Diaphorina citri psyllid: psy13103


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MELNNNEEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQR
cccccccccHHHHHHHHHHHHHHHcccccccccEEEccccHHHHHHHcccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHccccccccCCcccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHcc
*ELN**EEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELNNNEEELELLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQDLFFFDVAQLDWDHYCTSAPFLRLLKIYSKLTKAQYTLSYFSLRSWTWKNANVIDLWTRLSDKDQELFFFDVAQLDWDHYCKALLLGLRVYLVKDGIHTLPAARRKWQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0016620 [MF]oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0016903, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted