Query psy13111
Match_columns 127
No_of_seqs 80 out of 82
Neff 2.7
Searched_HMMs 46136
Date Fri Aug 16 19:53:28 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy13111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13111hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG3248|consensus 97.6 1.4E-05 3E-10 70.3 0.6 27 100-127 280-306 (421)
2 KOG3248|consensus 76.8 1.2 2.7E-05 39.8 1.2 30 97-126 298-327 (421)
3 COG2704 DcuB Anaerobic C4-dica 41.4 13 0.00029 33.8 1.1 11 14-24 195-205 (436)
4 PF10481 CENP-F_N: Cenp-F N-te 40.1 6.9 0.00015 34.1 -0.8 10 2-11 200-209 (307)
5 KOG0907|consensus 36.7 11 0.00025 26.9 -0.0 10 109-118 29-38 (106)
6 PF03605 DcuA_DcuB: Anaerobic 36.7 17 0.00036 32.2 1.0 13 14-26 192-204 (364)
7 PHA02278 thioredoxin-like prot 35.3 12 0.00025 26.3 -0.2 10 110-119 23-32 (103)
8 cd02985 TRX_CDSP32 TRX family, 35.1 12 0.00026 25.2 -0.1 9 110-118 24-32 (103)
9 cd02952 TRP14_like Human TRX-r 31.3 17 0.00036 26.7 0.1 12 108-119 35-46 (119)
10 KOG1435|consensus 31.2 13 0.00027 33.7 -0.6 27 92-119 396-422 (428)
11 cd03000 PDI_a_TMX3 PDIa family 31.2 15 0.00032 24.4 -0.2 13 108-120 22-34 (104)
12 cd02948 TRX_NDPK TRX domain, T 30.2 16 0.00034 24.5 -0.2 10 110-119 26-35 (102)
13 COG0526 TrxA Thiol-disulfide i 30.1 16 0.00035 21.7 -0.1 10 110-119 41-50 (127)
14 cd02999 PDI_a_ERp44_like PDIa 30.1 16 0.00034 24.8 -0.2 11 110-120 27-37 (100)
15 PF13451 zf-trcl: Probable zin 28.5 18 0.0004 23.7 -0.1 18 104-121 27-44 (49)
16 cd02956 ybbN ybbN protein fami 28.1 18 0.0004 23.2 -0.1 11 109-119 20-30 (96)
17 cd02959 ERp19 Endoplasmic reti 28.1 18 0.00038 25.6 -0.2 11 110-120 28-38 (117)
18 cd03005 PDI_a_ERp46 PDIa famil 27.2 19 0.00042 23.0 -0.2 11 110-120 25-35 (102)
19 cd02997 PDI_a_PDIR PDIa family 27.1 19 0.00042 23.0 -0.2 10 110-119 26-35 (104)
20 cd02954 DIM1 Dim1 family; Dim1 26.7 20 0.00044 26.3 -0.1 9 110-118 23-31 (114)
21 cd02994 PDI_a_TMX PDIa family, 26.4 20 0.00044 23.3 -0.2 13 106-118 21-33 (101)
22 PF01222 ERG4_ERG24: Ergostero 26.3 15 0.00032 32.4 -1.1 24 91-118 399-422 (432)
23 PF01586 Basic: Myogenic Basic 25.3 24 0.00051 25.6 0.0 11 111-121 72-83 (86)
24 PRK13692 (3R)-hydroxyacyl-ACP 25.2 45 0.00097 25.1 1.5 21 11-31 36-56 (159)
25 cd02953 DsbDgamma DsbD gamma f 25.1 22 0.00049 23.4 -0.1 11 110-120 20-30 (104)
26 cd03002 PDI_a_MPD1_like PDI fa 24.4 23 0.0005 23.1 -0.2 10 110-119 27-36 (109)
27 PF13899 Thioredoxin_7: Thiore 23.7 22 0.00047 23.0 -0.4 12 109-120 25-36 (82)
28 KOG1818|consensus 23.6 25 0.00055 33.2 -0.1 31 89-119 160-190 (634)
29 cd03003 PDI_a_ERdj5_N PDIa fam 23.2 25 0.00055 23.0 -0.2 10 110-119 27-36 (101)
30 KOG0910|consensus 22.8 27 0.0006 27.4 -0.1 9 110-118 70-78 (150)
31 cd02967 mauD Methylamine utili 22.4 29 0.00062 22.8 -0.0 9 110-118 30-38 (114)
32 cd02963 TRX_DnaJ TRX domain, D 22.1 28 0.00062 23.8 -0.1 9 111-119 34-42 (111)
33 TIGR02738 TrbB type-F conjugat 22.0 29 0.00062 26.2 -0.1 10 109-118 58-67 (153)
34 cd03449 R_hydratase (R)-hydrat 21.9 54 0.0012 21.9 1.3 16 11-26 29-44 (128)
35 cd02984 TRX_PICOT TRX domain, 20.9 30 0.00065 22.1 -0.2 10 110-119 23-32 (97)
36 cd02995 PDI_a_PDI_a'_C PDIa fa 20.9 30 0.00065 22.0 -0.2 11 108-118 25-35 (104)
37 cd03004 PDI_a_ERdj5_C PDIa fam 20.8 30 0.00065 22.6 -0.2 9 110-118 28-36 (104)
