Query         psy13111
Match_columns 127
No_of_seqs    80 out of 82
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:53:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13111hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3248|consensus               97.6 1.4E-05   3E-10   70.3   0.6   27  100-127   280-306 (421)
  2 KOG3248|consensus               76.8     1.2 2.7E-05   39.8   1.2   30   97-126   298-327 (421)
  3 COG2704 DcuB Anaerobic C4-dica  41.4      13 0.00029   33.8   1.1   11   14-24    195-205 (436)
  4 PF10481 CENP-F_N:  Cenp-F N-te  40.1     6.9 0.00015   34.1  -0.8   10    2-11    200-209 (307)
  5 KOG0907|consensus               36.7      11 0.00025   26.9  -0.0   10  109-118    29-38  (106)
  6 PF03605 DcuA_DcuB:  Anaerobic   36.7      17 0.00036   32.2   1.0   13   14-26    192-204 (364)
  7 PHA02278 thioredoxin-like prot  35.3      12 0.00025   26.3  -0.2   10  110-119    23-32  (103)
  8 cd02985 TRX_CDSP32 TRX family,  35.1      12 0.00026   25.2  -0.1    9  110-118    24-32  (103)
  9 cd02952 TRP14_like Human TRX-r  31.3      17 0.00036   26.7   0.1   12  108-119    35-46  (119)
 10 KOG1435|consensus               31.2      13 0.00027   33.7  -0.6   27   92-119   396-422 (428)
 11 cd03000 PDI_a_TMX3 PDIa family  31.2      15 0.00032   24.4  -0.2   13  108-120    22-34  (104)
 12 cd02948 TRX_NDPK TRX domain, T  30.2      16 0.00034   24.5  -0.2   10  110-119    26-35  (102)
 13 COG0526 TrxA Thiol-disulfide i  30.1      16 0.00035   21.7  -0.1   10  110-119    41-50  (127)
 14 cd02999 PDI_a_ERp44_like PDIa   30.1      16 0.00034   24.8  -0.2   11  110-120    27-37  (100)
 15 PF13451 zf-trcl:  Probable zin  28.5      18  0.0004   23.7  -0.1   18  104-121    27-44  (49)
 16 cd02956 ybbN ybbN protein fami  28.1      18  0.0004   23.2  -0.1   11  109-119    20-30  (96)
 17 cd02959 ERp19 Endoplasmic reti  28.1      18 0.00038   25.6  -0.2   11  110-120    28-38  (117)
 18 cd03005 PDI_a_ERp46 PDIa famil  27.2      19 0.00042   23.0  -0.2   11  110-120    25-35  (102)
 19 cd02997 PDI_a_PDIR PDIa family  27.1      19 0.00042   23.0  -0.2   10  110-119    26-35  (104)
 20 cd02954 DIM1 Dim1 family; Dim1  26.7      20 0.00044   26.3  -0.1    9  110-118    23-31  (114)
 21 cd02994 PDI_a_TMX PDIa family,  26.4      20 0.00044   23.3  -0.2   13  106-118    21-33  (101)
 22 PF01222 ERG4_ERG24:  Ergostero  26.3      15 0.00032   32.4  -1.1   24   91-118   399-422 (432)
 23 PF01586 Basic:  Myogenic Basic  25.3      24 0.00051   25.6   0.0   11  111-121    72-83  (86)
 24 PRK13692 (3R)-hydroxyacyl-ACP   25.2      45 0.00097   25.1   1.5   21   11-31     36-56  (159)
 25 cd02953 DsbDgamma DsbD gamma f  25.1      22 0.00049   23.4  -0.1   11  110-120    20-30  (104)
 26 cd03002 PDI_a_MPD1_like PDI fa  24.4      23  0.0005   23.1  -0.2   10  110-119    27-36  (109)
 27 PF13899 Thioredoxin_7:  Thiore  23.7      22 0.00047   23.0  -0.4   12  109-120    25-36  (82)
 28 KOG1818|consensus               23.6      25 0.00055   33.2  -0.1   31   89-119   160-190 (634)
 29 cd03003 PDI_a_ERdj5_N PDIa fam  23.2      25 0.00055   23.0  -0.2   10  110-119    27-36  (101)
 30 KOG0910|consensus               22.8      27  0.0006   27.4  -0.1    9  110-118    70-78  (150)
 31 cd02967 mauD Methylamine utili  22.4      29 0.00062   22.8  -0.0    9  110-118    30-38  (114)
 32 cd02963 TRX_DnaJ TRX domain, D  22.1      28 0.00062   23.8  -0.1    9  111-119    34-42  (111)
 33 TIGR02738 TrbB type-F conjugat  22.0      29 0.00062   26.2  -0.1   10  109-118    58-67  (153)
 34 cd03449 R_hydratase (R)-hydrat  21.9      54  0.0012   21.9   1.3   16   11-26     29-44  (128)
 35 cd02984 TRX_PICOT TRX domain,   20.9      30 0.00065   22.1  -0.2   10  110-119    23-32  (97)
 36 cd02995 PDI_a_PDI_a'_C PDIa fa  20.9      30 0.00065   22.0  -0.2   11  108-118    25-35  (104)
 37 cd03004 PDI_a_ERdj5_C PDIa fam  20.8      30 0.00065   22.6  -0.2    9  110-118    28-36  (104)
 38 PTZ00051 thioredoxin; Provisio  20.8      31 0.00067   22.1  -0.1   10  110-119    27-36  (98)
 39 cd02998 PDI_a_ERp38 PDIa famil  20.8      31 0.00066   21.9  -0.1   11  110-120    27-37  (105)
 40 cd03001 PDI_a_P5 PDIa family,   20.6      30 0.00065   22.1  -0.2   10  110-119    27-36  (103)
 41 cd02993 PDI_a_APS_reductase PD  20.3      29 0.00063   23.4  -0.3   11  110-120    30-40  (109)
 42 cd02996 PDI_a_ERp44 PDIa famil  20.0      32  0.0007   22.8  -0.1   11  110-120    27-37  (108)

No 1  
>KOG3248|consensus
Probab=97.64  E-value=1.4e-05  Score=70.27  Aligned_cols=27  Identities=37%  Similarity=1.026  Sum_probs=25.1

Q ss_pred             hhhhhcccccchhhhcccccccccccCC
Q psy13111        100 CRKVYGMEHRDLWCTQCKWKKACSRFGD  127 (127)
Q Consensus       100 CR~~yGm~~~~~WC~~Cr~KK~C~rf~d  127 (127)
                      =|++||+++.++||+.|+ ||+|.+|+|
T Consensus       280 trarfgvqes~~~~~~c~-kKkc~~~~~  306 (421)
T KOG3248|consen  280 TRARFGVQESEMWCGSCK-KKKCVAYID  306 (421)
T ss_pred             hhhhhhhhcccccccccc-cchhhhhcC
Confidence            388999999999999999 999999986


No 2  
>KOG3248|consensus
Probab=76.76  E-value=1.2  Score=39.85  Aligned_cols=30  Identities=17%  Similarity=-0.020  Sum_probs=28.7

Q ss_pred             cchhhhhhcccccchhhhcccccccccccC
Q psy13111         97 SKKCRKVYGMEHRDLWCTQCKWKKACSRFG  126 (127)
Q Consensus        97 ~KKCR~~yGm~~~~~WC~~Cr~KK~C~rf~  126 (127)
                      .|||++.++.+..-.||..|+.++.|++|.
T Consensus       298 kKkc~~~~~~~g~~d~~~s~dg~~~~~~y~  327 (421)
T KOG3248|consen  298 KKKCVAYIDREGGCDSPDSSDGSGLDSPYS  327 (421)
T ss_pred             cchhhhhcCccCCCCCCCcccCCcccCCCC
Confidence            799999999999999999999999999985


No 3  
>COG2704 DcuB Anaerobic C4-dicarboxylate transporter [General function prediction only]
Probab=41.36  E-value=13  Score=33.77  Aligned_cols=11  Identities=73%  Similarity=0.996  Sum_probs=10.0

Q ss_pred             CCChHHHHhhh
Q psy13111         14 RVDPEYQKNLS   24 (127)
Q Consensus        14 heDPeyq~~l~   24 (127)
                      ++|||||+.|.
T Consensus       195 ~~Dp~yq~RL~  205 (436)
T COG2704         195 DDDPEYQKRLS  205 (436)
T ss_pred             cCCHHHHHHhh
Confidence            68999999997


No 4  
>PF10481 CENP-F_N:  Cenp-F N-terminal domain;  InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []. Most of the kinetochore/centromere functions appear to depend upon binding of the C-terminal part of the molecule, whereas the N-terminal part, here, may be a cytoplasmic player in controlling the function of microtubules and dynein [].
Probab=40.06  E-value=6.9  Score=34.11  Aligned_cols=10  Identities=30%  Similarity=0.507  Sum_probs=9.1

Q ss_pred             CCCCcccccc
Q psy13111          2 SSYAHSDQCQ   11 (127)
Q Consensus         2 ~tlshrDmar   11 (127)
                      +||+|||+||
T Consensus       200 stmsHRdIAr  209 (307)
T PF10481_consen  200 STMSHRDIAR  209 (307)
T ss_pred             ccccHHHHHH
Confidence            6999999997


No 5  
>KOG0907|consensus
Probab=36.73  E-value=11  Score=26.88  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=8.2

Q ss_pred             cchhhhcccc
Q psy13111        109 RDLWCTQCKW  118 (127)
Q Consensus       109 ~~~WC~~Cr~  118 (127)
                      .-.||.+||-
T Consensus        29 ~a~wCgPCk~   38 (106)
T KOG0907|consen   29 YATWCGPCKA   38 (106)
T ss_pred             ECCCCcchhh
Confidence            4689999985


No 6  
>PF03605 DcuA_DcuB:  Anaerobic c4-dicarboxylate membrane transporter;  InterPro: IPR004668 These proteins are members of the C4-Dicarboxylate Uptake (Dcu) family. Most proteins in this family are predicted to have 12 GES predicted transmembrane regions; however the one member whose membrane topology has been experimentally determined has 10 transmembrane regions, with both the N- and C-termini localized to the periplasm []. The DcuA and DcuB proteins are involved in the transport of aspartate, malate, fumarate and succinate in many species [, , ], and are thought to function as antiporters with any two of these substrates. Since DcuA is encoded in an operon with the gene for aspartase, and DcuB is encoded in an operon with the gene for fumarase, their physiological functions may be to catalyze aspartate:fumarate and fumarate:malate exchange during the anaerobic utilization of aspartate and fumarate, respectively []. The Escherichia coli DcuA and DcuB proteins have very different expression patterns []. DcuA is constitutively expressed; DcuB is strongly induced anaerobically by FNR and C4-dicarboxylates, while it is repressed by nitrate and subject to CRP-mediated catabolite repression.; GO: 0015556 C4-dicarboxylate transmembrane transporter activity, 0015740 C4-dicarboxylate transport, 0016021 integral to membrane
Probab=36.73  E-value=17  Score=32.23  Aligned_cols=13  Identities=46%  Similarity=0.736  Sum_probs=10.8

Q ss_pred             CCChHHHHhhhcC
Q psy13111         14 RVDPEYQKNLSKP   26 (127)
Q Consensus        14 heDPeyq~~l~~~   26 (127)
                      .+|||||+.+..+
T Consensus       192 ~~Dp~yq~rl~~g  204 (364)
T PF03605_consen  192 DDDPEYQERLADG  204 (364)
T ss_pred             ccCHHHHHHHhcc
Confidence            6899999998743


No 7  
>PHA02278 thioredoxin-like protein
Probab=35.31  E-value=12  Score=26.30  Aligned_cols=10  Identities=20%  Similarity=0.468  Sum_probs=7.9

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      --||.+||.-
T Consensus        23 A~WCgpCk~m   32 (103)
T PHA02278         23 QDNCGKCEIL   32 (103)
T ss_pred             CCCCHHHHhH
Confidence            4699999953


No 8  
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif. CDSP32 is a stress-inducible TRX, i.e., it acts as a TRX by reducing protein disulfides and is induced by environmental and oxidative stress conditions. It plays a critical role in plastid defense against oxidative damage, a role related to its function as a physiological electron donor to BAS1, a plastidic 2-cys peroxiredoxin. Plants lacking CDSP32 exhibit decreased photosystem II photochemical efficiencies and chlorophyll retention compared to WT controls, as well as an increased proportion of BAS1 in its overoxidized monomeric form.
Probab=35.06  E-value=12  Score=25.25  Aligned_cols=9  Identities=0%  Similarity=-0.484  Sum_probs=7.1

Q ss_pred             chhhhcccc
Q psy13111        110 DLWCTQCKW  118 (127)
Q Consensus       110 ~~WC~~Cr~  118 (127)
                      -.||.+|+.
T Consensus        24 a~wC~~C~~   32 (103)
T cd02985          24 LKHSGPSVK   32 (103)
T ss_pred             CCCCHhHHH
Confidence            359999985


No 9  
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1. TRP14 catalyzes the reduction of small disulfide-containing peptides but does not reduce disulfides of ribonucleotide reductase, peroxiredoxin and methionine sulfoxide reductase, which are TRX1 substrates. TRP14 also plays a role in tumor necrosis factor (TNF)-alpha signaling pathways, distinct from that of TRX1. Its depletion promoted TNF-alpha induced activation of c-Jun N-terminal kinase and mitogen-activated protein kinases.
Probab=31.27  E-value=17  Score=26.67  Aligned_cols=12  Identities=25%  Similarity=0.855  Sum_probs=9.3

Q ss_pred             ccchhhhccccc
Q psy13111        108 HRDLWCTQCKWK  119 (127)
Q Consensus       108 ~~~~WC~~Cr~K  119 (127)
                      ..+.||.+||.-
T Consensus        35 ~~~~WC~pCr~~   46 (119)
T cd02952          35 DGQSWCPDCVKA   46 (119)
T ss_pred             CCCCCCHhHHhh
Confidence            456899999954


No 10 
>KOG1435|consensus
Probab=31.19  E-value=13  Score=33.74  Aligned_cols=27  Identities=22%  Similarity=0.729  Sum_probs=19.3

Q ss_pred             cCCCCcchhhhhhcccccchhhhccccc
Q psy13111         92 KVRGDSKKCRKVYGMEHRDLWCTQCKWK  119 (127)
Q Consensus        92 ~~r~~~KKCR~~yGm~~~~~WC~~Cr~K  119 (127)
                      |...|+.|||+.||-+=+ .-|++|+..
T Consensus       396 R~~RDe~rC~~KYG~~W~-~Yc~~Vpyr  422 (428)
T KOG1435|consen  396 RAARDEHRCRSKYGEDWE-EYCRKVPYR  422 (428)
T ss_pred             HHhhhHHHHHHHHhhhHH-HHHhhCCcc
Confidence            345566999999998544 448887753


No 11 
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase.
Probab=31.16  E-value=15  Score=24.43  Aligned_cols=13  Identities=31%  Similarity=0.810  Sum_probs=9.3

Q ss_pred             ccchhhhcccccc
Q psy13111        108 HRDLWCTQCKWKK  120 (127)
Q Consensus       108 ~~~~WC~~Cr~KK  120 (127)
                      --..||.+||.-.
T Consensus        22 f~a~wC~~C~~~~   34 (104)
T cd03000          22 FYAPWCGHCKKLE   34 (104)
T ss_pred             EECCCCHHHHhhC
Confidence            3457999998643


No 12 
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a  component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which 
Probab=30.24  E-value=16  Score=24.54  Aligned_cols=10  Identities=40%  Similarity=1.062  Sum_probs=7.6

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      --||.+|+.-
T Consensus        26 a~wC~~Ck~~   35 (102)
T cd02948          26 QEWCGPCKAV   35 (102)
T ss_pred             CCcCHhHHHH
Confidence            4699999853


No 13 
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]
Probab=30.09  E-value=16  Score=21.70  Aligned_cols=10  Identities=30%  Similarity=1.159  Sum_probs=8.4

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||..|++-
T Consensus        41 ~~~C~~C~~~   50 (127)
T COG0526          41 APWCPPCRAE   50 (127)
T ss_pred             cCcCHHHHhh
Confidence            7899999874


No 14 
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER.
Probab=30.07  E-value=16  Score=24.85  Aligned_cols=11  Identities=18%  Similarity=0.504  Sum_probs=8.2

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      ..||.+|+.-.
T Consensus        27 a~WC~~C~~~~   37 (100)
T cd02999          27 ASWCPFSASFR   37 (100)
T ss_pred             CCCCHHHHhHh
Confidence            46999998643


No 15 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=28.49  E-value=18  Score=23.67  Aligned_cols=18  Identities=17%  Similarity=0.578  Sum_probs=14.4

Q ss_pred             hcccccchhhhccccccc
Q psy13111        104 YGMEHRDLWCTQCKWKKA  121 (127)
Q Consensus       104 yGm~~~~~WC~~Cr~KK~  121 (127)
                      -|+++.-..|..||.+++
T Consensus        27 Kgf~n~p~RC~~CR~~rk   44 (49)
T PF13451_consen   27 KGFDNEPKRCPSCRQARK   44 (49)
T ss_pred             cCCcCCCccCHHHHHHHH
Confidence            366778888999998875


No 16 
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=28.10  E-value=18  Score=23.21  Aligned_cols=11  Identities=9%  Similarity=-0.266  Sum_probs=8.1

Q ss_pred             cchhhhccccc
Q psy13111        109 RDLWCTQCKWK  119 (127)
Q Consensus       109 ~~~WC~~Cr~K  119 (127)
                      -.-||.+|+.-
T Consensus        20 ~a~wC~~C~~~   30 (96)
T cd02956          20 WAPRSPPSKEL   30 (96)
T ss_pred             ECCCChHHHHH
Confidence            34699999854


No 17 
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain. Denaturation studies indicate that the reduced form is more stable than the oxidized form, suggesting that the protein is involved in disulfide bond formation. In vitro, ERp19 has been shown to possess thiol-disulfide oxidase activity which is dependent on the presence of both active site cysteines. Although described as protein disulfide isomerase (PDI)-like, the protein does not complement for PDI activity. ERp19 shows a wide tissue distribution but is most abundant in liver, testis, heart and kidney.
Probab=28.07  E-value=18  Score=25.60  Aligned_cols=11  Identities=45%  Similarity=1.084  Sum_probs=8.3

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      -.||.+|+.-+
T Consensus        28 a~WC~~C~~~~   38 (117)
T cd02959          28 KTWCGACKALK   38 (117)
T ss_pred             CCcCHHHHHHH
Confidence            47999998643


No 18 
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=27.16  E-value=19  Score=23.02  Aligned_cols=11  Identities=36%  Similarity=1.023  Sum_probs=8.3

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      ..||.+|+..+
T Consensus        25 a~wC~~C~~~~   35 (102)
T cd03005          25 APWCGHCKRLA   35 (102)
T ss_pred             CCCCHHHHHhC
Confidence            45999998653


No 19 
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=27.12  E-value=19  Score=23.01  Aligned_cols=10  Identities=40%  Similarity=1.099  Sum_probs=7.4

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||..|+.-
T Consensus        26 a~wC~~C~~~   35 (104)
T cd02997          26 APWCGHCKKM   35 (104)
T ss_pred             CCCCHHHHHh
Confidence            3599999853


No 20 
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein. It is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 interacts with multiple splicing-associated proteins, suggesting that it functions at multiple control points in the splicing of pre-mRNA as part of a large spliceosomal complex involving many protein-protein interactions. U5 snRNP contains seven core proteins (common to all snRNPs) and nine U5-specific proteins, one of which is Dim1. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. It is essential for G2/M phase transition, as a consequence to its role in pre-mRNA splicing.
Probab=26.71  E-value=20  Score=26.30  Aligned_cols=9  Identities=22%  Similarity=0.471  Sum_probs=7.5

Q ss_pred             chhhhcccc
Q psy13111        110 DLWCTQCKW  118 (127)
Q Consensus       110 ~~WC~~Cr~  118 (127)
                      -.||.+||.
T Consensus        23 A~WCgpCk~   31 (114)
T cd02954          23 RDWDPVCMQ   31 (114)
T ss_pred             CCCChhHHH
Confidence            469999985


No 21 
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC.
Probab=26.38  E-value=20  Score=23.31  Aligned_cols=13  Identities=31%  Similarity=0.961  Sum_probs=9.2

Q ss_pred             ccccchhhhcccc
Q psy13111        106 MEHRDLWCTQCKW  118 (127)
Q Consensus       106 m~~~~~WC~~Cr~  118 (127)
                      ++=-..||.+|+.
T Consensus        21 v~f~a~wC~~C~~   33 (101)
T cd02994          21 IEFYAPWCPACQQ   33 (101)
T ss_pred             EEEECCCCHHHHH
Confidence            3444569999985


No 22 
>PF01222 ERG4_ERG24:  Ergosterol biosynthesis ERG4/ERG24 family;  InterPro: IPR001171 The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol []. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family.; GO: 0016020 membrane
Probab=26.30  E-value=15  Score=32.43  Aligned_cols=24  Identities=42%  Similarity=0.901  Sum_probs=17.4

Q ss_pred             CcCCCCcchhhhhhcccccchhhhcccc
Q psy13111         91 RKVRGDSKKCRKVYGMEHRDLWCTQCKW  118 (127)
Q Consensus        91 ~~~r~~~KKCR~~yGm~~~~~WC~~Cr~  118 (127)
                      -|...|.+||++.||=    .|-..|++
T Consensus       399 hR~~RD~~rC~~KYG~----~W~~Yc~~  422 (432)
T PF01222_consen  399 HRARRDEERCRKKYGK----DWDEYCKR  422 (432)
T ss_pred             hhHHHHHHHHHHhhCH----HHHHHHHh
Confidence            4557889999999994    45555543


No 23 
>PF01586 Basic:  Myogenic Basic domain;  InterPro: IPR002546 This basic domain is found in the MyoD family of muscle specific proteins that control muscle development. The bHLH region of the MyoD family includes the basic domain and the Helix-loop-helix (HLH) motif. The bHLH region mediates specific DNA binding []. With 12 residues of the basic domain involved in DNA binding []. The basic domain forms an extended alpha helix in the structure.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007517 muscle organ development, 0005634 nucleus; PDB: 1MDY_C.
Probab=25.31  E-value=24  Score=25.56  Aligned_cols=11  Identities=55%  Similarity=1.395  Sum_probs=1.3

Q ss_pred             hh-hhccccccc
Q psy13111        111 LW-CTQCKWKKA  121 (127)
Q Consensus       111 ~W-C~~Cr~KK~  121 (127)
                      +| |++|+||..
T Consensus        72 ~WACKaCKRKt~   83 (86)
T PF01586_consen   72 LWACKACKRKTV   83 (86)
T ss_dssp             -------S---T
T ss_pred             HHHhHhhhccCc
Confidence            68 999999853


No 24 
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional
Probab=25.16  E-value=45  Score=25.09  Aligned_cols=21  Identities=19%  Similarity=0.303  Sum_probs=16.6

Q ss_pred             cCCCCChHHHHhhhcCccchh
Q psy13111         11 QNGRVDPEYQKNLSKPGLVAT   31 (127)
Q Consensus        11 rPPheDPeyq~~l~~~~~~~~   31 (127)
                      -|.|.|+||.+.....++++.
T Consensus        36 nPlh~D~e~A~~~~fg~~iA~   56 (159)
T PRK13692         36 DAAYFEEDAAAELGYKGLLAP   56 (159)
T ss_pred             CCCccCHHHHHhcCCCCcccC
Confidence            589999999998876666553


No 25 
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha).  DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=25.05  E-value=22  Score=23.38  Aligned_cols=11  Identities=36%  Similarity=1.075  Sum_probs=8.3

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      -.||.+|+.-+
T Consensus        20 a~wC~~C~~~~   30 (104)
T cd02953          20 ADWCVTCKVNE   30 (104)
T ss_pred             cchhHHHHHHH
Confidence            46999998643


No 26 
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity.
Probab=24.37  E-value=23  Score=23.09  Aligned_cols=10  Identities=40%  Similarity=1.072  Sum_probs=7.6

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||.+|+.-
T Consensus        27 a~wC~~C~~~   36 (109)
T cd03002          27 APWCGHCKNL   36 (109)
T ss_pred             CCCCHHHHhh
Confidence            4599999864


No 27 
>PF13899 Thioredoxin_7:  Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A ....
Probab=23.68  E-value=22  Score=23.01  Aligned_cols=12  Identities=33%  Similarity=0.850  Sum_probs=9.1

