Diaphorina citri psyllid: psy13103

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--

MELNNNEEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQR

cccccccccHHHHHHHHHHHHHHHcccccccccEEEccccHHHHHHHcccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHccccccccCCcccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHcc

*ELN**EEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQ*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MELNNNEEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044710 [BP]	single-organism metabolic process	probable	GO:0008150, GO:0008152
GO:0016620 [MF]	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	probable	GO:0003824, GO:0016903, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted