTQGQAFCLSVFDHWRIVPGDPLDKSI----AIRPLEPAPIRHLAREFMIKTRRRKGLSEDVSI  948 (971)
T ss_pred             eeeeccchhHHHHhhhhcccCCCCcccccc----ccccCCCCCcchhHHHHHHHhhhhccccccccc
Confidence            378999999999999999999999998643    344678999999999999999999999877544


No 4  
>PTZ00416 elongation factor 2; Provisional
Probab=99.58  E-value=1e-15  Score=127.77  Aligned_cols=57  Identities=25%  Similarity=0.308  Sum_probs=47.8

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCcccccCcchhhHH
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKLVAHAEKQR   75 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr   75 (81)
                      +|..|+|+|++++.||||+.||+|||                +.+|+||+||++||+||||+  +++|.+.++-+
T Consensus       778 LRs~T~G~g~~~~~F~~y~~vp~dp~----------------~~~~~a~~~~~~~R~rKGl~--~~~~~~~~~~~  834 (836)
T PTZ00416        778 LRAATSGQAFPQCVFDHWQVVPGDPL----------------EPGSKANEIVLSIRKRKGLK--PEIPDLDNYLD  834 (836)
T ss_pred             HHhhCcCCceEEEEeccEEECCCCCC----------------CchhHHHHHHHHHHHhCCCC--CCCCCHHHhcc
Confidence            47899999999999999999999999                45799999999999999994  44654444433


No 5  
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=99.57  E-value=1.4e-15  Score=126.94  Aligned_cols=59  Identities=20%  Similarity=0.396  Sum_probs=53.0

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCcccccCcchhhHHhh
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKLVAHAEKQRTV   77 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr~L   77 (81)
                      .|..|+|+|++++.||||+.||+|||                +.+|+|++||++||+||||  .+++|.+.+|-++|
T Consensus       785 LRs~T~G~g~~~~~f~~y~~v~~dp~----------------~~~~~a~~~~~~~R~rKGl--~~~~~~~~~~~d~~  843 (843)
T PLN00116        785 LRAATSGQAFPQCVFDHWDMMSSDPL----------------EAGSQAAQLVADIRKRKGL--KEQMPPLSEYEDKL  843 (843)
T ss_pred             HHhhCCCCCeEEEEeceeEECCCCCC----------------CchhHHHHHHHHHHhhCCC--CCCCCCHHHhcccC
Confidence            37789999999999999999999999                4589999999999999999  57799888887764


No 6  
>PRK07560 elongation factor EF-2; Reviewed
Probab=98.93  E-value=6.2e-10  Score=91.93  Aligned_cols=49  Identities=18%  Similarity=0.191  Sum_probs=42.0

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCcccccCcchhh
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQDKLVAHAEK   73 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aek   73 (81)
                      .|..|+|+|++++.||||+.||+                      |.|+++|.++|+||||  .++|+.+.++
T Consensus       681 Lrs~T~G~~~~~~~f~~y~~v~~----------------------~~~~~ii~~~r~rKGl--~~~~~~~~~~  729 (731)
T PRK07560        681 IRSATEGRALWSTEFAGFEPVPD----------------------SLQLDIVRQIRERKGL--KPELPKPEDF  729 (731)
T ss_pred             HHhhCcCCceEEEEeccceeCCH----------------------HHHHHHHHHHHhhCCC--CCCCCChhhh
Confidence            36789999999999999999972                      5799999999999999  4677766554


No 7  
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=98.77  E-value=4e-09  Score=87.17  Aligned_cols=41  Identities=24%  Similarity=0.286  Sum_probs=36.7

Q ss_pred             CCcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCc
Q psy13098          1 MNLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPV   63 (81)
Q Consensus         1 ~~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~   63 (81)
                      +|..|+|+|++++.||||+.+|+                      +.++++|.++|+||||+.
T Consensus       679 Lrs~T~G~a~~~~~f~~y~~vp~----------------------~~~~~ii~~~r~rkgl~~  719 (720)
T TIGR00490       679 IRGATSGRCLWSTEHAGFELVPQ----------------------NLQQEFVMEVRKRKGLKL  719 (720)
T ss_pred             HHhhCCCCceEEEEecccccCCH----------------------HHHHHHHHHHHhhcCCCC
Confidence            37789999999999999999972                      479999999999999975


No 8  
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=97.75  E-value=1.8e-05  Score=66.47  Aligned_cols=38  Identities=24%  Similarity=0.290  Sum_probs=35.3

Q ss_pred             CcccCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGL   61 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL   61 (81)
                      |..|+|.|++++.||||+.+|                      .|.|.+++.++|+|||+
T Consensus       660 Rs~T~Gra~~~m~f~~y~~vp----------------------~~~a~~ii~~~~~~~~~  697 (697)
T COG0480         660 RSATQGRASFSMEFDHYEEVP----------------------SSVAEEIIAKRRKRKGL  697 (697)
T ss_pred             HhhcCCceeEEEEecccEeCC----------------------HHHHHHHHHHhhhhcCC
Confidence            788999999999999999887                      57899999999999996


No 9  
>smart00838 EFG_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Probab=97.25  E-value=0.0001  Score=45.76  Aligned_cols=25  Identities=8%  Similarity=-0.000  Sum_probs=22.2

Q ss_pred             CcccCCcceeeceeccceecCCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPY   26 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~   26 (81)
                      |..|+|.|+.++.|+||+.+++|+.
T Consensus        60 rs~T~G~~~~~~~f~~y~~~~~~~~   84 (85)
T smart00838       60 RSATQGRATWSMEFSHYEEVPKSIA   84 (85)
T ss_pred             HHhcCCeEEEEEEeCcceECChhhc
Confidence            5789999999999999999997653


No 10 
>TIGR00484 EF-G translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.
Probab=96.62  E-value=0.00043  Score=57.14  Aligned_cols=25  Identities=8%  Similarity=-0.020  Sum_probs=22.8

Q ss_pred             CcccCCcceeeceeccceecCCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPY   26 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~   26 (81)
                      |..|+|+|++++.||||+.+|+|++
T Consensus       657 rs~T~G~~~~~~~f~~y~~v~~~~~  681 (689)
T TIGR00484       657 RSFTQGRGTYSMEFLHYGEVPSSVA  681 (689)
T ss_pred             HHhcCCceEEEEEeccceeCCHHHH
Confidence            6789999999999999999998765


No 11 
>PF00679 EFG_C:  Elongation factor G C-terminus;  InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF2 (EF-G) is a G-protein. It brings about the translocation of peptidyl-tRNA and mRNA through a ratchet-like mechanism: the binding of GTP-EF2 to the ribosome causes a counter-clockwise rotation in the small ribosomal subunit; the hydrolysis of GTP to GDP by EF2 and the subsequent release of EF2 causes a clockwise rotation of the small subunit back to the starting position [, ]. This twisting action destabilises tRNA-ribosome interactions, freeing the tRNA to translocate along the ribosome upon GTP-hydrolysis by EF2. EF2 binding also affects the entry and exit channel openings for the mRNA, widening it when bound to enable the mRNA to translocate along the ribosome. This entry represents the C-terminal domain found in EF2 (or EF-G) of both prokaryotes and eukaryotes (also known as eEF2), as well as in some tetracycline-resistance proteins. This domain adopts a ferredoxin-like fold consisting of an alpha/beta sandwich with anti-parallel beta-sheets. It resembles the topology of domain III found in these elongation factors, with which it forms the C-terminal block, but these two domains cannot be superimposed []. This domain is often found associated with (IPR000795 from INTERPRO), which contains the signatures for the N terminus of the proteins. More information about these proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0005525 GTP binding; PDB: 1WDT_A 2DY1_A 3CB4_F 3DEG_C 2EFG_A 1ELO_A 2XSY_Y 2WRK_Y 1DAR_A 2WRI_Y ....
Probab=96.49  E-value=0.0004  Score=43.59  Aligned_cols=25  Identities=12%  Similarity=-0.049  Sum_probs=21.7

Q ss_pred             CcccCCcceeeceeccceecCCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPY   26 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~   26 (81)
                      |..|+|+|..++.|+||+.+++|++
T Consensus        62 r~~T~G~a~~~~~~~~y~~~~~~~~   86 (89)
T PF00679_consen   62 RSLTSGRASFSMEFSGYRPVPGDIL   86 (89)
T ss_dssp             HHHTTTS-EEEEEEEEEEEESHHHH
T ss_pred             hccCCCEEEEEEEECeeEECCCChh
Confidence            5679999999999999999998875


No 12 
>PRK12739 elongation factor G; Reviewed
Probab=96.48  E-value=0.00073  Score=55.90  Aligned_cols=23  Identities=9%  Similarity=0.052  Sum_probs=20.8

Q ss_pred             CcccCCcceeeceeccceecCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINID   24 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gD   24 (81)
                      |..|+|+|++++.||||+.+|++
T Consensus       657 r~~T~G~a~~~~~f~~y~~v~~~  679 (691)
T PRK12739        657 RSATQGRATFSMEFDHYEEVPKN  679 (691)
T ss_pred             HhhccCceEEEEEeccceECCHH
Confidence            67899999999999999999853


No 13 
>PRK13351 elongation factor G; Reviewed
Probab=96.43  E-value=0.00067  Score=55.77  Aligned_cols=25  Identities=12%  Similarity=-0.031  Sum_probs=23.0

Q ss_pred             CcccCCcceeeceeccceecCCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPY   26 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~   26 (81)
                      |..|+|+|++++.||||+.+++|++
T Consensus       657 rs~T~G~a~~~~~f~~y~~v~~~~~  681 (687)
T PRK13351        657 RSMTKGRGSFTMEFSHFDPVPPAVQ  681 (687)
T ss_pred             HhhcCCceEEEEEeccceeCCHHHH
Confidence            6789999999999999999998775


No 14 
>PRK12740 elongation factor G; Reviewed
Probab=96.31  E-value=0.00081  Score=54.97  Aligned_cols=25  Identities=8%  Similarity=-0.080  Sum_probs=22.8

Q ss_pred             CcccCCcceeeceeccceecCCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDPY   26 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP~   26 (81)
                      |..|+|+|++++.|+||+.+++|++
T Consensus       639 r~~T~G~a~~~~~f~~y~~~~~~~~  663 (668)
T PRK12740        639 RSLTQGRGSFSMEFSHYEEVPGNVA  663 (668)
T ss_pred             HHhcCCeEEEEEEecccccCCHHHH
Confidence            6789999999999999999998765


No 15 
>PRK00007 elongation factor G; Reviewed
Probab=95.95  E-value=0.0022  Score=53.21  Aligned_cols=24  Identities=8%  Similarity=0.022  Sum_probs=21.6

Q ss_pred             CcccCCcceeeceeccceecCCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINIDP   25 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gDP   25 (81)
                      |..|+|+|++++.|+||+.+|+|.
T Consensus       660 rs~T~G~a~~~~~f~~y~~v~~~~  683 (693)
T PRK00007        660 RSMTQGRATYSMEFDHYEEVPKNV  683 (693)
T ss_pred             HhhcCCceEEEEEeceeeECCHHH
Confidence            678999999999999999998654


No 16 
>PRK10218 GTP-binding protein; Provisional
Probab=64.48  E-value=3.8  Score=34.27  Aligned_cols=23  Identities=9%  Similarity=-0.036  Sum_probs=20.6

Q ss_pred             CcccCCcceeeceeccceecC-CC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVIN-ID   24 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~-gD   24 (81)
                      +..|+|.+...+.|+||+.++ |+
T Consensus       456 ~s~T~G~g~~~~~f~~Y~~~~~g~  479 (607)
T PRK10218        456 MTMTSGTGLLYSTFSHYDDVRPGE  479 (607)
T ss_pred             hhhCCCeEEEEEEecCccCCCCCC
Confidence            567999999999999999998 54


No 17 
>COG4851 CamS Protein involved in sex pheromone biosynthesis [General function prediction only]
Probab=62.50  E-value=6.2  Score=31.61  Aligned_cols=37  Identities=19%  Similarity=0.382  Sum_probs=29.1

Q ss_pred             cCCCC-CCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCC
Q psy13098         21 INIDP-YWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLP   62 (81)
Q Consensus        21 l~gDP-~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~   62 (81)
                      =+||+ |-...++.++..-|+     .+|.++++.+|+.+||.
T Consensus       187 kdg~~~fe~eisds~l~~qGe-----kiaqeVlnRlR~~d~lk  224 (382)
T COG4851         187 KDGDTYFETEISDSKLLEQGE-----KIAQEVLNRLRREDGLK  224 (382)
T ss_pred             ccCCccceeecCHHHHHHHHH-----HHHHHHHHHHHhhcCCc
Confidence            36899 544577888877664     48999999999999983


No 18 
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA. This bacterial (and Arabidopsis) protein, termed TypA or BipA, a GTP-binding protein, is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.
Probab=62.44  E-value=4.4  Score=33.68  Aligned_cols=23  Identities=13%  Similarity=-0.126  Sum_probs=20.9

Q ss_pred             CcccCCcceeeceeccceecCCC
Q psy13098          2 NLCCRGSVDGLRYFFWFQVINID   24 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l~gD   24 (81)
                      +..|+|.++....|+||+.++++
T Consensus       452 ~s~T~G~g~~~~~f~~Y~~~~~~  474 (594)
T TIGR01394       452 LTDTRGTGIMNHVFDEYEPWKGE  474 (594)
T ss_pred             HhhcCCeEEEEEEeccceeCCCc
Confidence            56799999999999999999975


No 19 
>cd08325 CARD_CASP1-like Caspase activation and recruitment domain found in Caspase-1 and related proteins. Caspase activation and recruitment domain (CARD) similar to those found in Caspase-1 (CASP1, ICE) and related proteins, including CARD-only proteins such as ICEBERG or CARD18, INCA (CARD17), CARD16 (COP1, PSEUDO-ICE), CARD8 (DACAR, NDPP1, TUCAN), and CARD12 (NLRC4), as well as ICE-like caspases such as CASP12, CASP5 (ICH-3) and CASP4 (TX, ICH-2). Caspases are aspartate-specific cysteine proteases with functions in apoptosis and immune signaling. CASP1 plays a central role in the cellular response to a wide variety of microbial and non-microbial stimuli, being activated by the inflammasome or the pyroptosome. CARD8 binds itself and the initiator caspase-9, interfering with the binding of APAF-1 and suppressing caspase-9 activation. CARD12 is a Nod-like receptor (NLR) that plays an important role in the innate immune response to Gram-negative bacteria. Caspase-4 (CASP4), -5 (CASP5),
Probab=57.11  E-value=9.1  Score=23.94  Aligned_cols=29  Identities=28%  Similarity=0.382  Sum_probs=23.0

Q ss_pred             cchHHHhhcCC-CCCccCHHHHHHHHHHHh
Q psy13098         30 RTEEEYLHFGD-KADTENRARKYMDSVRKR   58 (81)
Q Consensus        30 ~t~ee~e~~g~-~~~~~n~Ar~~v~~iRkR   58 (81)
                      .|++|++..++ .......||.+|+.+.++
T Consensus        31 l~~~E~e~i~~~~~t~~dkar~Lid~v~~K   60 (83)
T cd08325          31 LNEEEMEKIKEENNTIMDKARVLVDSVTEK   60 (83)
T ss_pred             CCHHHHHHHHhccCCHHHHHHHHHHHHHHH
Confidence            47889998777 445788999999999854


No 20 
>cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes. The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions. The final two steps of the CoA biosynthesis pathway are catalyzed by phosphopantetheine adenylyltransferase (PPAT) and dephospho-CoA (dPCoA) kinase (DPCK). The PPAT reaction involves the reversible adenylation of 4'-phosphopantetheine to form 3'-dPCoA and PPi, and DPCK catalyses phosphorylation of the 3'-hydroxy group of the ribose moiety of dPCoA.  In eukaryotes the two enzymes are part of a large multienzyme complex . Studies in Corynebacterium ammoniagenes suggested that separate enzymes were present, and this was confirmed through identification of the bacterial PPAT/CoAD.
Probab=55.01  E-value=6.2  Score=27.00  Aligned_cols=48  Identities=15%  Similarity=0.234  Sum_probs=29.8

Q ss_pred             cceecC-CCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCccc
Q psy13098         17 WFQVIN-IDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQD   65 (81)
Q Consensus        17 HW~~l~-gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~e   65 (81)
                      ++++++ .|||--..|+.+++-+ --.++...--..|+.+|+.+||+.-+
T Consensus        71 ~~~i~~i~d~~Gpt~~~~~~d~l-VVS~ET~~~~~~iN~~R~~~gl~pl~  119 (143)
T cd02164          71 KYEIVPIDDPYGPTGTDPDLEAI-VVSPETYPGALKINRKREENGLSPLE  119 (143)
T ss_pred             eEEEEEccCCCCCcccCCCCCEE-EEcHHHhhhHHHHHHHHHHCCCCcee
Confidence            566776 4887544544443332 11123334578999999999997665


No 21 
>PRK05433 GTP-binding protein LepA; Provisional
Probab=54.95  E-value=5.5  Score=33.07  Aligned_cols=20  Identities=15%  Similarity=0.049  Sum_probs=17.8

Q ss_pred             CcccCCcceeeceeccceec
Q psy13098          2 NLCCRGSVDGLRYFFWFQVI   21 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~l   21 (81)
                      |..|+|.|+..+-|+||+.-
T Consensus       462 ks~T~G~gs~~~~~~~Y~~~  481 (600)
T PRK05433        462 KSVSRGYASLDYEFIGYRES  481 (600)
T ss_pred             HhhcCCEEEEEEEECCcccc
Confidence            67899999999999999854


No 22 
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=53.63  E-value=6.3  Score=32.72  Aligned_cols=19  Identities=11%  Similarity=-0.036  Sum_probs=17.4

Q ss_pred             CcccCCcceeeceecccee
Q psy13098          2 NLCCRGSVDGLRYFFWFQV   20 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~   20 (81)
                      +..|+|.|+..+.|+||+.
T Consensus       459 ks~T~G~gs~~~~~~~Y~~  477 (595)
T TIGR01393       459 KSISRGYASFDYELIGYRP  477 (595)
T ss_pred             hhhcCCEEEEEEEECCccc
Confidence            6789999999999999984


No 23 
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=47.61  E-value=21  Score=33.23  Aligned_cols=31  Identities=42%  Similarity=0.382  Sum_probs=24.5

Q ss_pred             CccCHHHHHHHHHHHhcCCCcccccCcchhhHHhhhhc
Q psy13098         43 DTENRARKYMDSVRKRKGLPVQDKLVAHAEKQRTVKRN   80 (81)
Q Consensus        43 ~~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr~L~k~   80 (81)
                      -+++.|-.||..+||=|||..       +|++..++.|
T Consensus      1223 lep~~AFkIME~VRKGk~lk~-------~e~~~~Mke~ 1253 (1444)
T COG2176        1223 LEPSLAFKIMEFVRKGKGLKP-------AEYEELMKEN 1253 (1444)
T ss_pred             CCcchHHHHHHHHhccCCCCh-------HHHHHHHHHc
Confidence            578899999999999999964       5666655554


No 24 
>PF07537 CamS:  CamS sex pheromone cAM373 precursor;  InterPro: IPR011426 This family includes CamS (Q8L313 from SWISSPROT), from which Staphylococcus aureus sex pheromone staph-cAM373 is processed. It also includes a number of uncharacterised bacterial proteins.; PDB: 3N2Q_A 3IB5_A 2QX2_A.
Probab=47.33  E-value=8.1  Score=30.22  Aligned_cols=41  Identities=32%  Similarity=0.516  Sum_probs=29.4

Q ss_pred             cceecCCCC-CCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCC
Q psy13098         17 WFQVINIDP-YWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLP   62 (81)
Q Consensus        17 HW~~l~gDP-~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~   62 (81)
                      .|+.-.+.| |-+..++++++..|     ...|.++|..+|++++|.
T Consensus       123 yy~~e~~g~~~~~~Is~~e~~~~G-----k~~A~~iv~rlR~~~~l~  164 (319)
T PF07537_consen  123 YYQKEEDGPTYEVEISDEEMEAYG-----KEMANKIVKRLRKKKGLK  164 (319)
T ss_dssp             EEESSTTS-EEEEES-HHHHHHHH-----HHHHHHHHHHHHHCCCGS
T ss_pred             eecccCCCceeeEecCHHHHHHHH-----HHHHHHHHHHHHhccccC
Confidence            344444444 35568889999986     458999999999999983


No 25 
>PF07421 Pro-NT_NN:  Neurotensin/neuromedin N precursor;  InterPro: IPR008055 Neurotensin is a 13-residue peptide transmitter, sharing significant similarity in its 6 C-terminal amino acid residues with several other neuropeptides, including neuromedin N (which is derived from the same precursor). This C-terminal region is responsible for the full biological activity, the N-terminal portion having a modulatory role.  Neurotensin is distributed throughout the central nervous system, with highest levels in the hypothalamus, amygdala and nucleus accumbens. It induces a variety of effects, including: analgesia, hypothermia and increased locomotor activity. It is also involved in regulation of dopamine pathways. In the periphery, neurotensin is found in endocrine cells of the small intestine, where it leads to secretion and smooth muscle contraction []. The neurotensin/neuromedin N precursor can also be processed to produce large 125-138 amino acid peptides with the neurotensin or neuromedin N sequence at their C terminus. These large peptides appear to be less potent than their smaller counterparts, but are also less sensitive to degradation and may represent endogenous, long-lasting activators in a number of pathophysiological situations.; GO: 0005184 neuropeptide hormone activity, 0005576 extracellular region; PDB: 3F6K_N.
Probab=45.17  E-value=7.1  Score=28.26  Aligned_cols=15  Identities=20%  Similarity=0.144  Sum_probs=0.0

Q ss_pred             eeccceecCCCCCCC
Q psy13098         14 YFFWFQVINIDPYWE   28 (81)
Q Consensus        14 ~FsHW~~l~gDP~~~   28 (81)
                      .|.||+++.+|-++.
T Consensus       114 ~fqhwel~qed~l~~  128 (169)
T PF07421_consen  114 AFQHWELIQEDYLDP  128 (169)
T ss_dssp             ---------------
T ss_pred             cchHHHHHHHHHhhc
Confidence            699999999998853


No 26 
>PF10041 DUF2277:  Uncharacterized conserved protein (DUF2277);  InterPro: IPR018735  Members of this family of hypothetical bacterial proteins have no known function. 
Probab=41.20  E-value=33  Score=22.05  Aligned_cols=21  Identities=33%  Similarity=0.445  Sum_probs=14.8

Q ss_pred             CCCCcchHHHhhcCCCCCccCHHHHHHHHH
Q psy13098         26 YWEPRTEEEYLHFGDKADTENRARKYMDSV   55 (81)
Q Consensus        26 ~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~i   55 (81)
                      |.-|.|++||..-         |.+||.+|
T Consensus        11 fePpaT~~EI~aA---------AlQyVRKv   31 (78)
T PF10041_consen   11 FEPPATDEEIRAA---------ALQYVRKV   31 (78)
T ss_pred             CCCCCCHHHHHHH---------HHHHHHHH
Confidence            5556899998763         77886554


No 27 
>PF12544 LAM_C:  Lysine-2,3-aminomutase ; PDB: 2A5H_D.
Probab=40.23  E-value=15  Score=25.50  Aligned_cols=16  Identities=6%  Similarity=-0.243  Sum_probs=10.3

Q ss_pred             CCcccCCcceeeceec
Q psy13098          1 MNLCCRGSVDGLRYFF   16 (81)
Q Consensus         1 ~~~~T~G~A~~ql~Fs   16 (81)
                      +|-+|||-|.|+.|.|
T Consensus         4 LRGhtSGlAvPtyVvD   19 (127)
T PF12544_consen    4 LRGHTSGLAVPTYVVD   19 (127)
T ss_dssp             TCTTC-GGG--EEEEE
T ss_pred             ccccccccccceEEEE
Confidence            4678999999988874


No 28 
>PRK05473 hypothetical protein; Provisional
Probab=33.76  E-value=43  Score=21.84  Aligned_cols=23  Identities=26%  Similarity=0.525  Sum_probs=16.7

Q ss_pred             ecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHH
Q psy13098         20 VINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVR   56 (81)
Q Consensus        20 ~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iR   56 (81)
                      +|.|||-+.+              .-|-||.+|.++=
T Consensus        46 llSGDPaYIt--------------sh~nAR~lIrkiE   68 (86)
T PRK05473         46 LLSGDPAYIP--------------RHNDARNLIRKLE   68 (86)
T ss_pred             hccCCCCccC--------------CcccHHHHHHHHh
Confidence            4678998763              4567888888764


No 29 
>PF07368 DUF1487:  Protein of unknown function (DUF1487);  InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster. The function of this family is unknown.
Probab=33.52  E-value=42  Score=25.03  Aligned_cols=35  Identities=23%  Similarity=0.506  Sum_probs=30.0

Q ss_pred             ccCHHHHHHHHHHHhcCCCcccccCcchhhHHhhhh
Q psy13098         44 TENRARKYMDSVRKRKGLPVQDKLVAHAEKQRTVKR   79 (81)
Q Consensus        44 ~~n~Ar~~v~~iRkRKGL~~~ekiv~~aekqr~L~k   79 (81)
                      .+++..+||..||.|-. +..+.|-.|+.|.|+|++
T Consensus        42 qEsireefi~rvr~~m~-pl~~~va~Hpny~rsl~~   76 (215)
T PF07368_consen   42 QESIREEFIERVRSRMK-PLSPQVANHPNYLRSLKK   76 (215)
T ss_pred             eHHHHHHHHHHHHHhCc-cCChhhccCcHHHHHHHH
Confidence            57788999999999965 347899999999999975


No 30 
>PF04552 Sigma54_DBD:  Sigma-54, DNA binding domain;  InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore, this region contains a putative helix-turn-helix motif. At the C terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins [].; PDB: 2AHQ_A 2O9L_A 2O8K_A.
Probab=32.91  E-value=39  Score=23.76  Aligned_cols=35  Identities=17%  Similarity=0.366  Sum_probs=21.1

Q ss_pred             CCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCc
Q psy13098         28 EPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPV   63 (81)
Q Consensus        28 ~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~   63 (81)
                      .|.||++|.+.... .+=++||..|.+-|..-|++.
T Consensus       120 ~PlSD~~i~~~L~~-~gi~isRRTVaKYR~~L~Ip~  154 (160)
T PF04552_consen  120 KPLSDQEIAELLKE-EGIKISRRTVAKYREELGIPS  154 (160)
T ss_dssp             S---HHHHHHHHTT-TTS---HHHHHHHHHHHT-S-
T ss_pred             CCCCHHHHHHHHHH-cCCCccHHHHHHHHHHcCCCC
Confidence            47789998885543 236799999999999988853


No 31 
>cd01671 CARD Caspase activation and recruitment domain: a protein-protein interaction domain. Caspase activation and recruitment domains (CARDs) are death domains (DDs) found associated with caspases. Caspases are aspartate-specific cysteine proteases with functions in apoptosis, immune signaling, inflammation, and host-defense mechanisms. In addition to caspases, proteins containing CARDs include adaptor proteins such as RAIDD, CARD9, and RIG-I-like helicases, which can form mutliprotein complexes and play important roles in mediating the signals to induce immune and inflammatory responses. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including PYRIN and DED (Death Effector Domain). They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=32.58  E-value=41  Score=19.73  Aligned_cols=30  Identities=37%  Similarity=0.615  Sum_probs=22.3

Q ss_pred             cchHHHhhcCCCCCccCHHHHHHHHHHHhcC
Q psy13098         30 RTEEEYLHFGDKADTENRARKYMDSVRKRKG   60 (81)
Q Consensus        30 ~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKG   60 (81)
                      .|.++.+...........|+++++.+.+ ||
T Consensus        28 lt~~e~~~i~~~~~~~~k~~~Lld~l~~-kg   57 (80)
T cd01671          28 LTEEEYEKIRSESTRQDKARKLLDILPR-KG   57 (80)
T ss_pred             CCHHHHHHHHcCCChHHHHHHHHHHHHh-cC
Confidence            4667777765555677789999999886 66


No 32 
>PF07980 SusD:  SusD family;  InterPro: IPR012944 This domain occurs in several hypothetical proteins. It also occurs in RagB, Q9ZA59 from SWISSPROT, a protein involved in signalling [] and SusD, Q8A1G2 from SWISSPROT, an outer membrane protein involved in nutrient binding [].; PDB: 3IHV_A 3LEW_A 3JQ1_A 3JQ0_A 3NQP_B 3SNX_A 3L22_A 3OTN_A 3IV0_A 3QNK_C ....
Probab=32.17  E-value=44  Score=23.03  Aligned_cols=19  Identities=47%  Similarity=0.793  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHhcCCCccc
Q psy13098         47 RARKYMDSVRKRKGLPVQD   65 (81)
Q Consensus        47 ~Ar~~v~~iRkRKGL~~~e   65 (81)
                      .|.++|+.||+|-|++...
T Consensus       151 ~A~~~lN~vR~Rag~~~~~  169 (266)
T PF07980_consen  151 EALEYLNQVRKRAGLPPLT  169 (266)
T ss_dssp             HHHHHHHHHHHHTTTTCGG
T ss_pred             HHHHHHHHHHHHcCCCccc
Confidence            4999999999999986543


No 33 
>COG0813 DeoD Purine-nucleoside phosphorylase [Nucleotide transport and metabolism]
Probab=31.58  E-value=28  Score=26.53  Aligned_cols=7  Identities=29%  Similarity=0.534  Sum_probs=6.2

Q ss_pred             ecCCCCC
Q psy13098         20 VINIDPY   26 (81)
Q Consensus        20 ~l~gDP~   26 (81)
                      +||||||
T Consensus        18 LmPGDPl   24 (236)
T COG0813          18 LMPGDPL   24 (236)
T ss_pred             ecCCCCc
Confidence            5899999


No 34 
>cd08329 CARD_BIRC2_BIRC3 Caspase activation and recruitment domain found in Baculoviral IAP repeat-containing proteins, BIRC2 (c-IAP1) and BIRC3 (c-IAP2). Caspase activation and recruitment domain (CARD) similar to those found in Baculoviral IAP repeat (BIR)-containing protein 2 (BIRC2) or cellular Inhibitor of Apoptosis Protein 1 (c-IAP1), and BIRC3 (or c-IAP2). IAPs are anti-apoptotic proteins that contain at least one BIR domain. Most IAPs also contain a C-terminal RING domain. In addition, both BIRC2 and BIRC3 contain a CARD. BIRC2 and BIRC3, through their binding with TRAF (TNF receptor-associated factor) 2, are recruited to TNFR-1/2 signaling complexes, where they regulate caspase-8 activity. They also play important roles in pro-survival NF-kB signaling pathways. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation and host-defense mechanisms. DDs are protein-protein interac
Probab=31.54  E-value=49  Score=21.14  Aligned_cols=30  Identities=40%  Similarity=0.477  Sum_probs=23.9

Q ss_pred             cchHHHhhcCCCCCccCHHHHHHHHHHHhcC
Q psy13098         30 RTEEEYLHFGDKADTENRARKYMDSVRKRKG   60 (81)
Q Consensus        30 ~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKG   60 (81)
                      .|++|++....+......||.+++.+. .||
T Consensus        38 lt~ee~e~I~~~~t~~~qAr~Lld~l~-~KG   67 (94)
T cd08329          38 ITEQEYDVIKQKTQTPLQARELIDTVL-VKG   67 (94)
T ss_pred             CCHHHHHHHHcCCChHHHHHHHHHHHH-hhh
Confidence            578888887666666789999999988 566


No 35 
>PF06135 DUF965:  Bacterial protein of unknown function (DUF965);  InterPro: IPR009309 This family consists of several hypothetical bacterial proteins. The function of the family is unknown.
Probab=30.69  E-value=48  Score=21.29  Aligned_cols=23  Identities=22%  Similarity=0.469  Sum_probs=16.4

Q ss_pred             ecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHH
Q psy13098         20 VINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVR   56 (81)
Q Consensus        20 ~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iR   56 (81)
                      +|.|||-+.+              .-|-||.+|.++=
T Consensus        43 llSGDPaYIt--------------sh~nAR~lIr~~e   65 (79)
T PF06135_consen   43 LLSGDPAYIT--------------SHNNARNLIRKIE   65 (79)
T ss_pred             eecCCCcccc--------------CcccHHHHHHHHh
Confidence            3788998763              4567888887764


No 36 
>PF00486 Trans_reg_C:  Transcriptional regulatory protein, C terminal;  InterPro: IPR001867 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain that is almost always found associated with the response regulator receiver domain (see IPR001789 from INTERPRO). It may play a role in DNA binding [].; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2K4J_A 2JPB_A 1ODD_A 1OPC_A 1KGS_A 2PMU_E 2JZY_A 1GXP_B 1QQI_A 2Z33_A ....
Probab=29.74  E-value=71  Score=18.16  Aligned_cols=32  Identities=22%  Similarity=0.380  Sum_probs=23.2

Q ss_pred             CcchHHHhh--cCCCC-CccCHHHHHHHHHHHhcC
Q psy13098         29 PRTEEEYLH--FGDKA-DTENRARKYMDSVRKRKG   60 (81)
Q Consensus        29 ~~t~ee~e~--~g~~~-~~~n~Ar~~v~~iRkRKG   60 (81)
                      ++|.++|.+  ||... ...+.-+.+|..+|+.=+
T Consensus        24 ~vs~~~l~~~~w~~~~~~~~~~l~~~I~rLR~kL~   58 (77)
T PF00486_consen   24 VVSREELIEALWGDEEDVSDNSLDVHISRLRKKLE   58 (77)
T ss_dssp             EEEHHHHHHHHTSSSSTTCTHHHHHHHHHHHHHHH
T ss_pred             CCCHHHhCChhhhcccccchhhHHHHHHHHHHHHh
Confidence            456677665  77765 566677999999998854