Q ss_pred             cchhhhcccccc
Q psy13111        109 RDLWCTQCKWKK  120 (127)
Q Consensus       109 ~~~WC~~Cr~KK  120 (127)
                      .-.||..|+.-+
T Consensus        25 ~a~wC~~C~~l~   36 (82)
T PF13899_consen   25 GADWCPPCKKLE   36 (82)
T ss_dssp             ETTTTHHHHHHH
T ss_pred             ECCCCHhHHHHH
Confidence            357999998754


No 28 
>KOG1818|consensus
Probab=23.65  E-value=25  Score=33.24  Aligned_cols=31  Identities=23%  Similarity=0.563  Sum_probs=26.1

Q ss_pred             CCCcCCCCcchhhhhhcccccchhhhccccc
Q psy13111         89 PTRKVRGDSKKCRKVYGMEHRDLWCTQCKWK  119 (127)
Q Consensus        89 ~~~~~r~~~KKCR~~yGm~~~~~WC~~Cr~K  119 (127)
                      |..-+..+-.|||+.||+-++.--|..|-++
T Consensus       160 pdW~D~~~C~rCr~~F~~~~rkHHCr~CG~v  190 (634)
T KOG1818|consen  160 PDWIDSEECLRCRVKFGLTNRKHHCRNCGQV  190 (634)
T ss_pred             cccccccccceeeeeeeeccccccccccchh
Confidence            3455667889999999999999999999883


No 29 
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=23.22  E-value=25  Score=23.00  Aligned_cols=10  Identities=20%  Similarity=0.521  Sum_probs=7.8

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||.+|+.-
T Consensus        27 a~wC~~C~~~   36 (101)
T cd03003          27 SPRCSHCHDL   36 (101)
T ss_pred             CCCChHHHHh
Confidence            4799999853


No 30 
>KOG0910|consensus
Probab=22.81  E-value=27  Score=27.40  Aligned_cols=9  Identities=44%  Similarity=1.295  Sum_probs=7.1

Q ss_pred             chhhhcccc
Q psy13111        110 DLWCTQCKW  118 (127)
Q Consensus       110 ~~WC~~Cr~  118 (127)
                      -.||.+|+-
T Consensus        70 A~WCgPCk~   78 (150)
T KOG0910|consen   70 AEWCGPCKM   78 (150)
T ss_pred             cCcCccHhH
Confidence            469999973


No 31 
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit.
Probab=22.42  E-value=29  Score=22.84  Aligned_cols=9  Identities=33%  Similarity=0.593  Sum_probs=7.4

Q ss_pred             chhhhcccc
Q psy13111        110 DLWCTQCKW  118 (127)
Q Consensus       110 ~~WC~~Cr~  118 (127)
                      ..||..|+.
T Consensus        30 ~~wC~~C~~   38 (114)
T cd02967          30 SPTCPVCKK   38 (114)
T ss_pred             CCCCcchHh
Confidence            569999985


No 32 
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network.
Probab=22.08  E-value=28  Score=23.79  Aligned_cols=9  Identities=33%  Similarity=0.970  Sum_probs=7.3

Q ss_pred             hhhhccccc
Q psy13111        111 LWCTQCKWK  119 (127)
Q Consensus       111 ~WC~~Cr~K  119 (127)
                      .||.+|+.-
T Consensus        34 ~wC~~C~~~   42 (111)
T cd02963          34 DWCFSCIHI   42 (111)
T ss_pred             CccHhHHHh
Confidence            699999854


No 33 
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=21.99  E-value=29  Score=26.18  Aligned_cols=10  Identities=20%  Similarity=0.428  Sum_probs=7.8

Q ss_pred             cchhhhcccc
Q psy13111        109 RDLWCTQCKW  118 (127)
Q Consensus       109 ~~~WC~~Cr~  118 (127)
                      =..||.+||.
T Consensus        58 WAsWCppCr~   67 (153)
T TIGR02738        58 YQSTCPYCHQ   67 (153)
T ss_pred             ECCCChhHHH
Confidence            3469999985


No 34 
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.  The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer.  A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=21.87  E-value=54  Score=21.86  Aligned_cols=16  Identities=25%  Similarity=0.225  Sum_probs=12.5