No 37 
>PF13779 DUF4175:  Domain of unknown function (DUF4175)
Probab=29.32  E-value=56  Score=28.70  Aligned_cols=39  Identities=28%  Similarity=0.313  Sum_probs=24.3

Q ss_pred             CCCCCCCCcchHHHh-hcCCCCCccC---HHHHHHHHHHHhcC
Q psy13098         22 NIDPYWEPRTEEEYL-HFGDKADTEN---RARKYMDSVRKRKG   60 (81)
Q Consensus        22 ~gDP~~~~~t~ee~e-~~g~~~~~~n---~Ar~~v~~iRkRKG   60 (81)
                      +.|||-.|....... ..+..++.++   .||+|++.||||-|
T Consensus       761 ~~DPLGR~~~~~~~~~~~~~~vp~e~~~~RAR~IleELRrR~g  803 (820)
T PF13779_consen  761 GRDPLGRPLGGQGPGGDDDVKVPDEIDRQRAREILEELRRRLG  803 (820)
T ss_pred             CCCCCCCCCCCCCCCCCCCccCCChhHHHHHHHHHHHHHHhcC
Confidence            468887775433221 1222223322   89999999999988


No 38 
>PF06820 Phage_fiber_C:  Putative prophage tail fibre C-terminus;  InterPro: IPR009640 This entry represents the C terminus of phage 933W tail fibre protein. This domain is found together with conserved RLGP motif. The characteristics of the protein distribution suggest prophage matches.
Probab=29.25  E-value=28  Score=21.50  Aligned_cols=18  Identities=28%  Similarity=0.187  Sum_probs=14.6

Q ss_pred             eeceeccceecCCCCCCC
Q psy13098         11 GLRYFFWFQVINIDPYWE   28 (81)
Q Consensus        11 ~ql~FsHW~~l~gDP~~~   28 (81)
                      .|++|+|-++.=+|--|+
T Consensus        41 vq~~f~~LQv~fgDGpWq   58 (64)
T PF06820_consen   41 VQGVFRHLQVRFGDGPWQ   58 (64)
T ss_pred             heeeeeeeEEEeccCChh
Confidence            489999999998876554


No 39 
>PF15332 LIME1:  Lck-interacting transmembrane adapter 1
Probab=28.85  E-value=37  Score=25.61  Aligned_cols=49  Identities=22%  Similarity=0.208  Sum_probs=26.2

Q ss_pred             eceeccceecCCC-CCCCCcc--hHHHhhcCCCC-CccCHHHHHHH----HHHHhcCC
Q psy13098         12 LRYFFWFQVINID-PYWEPRT--EEEYLHFGDKA-DTENRARKYMD----SVRKRKGL   61 (81)
Q Consensus        12 ql~FsHW~~l~gD-P~~~~~t--~ee~e~~g~~~-~~~n~Ar~~v~----~iRkRKGL   61 (81)
                      --+|+||+ +|.- |.-.+.+  +-..-..|..+ +..++|..-|.    -|+|.||-
T Consensus        89 p~aF~hre-lP~~~PaA~~s~~peATYSNVgLAAiPraslAaspVvAEYAciqK~KgT  145 (228)
T PF15332_consen   89 PSAFSHRE-LPQAPPAASPSIGPEATYSNVGLAAIPRASLAASPVVAEYACIQKLKGT  145 (228)
T ss_pred             CCCCChhh-cCCCCcccccccCccceeccccccccCccccccchhHHHHHHHHHhccC
Confidence            45899999 6654 5543322  22233333322 34445544333    38899985


No 40 
>PF10937 DUF2638:  Protein of unknown function (DUF2638);  InterPro: IPR020373 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents a component of the mitochondrial small ribosomal subunit. Mature mitochondrial ribosomes consist of a small (37S) and a large (54S) subunit. The 37S subunit contains at least 33 different proteins and 1 molecule of RNA (15S). The 54S subunit contains at least 45 different proteins and 1 molecule of RNA (21S). This entry is represented by a mitochondrial ribosomal protein of the small subunit, which has similarity to human mitochondrial ribosomal protein MRP-S36 [, , ].
Probab=28.09  E-value=28  Score=23.37  Aligned_cols=24  Identities=25%  Similarity=0.224  Sum_probs=17.5

Q ss_pred             ceeccceecCCCCCCCCcchHHHhh
Q psy13098         13 RYFFWFQVINIDPYWEPRTEEEYLH   37 (81)
Q Consensus        13 l~FsHW~~l~gDP~~~~~t~ee~e~   37 (81)
                      -+||.|+ ||.-=-..+.+++|||-
T Consensus        83 ~~~~~~e-LP~Rfrr~p~se~EiE~  106 (112)
T PF10937_consen   83 EYFDRSE-LPARFRRKPISEEEIEA  106 (112)
T ss_pred             ceeeHHH-cCHhHccCCCCHHHHHH
Confidence            4678888 77655566788899875


No 41 
>cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases. ASPA (also known as aminoacylase 2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=27.86  E-value=17  Score=27.56  Aligned_cols=22  Identities=14%  Similarity=-0.088  Sum_probs=18.3

Q ss_pred             eeeceeccceecC-CCCCCCCcc
Q psy13098         10 DGLRYFFWFQVIN-IDPYWEPRT   31 (81)
Q Consensus        10 ~~ql~FsHW~~l~-gDP~~~~~t   31 (81)
                      .|+|+...|+.|. |||++....
T Consensus       226 hp~lq~~d~~~l~~Gdp~f~~~~  248 (282)
T cd06909         226 HPQLQDRDWQPLKPGDPLFLTFD  248 (282)
T ss_pred             CchhcCCCCcccCCCCceEecCC
Confidence            7999999999995 999766543


No 42 
>PLN02388 phosphopantetheine adenylyltransferase
Probab=27.51  E-value=30  Score=24.82  Aligned_cols=47  Identities=19%  Similarity=0.200  Sum_probs=27.5

Q ss_pred             ceecC-CCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCccc
Q psy13098         18 FQVIN-IDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPVQD   65 (81)
Q Consensus        18 W~~l~-gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~~e   65 (81)
                      +++++ .|||--..++.+++-+ --.++...-...|+.+|+.+||+.-+
T Consensus        92 ~~i~~i~D~~Gpt~~~~~~d~L-VVS~ET~~g~~~IN~~R~e~Gl~pL~  139 (177)
T PLN02388         92 VQAEPIIDPYGPSIVDENLEAI-VVSKETLPGGLSVNKKRAERGLSQLK  139 (177)
T ss_pred             EEEEEecCCCCCcccCCCCCEE-EEcHhHhhhHHHHHHHHHHCCCCCeE
Confidence            56666 4777544443333221 11123334578999999999996654


No 43 
>COG1015 DeoB Phosphopentomutase [Carbohydrate transport and metabolism]
Probab=26.96  E-value=56  Score=26.63  Aligned_cols=40  Identities=15%  Similarity=0.230  Sum_probs=23.7

Q ss_pred             ccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHHHHHHhcCCCc
Q psy13098         16 FWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMDSVRKRKGLPV   63 (81)
Q Consensus        16 sHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKGL~~   63 (81)
                      -|||++. =|...|.     ..|  +...+....+++.+|+++-|++.
T Consensus        88 GHWEimG-~pv~~~~-----~~f--~~~~~~fp~el~~~i~~~~g~~~  127 (397)
T COG1015          88 GHWEIMG-VPVLFPF-----GYF--PDTVNGFPEELLDEIERRTGRKG  127 (397)
T ss_pred             cchhhcC-Ccccccc-----ccc--ccccccChHHHHHHHHhhcCCce
Confidence            6999885 4442211     112  11235567899999999866643


No 44 
>PF11267 DUF3067:  Protein of unknown function (DUF3067);  InterPro: IPR021420  This family of proteins has no known function. ; PDB: 2LJW_A.
Probab=26.87  E-value=31  Score=22.99  Aligned_cols=53  Identities=28%  Similarity=0.463  Sum_probs=29.4

Q ss_pred             cCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCC-------CccCHHHHHHHHHHHhcCCC
Q psy13098          5 CRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKA-------DTENRARKYMDSVRKRKGLP   62 (81)
Q Consensus         5 T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~-------~~~n~Ar~~v~~iRkRKGL~   62 (81)
                      +.|..+.|+.   |.-+.+-.|  |.||+|..++.+.+       ......+.++.++|+|-.|.
T Consensus        23 ~~~~v~lqVM---W~yLeQ~SF--PltE~eY~~hL~~va~~L~~wG~~~~Vr~~l~~t~~rPRlG   82 (99)
T PF11267_consen   23 RRGRVYLQVM---WKYLEQRSF--PLTEEEYLEHLDAVAEYLNAWGQADQVRAFLEETRERPRLG   82 (99)
T ss_dssp             ETTEEEEEEE---EEETTSTT---SS-HHHHHHHHHHHHHHHHHHS-HHHHHHHHHH-----BTT
T ss_pred             EcCEEEEEEe---hhhccCCCc--CCCHHHHHHHHHHHHHHHHHcccHHHHHHHHHhCCCCCCCC
Confidence            4556667766   555888888  78988855543222       23446789999999887764


No 45 
>PF00619 CARD:  Caspase recruitment domain;  InterPro: IPR001315 The caspase recruitment domain domain (CARD) is a homotypic protein interaction module composed of a bundle of six alpha-helices. CARD is related in sequence and structure to the death domain (DD, see IPR000488 from INTERPRO) and the death effector domain (DED, see IPR001875 from INTERPRO), which work in similar pathways and show similar interaction properties []. The CARD domain typically associates with other CARD-containing proteins, forming either dimers or trimers. CARD domains can be found in isolation, or in combination with other domains. Domains associated with CARD include: NACHT (IPR007111 from INTERPRO) (in Nal1 and Bir1), NB-ARC (IPR002182 from INTERPRO) (in Apaf-1), pyrin/dapin domains (IPR004020 from INTERPRO) (in Nal1), leucine-rich repeats () (in Nal1), WD repeats (IPR001680 from INTERPRO) (in Apaf1), Src homology domains (IPR001452 from INTERPRO), PDZ (IPR001478 from INTERPRO), RING, kinase and DD domains []. CARD-containing proteins are involved in apoptosis through their regulation of caspases that contain CARDs in their N-terminal pro-domains, including human caspases 1, 2, 9, 11 and 12 []. CARD-containing proteins are also involved in inflammation through their regulation of NF-kappaB []. The mechanisms by which CARDs activate caspases and NF-kappaB involve the assembly of multi-protein complexes, which can facilitate dimerisation or serve as scaffolds on which proteases and kinases are assembled and activated.; GO: 0005515 protein binding, 0042981 regulation of apoptosis, 0005622 intracellular; PDB: 2NSN_A 2NZ7_B 2DBD_A 4E9M_C 2B1W_A 3YGS_P 2KN6_A 3CRD_A 1DGN_A 3KAT_A ....
Probab=26.24  E-value=53  Score=19.39  Aligned_cols=29  Identities=31%  Similarity=0.584  Sum_probs=21.0

Q ss_pred             cchHHHhhcCCCCCccCHHHHHHHHHHHh
Q psy13098         30 RTEEEYLHFGDKADTENRARKYMDSVRKR   58 (81)
Q Consensus        30 ~t~ee~e~~g~~~~~~n~Ar~~v~~iRkR   58 (81)
                      .|++|.+.........+.++.+++.+.++
T Consensus        31 lt~~e~e~I~~~~t~~~k~~~LLd~l~~k   59 (85)
T PF00619_consen   31 LTEEEYEEIRSEPTRQDKARKLLDILKRK   59 (85)
T ss_dssp             SSHHHHHHHHTSSSHHHHHHHHHHHHHHC
T ss_pred             CCHHHHHHHHccCChHHHHHHHHHHHHHH
Confidence            36777777655556777899999987743


No 46 
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family. This uncharacterized protein family is found almost perfectly in the same set of genomes as the Pab1020 family described by model TIGR01209. These pairs are found mostly in Archaea, but also in a few bacteria (e.g. Alkalilimnicola ehrlichei MLHE-1, Aquifex aeolicus). While the partner protein has been described as homodimeric ligase that has RNA circularization activity, the function of this protein (also called UPF0278) is unknown.
Probab=25.70  E-value=31  Score=25.73  Aligned_cols=26  Identities=35%  Similarity=0.562  Sum_probs=20.3

Q ss_pred             ccCHHHHHHHHHHHh--cCCCcccccCc
Q psy13098         44 TENRARKYMDSVRKR--KGLPVQDKLVA   69 (81)
Q Consensus        44 ~~n~Ar~~v~~iRkR--KGL~~~ekiv~   69 (81)
                      +...-++||..+|.|  |||-+-|+-+-
T Consensus        89 PA~i~ye~I~e~R~RInkGLRVAEe~vr  116 (206)
T TIGR03875        89 PAEIFYEYIEEVRERIDKGLRVAEEHVR  116 (206)
T ss_pred             cHHHHHHHHHHHHHHHhcchhHHHHHHH
Confidence            445779999999999  99987765443


No 47 
>cd08330 CARD_ASC_NALP1 Caspase activation and recruitment domain found in Human ASC, NALP1, and similar proteins. Caspase activation and recruitment domain (CARD) similar to those found in human ASC (Apoptosis-associated speck-like protein containing a CARD) and NALP1 (CARD7, NLRP1). ASC, an adaptor molecule, and NALP1, a member of the Nod-like receptor (NLR) family, are involved in the assembly of the 'inflammasome', a multiprotein platform, which is responsible for caspase-1 activation and regulation of IL-1beta maturation. In general, CARDs are death domains (DDs) associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation and host-defense mechanisms. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including PYRIN and DED (Death Effector Domain). They se
Probab=24.75  E-value=74  Score=19.70  Aligned_cols=30  Identities=27%  Similarity=0.406  Sum_probs=21.6