Q ss_pred             cCCCCChHHHHhhhcC
Q psy13111         11 QNGRVDPEYQKNLSKP   26 (127)
Q Consensus        11 rPPheDPeyq~~l~~~   26 (127)
                      .|-|.|+||.+....+
T Consensus        29 npiH~D~~~A~~~g~~   44 (128)
T cd03449          29 NPIHLDEEYAKKTRFG   44 (128)
T ss_pred             CCccCCHHHHhhCCCC
Confidence            5889999998875533


No 35 
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=20.93  E-value=30  Score=22.07  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=7.6

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||..|+.-
T Consensus        23 ~~~C~~C~~~   32 (97)
T cd02984          23 APWAEPCKQM   32 (97)
T ss_pred             CCCCHHHHHH
Confidence            4699999854


No 36 
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=20.89  E-value=30  Score=22.01  Aligned_cols=11  Identities=36%  Similarity=0.981  Sum_probs=8.0

Q ss_pred             ccchhhhcccc
Q psy13111        108 HRDLWCTQCKW  118 (127)
Q Consensus       108 ~~~~WC~~Cr~  118 (127)
                      --..||..|+.
T Consensus        25 f~~~~C~~C~~   35 (104)
T cd02995          25 FYAPWCGHCKA   35 (104)
T ss_pred             EECCCCHHHHH
Confidence            34479999985


No 37 
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as  JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=20.77  E-value=30  Score=22.61  Aligned_cols=9  Identities=33%  Similarity=1.154  Sum_probs=7.1

Q ss_pred             chhhhcccc
Q psy13111        110 DLWCTQCKW  118 (127)
Q Consensus       110 ~~WC~~Cr~  118 (127)
                      ..||.+|+.
T Consensus        28 a~wC~~C~~   36 (104)
T cd03004          28 APWCGPCQA   36 (104)
T ss_pred             CCCCHHHHH
Confidence            359999985


No 38 
>PTZ00051 thioredoxin; Provisional
Probab=20.75  E-value=31  Score=22.14  Aligned_cols=10  Identities=40%  Similarity=1.076  Sum_probs=7.6

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||..|+.-
T Consensus        27 ~~~C~~C~~~   36 (98)
T PTZ00051         27 AEWCGPCKRI   36 (98)
T ss_pred             CCCCHHHHHH
Confidence            4699999854


No 39 
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=20.75  E-value=31  Score=21.92  Aligned_cols=11  Identities=36%  Similarity=0.963  Sum_probs=8.1

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      ..||..|+.-+
T Consensus        27 a~~C~~C~~~~   37 (105)
T cd02998          27 APWCGHCKNLA   37 (105)
T ss_pred             CCCCHHHHhhC
Confidence            46999998543


No 40 
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=20.64  E-value=30  Score=22.14  Aligned_cols=10  Identities=40%  Similarity=1.072  Sum_probs=7.7

Q ss_pred             chhhhccccc
Q psy13111        110 DLWCTQCKWK  119 (127)
Q Consensus       110 ~~WC~~Cr~K  119 (127)
                      ..||.+|+.-
T Consensus        27 a~~C~~C~~~   36 (103)
T cd03001          27 APWCGHCKNL   36 (103)
T ss_pred             CCCCHHHHHH
Confidence            3699999864


No 41 
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=20.32  E-value=29  Score=23.42  Aligned_cols=11  Identities=27%  Similarity=0.902  Sum_probs=8.4

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      ..||.+|+.-+
T Consensus        30 a~wC~~C~~~~   40 (109)
T cd02993          30 APWCPFCQAME   40 (109)
T ss_pred             CCCCHHHHHHh
Confidence            46999998654


No 42 
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=20.03  E-value=32  Score=22.84  Aligned_cols=11  Identities=18%  Similarity=0.537  Sum_probs=8.5

Q ss_pred             chhhhcccccc
Q psy13111        110 DLWCTQCKWKK  120 (127)
Q Consensus       110 ~~WC~~Cr~KK  120 (127)
                      ..||..|+.-+
T Consensus        27 a~wC~~C~~~~   37 (108)
T cd02996          27 ADWCRFSQMLH   37 (108)
T ss_pred             CCCCHHHHhhH
Confidence            46999998654


Done!