Q ss_pred             cchHHHhhcCCCCCccCHHHHHHHHHHHhcC
Q psy13098         30 RTEEEYLHFGDKADTENRARKYMDSVRKRKG   60 (81)
Q Consensus        30 ~t~ee~e~~g~~~~~~n~Ar~~v~~iRkRKG   60 (81)
                      .|+++.+..-........||++++.+.+ ||
T Consensus        30 it~e~~~~I~a~~T~~~kar~Lld~l~~-kG   59 (82)
T cd08330          30 ITQEQYSEVRAEKTNQEKMRKLFSFVRS-WG   59 (82)
T ss_pred             CCHHHHHHHHcCCCcHHHHHHHHHHHHc-cC
Confidence            5777777744444667789999999886 55


No 48 
>PRK04358 hypothetical protein; Provisional
Probab=23.79  E-value=25  Score=26.44  Aligned_cols=29  Identities=31%  Similarity=0.527  Sum_probs=22.6

Q ss_pred             ccCHHHHHHHHHHHh--cCCCcccccCcchh
Q psy13098         44 TENRARKYMDSVRKR--KGLPVQDKLVAHAE   72 (81)
Q Consensus        44 ~~n~Ar~~v~~iRkR--KGL~~~ekiv~~ae   72 (81)
                      +..+-++||..+|.|  |||.+-|+-+-.|.
T Consensus        93 PA~i~ye~I~~mR~RInkGLRVAEeavrea~  123 (217)
T PRK04358         93 PAEIFYEYIEDMRERINKGLRVAEEAVREAA  123 (217)
T ss_pred             cHHHHHHHHHHHHHHHhcchHHHHHHHHHHH
Confidence            445779999999999  99988876655543


No 49 
>PTZ00069 60S ribosomal protein L5; Provisional
Probab=22.54  E-value=71  Score=25.16  Aligned_cols=46  Identities=17%  Similarity=0.068  Sum_probs=37.7

Q ss_pred             cCCcceeeceeccceecCCCCCCCCcchHHHhhcCCCCCccCHHHHHHH
Q psy13098          5 CRGSVDGLRYFFWFQVINIDPYWEPRTEEEYLHFGDKADTENRARKYMD   53 (81)
Q Consensus         5 T~G~A~~ql~FsHW~~l~gDP~~~~~t~ee~e~~g~~~~~~n~Ar~~v~   53 (81)
                      |+-.++||++.+.   +.||--....+..||..+|-++...|.|--|+.
T Consensus        56 TN~~ii~Qiv~~~---~~GD~vl~sA~S~eL~kyG~k~gl~N~~AAY~T  101 (300)
T PTZ00069         56 TNKDIICQIVYAT---IVGDKVLAAAYSHELPRFGIPVGLTNYAAAYAT  101 (300)
T ss_pred             ECCcEEEEEEEee---cCCCEEEEEeehhhHhhcCcCCCCccHHHHHHH
Confidence            4556789999877   889988888888999999999999997766554


No 50 
>PF08745 UPF0278:  UPF0278 family;  InterPro: IPR022785 This entry contains proteins of the UPF0278 family and proteins containing PIN domains. Members of the UPF0278 family are uncharacterised and about 200 amino acids in length.; PDB: 2LCQ_A.
Probab=22.40  E-value=29  Score=25.88  Aligned_cols=28  Identities=32%  Similarity=0.542  Sum_probs=0.0

Q ss_pred             ccCHHHHHHHHHHHh--cCCCcccccCcch
Q psy13098         44 TENRARKYMDSVRKR--KGLPVQDKLVAHA   71 (81)
Q Consensus        44 ~~n~Ar~~v~~iRkR--KGL~~~ekiv~~a   71 (81)
                      +..+-++||..+|.|  |||.+-|+-+-.|
T Consensus        89 PA~i~yEyI~emR~RInKGLRVAEeavrea  118 (205)
T PF08745_consen   89 PAEIFYEYIEEMRERINKGLRVAEEAVREA  118 (205)
T ss_dssp             ------------------------------
T ss_pred             cccccccccccccccccccccccccccccc
Confidence            455779999999999  9998887665543


No 51 
>PF13758 Prefoldin_3:  Prefoldin subunit
Probab=21.59  E-value=1.4e+02  Score=19.88  Aligned_cols=29  Identities=21%  Similarity=0.352  Sum_probs=21.7

Q ss_pred             cchHHHhh-cCCCCCccCHHHHHHHHHHHh
Q psy13098         30 RTEEEYLH-FGDKADTENRARKYMDSVRKR   58 (81)
Q Consensus        30 ~t~ee~e~-~g~~~~~~n~Ar~~v~~iRkR   58 (81)
                      .|+.||.+ +|++....-.+.++|+-|-||
T Consensus        47 v~~kEi~~ilG~~~~i~Rt~~Qvv~~l~RR   76 (99)
T PF13758_consen   47 VTEKEIKEILGEGQGITRTREQVVDVLSRR   76 (99)
T ss_pred             ccHHHHHHHhCCCCCCCcCHHHHHHHHHHH
Confidence            45666666 887766666788899888888


No 52 
>PLN02882 aminoacyl-tRNA ligase
Probab=21.51  E-value=84  Score=28.52  Aligned_cols=24  Identities=33%  Similarity=0.520  Sum_probs=20.0

Q ss_pred             CHHHHHHHH---HHHhcCCCcccccCc
Q psy13098         46 NRARKYMDS---VRKRKGLPVQDKLVA   69 (81)
Q Consensus        46 n~Ar~~v~~---iRkRKGL~~~ekiv~   69 (81)
                      -.||++|+.   .||..||.+.++|-.
T Consensus       995 G~ARE~v~rIQ~lRK~~gl~~~D~I~v 1021 (1159)
T PLN02882        995 GVAREVVNRIQKLRKKAGLEPTDKVEV 1021 (1159)
T ss_pred             hHHHHHHHHHHHHHHhCCCCCCcEEEE
Confidence            379999987   699999999987743


No 53 
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=20.50  E-value=41  Score=20.08  Aligned_cols=19  Identities=21%  Similarity=0.282  Sum_probs=10.7

Q ss_pred             CcccCCcceeeceecccee
Q psy13098          2 NLCCRGSVDGLRYFFWFQV   20 (81)
Q Consensus         2 ~~~T~G~A~~ql~FsHW~~   20 (81)
                      +..+.|=-.-|.+|||=+.
T Consensus         7 ~VkCp~C~~~q~vFSha~t   25 (55)
T PF01667_consen    7 DVKCPGCYNIQTVFSHAQT   25 (55)
T ss_dssp             EEE-TTT-SEEEEETT-SS
T ss_pred             EEECCCCCCeeEEEecCCe
Confidence            3445555567899999553


Done!