38 PTZ00051 thioredoxin; Provisio 20.8 31 0.00067 22.1 -0.1 10 110-119 27-36 (98)
39 cd02998 PDI_a_ERp38 PDIa famil 20.8 31 0.00066 21.9 -0.1 11 110-120 27-37 (105)
40 cd03001 PDI_a_P5 PDIa family, 20.6 30 0.00065 22.1 -0.2 10 110-119 27-36 (103)
41 cd02993 PDI_a_APS_reductase PD 20.3 29 0.00063 23.4 -0.3 11 110-120 30-40 (109)
42 cd02996 PDI_a_ERp44 PDIa famil 20.0 32 0.0007 22.8 -0.1 11 110-120 27-37 (108)
No 1
>KOG3248|consensus
Probab=97.64 E-value=1.4e-05 Score=70.27 Aligned_cols=27 Identities=37% Similarity=1.026 Sum_probs=25.1
Q ss_pred hhhhhcccccchhhhcccccccccccCC
Q psy13111 100 CRKVYGMEHRDLWCTQCKWKKACSRFGD 127 (127)
Q Consensus 100 CR~~yGm~~~~~WC~~Cr~KK~C~rf~d 127 (127)
=|++||+++.++||+.|+ ||+|.+|+|
T Consensus 280 trarfgvqes~~~~~~c~-kKkc~~~~~ 306 (421)
T KOG3248|consen 280 TRARFGVQESEMWCGSCK-KKKCVAYID 306 (421)
T ss_pred hhhhhhhhcccccccccc-cchhhhhcC
Confidence 388999999999999999 999999986
No 2
>KOG3248|consensus
Probab=76.76 E-value=1.2 Score=39.85 Aligned_cols=30 Identities=17% Similarity=-0.020 Sum_probs=28.7
Q ss_pred cchhhhhhcccccchhhhcccccccccccC
Q psy13111 97 SKKCRKVYGMEHRDLWCTQCKWKKACSRFG 126 (127)
Q Consensus 97 ~KKCR~~yGm~~~~~WC~~Cr~KK~C~rf~ 126 (127)
.|||++.++.+..-.||..|+.++.|++|.
T Consensus 298 kKkc~~~~~~~g~~d~~~s~dg~~~~~~y~ 327 (421)
T KOG3248|consen 298 KKKCVAYIDREGGCDSPDSSDGSGLDSPYS 327 (421)
T ss_pred cchhhhhcCccCCCCCCCcccCCcccCCCC
Confidence 799999999999999999999999999985
No 3
>COG2704 DcuB Anaerobic C4-dicarboxylate transporter [General function prediction only]
Probab=41.36 E-value=13 Score=33.77 Aligned_cols=11 Identities=73% Similarity=0.996 Sum_probs=10.0
Q ss_pred CCChHHHHhhh
Q psy13111 14 RVDPEYQKNLS 24 (127)
Q Consensus 14 heDPeyq~~l~ 24 (127)
++|||||+.|.
T Consensus 195 ~~Dp~yq~RL~ 205 (436)
T COG2704 195 DDDPEYQKRLS 205 (436)
T ss_pred cCCHHHHHHhh
Confidence 68999999997
No 4
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []. Most of the kinetochore/centromere functions appear to depend upon binding of the C-terminal part of the molecule, whereas the N-terminal part, here, may be a cytoplasmic player in controlling the function of microtubules and dynein [].
Probab=40.06 E-value=6.9 Score=34.11 Aligned_cols=10 Identities=30% Similarity=0.507 Sum_probs=9.1
Q ss_pred CCCCcccccc
Q psy13111 2 SSYAHSDQCQ 11 (127)
Q Consensus 2 ~tlshrDmar 11 (127)
+||+|||+||
T Consensus 200 stmsHRdIAr 209 (307)
T PF10481_consen 200 STMSHRDIAR 209 (307)
T ss_pred ccccHHHHHH
Confidence 6999999997
No 5
>KOG0907|consensus
Probab=36.73 E-value=11 Score=26.88 Aligned_cols=10 Identities=40% Similarity=1.069 Sum_probs=8.2
Q ss_pred cchhhhcccc
Q psy13111 109 RDLWCTQCKW 118 (127)
Q Consensus 109 ~~~WC~~Cr~ 118 (127)
.-.||.+||-
T Consensus 29 ~a~wCgPCk~ 38 (106)
T KOG0907|consen 29 YATWCGPCKA 38 (106)
T ss_pred ECCCCcchhh
Confidence 4689999985
No 6
>PF03605 DcuA_DcuB: Anaerobic c4-dicarboxylate membrane transporter; InterPro: IPR004668 These proteins are members of the C4-Dicarboxylate Uptake (Dcu) family. Most proteins in this family are predicted to have 12 GES predicted transmembrane regions; however the one member whose membrane topology has been experimentally determined has 10 transmembrane regions, with both the N- and C-termini localized to the periplasm []. The DcuA and DcuB proteins are involved in the transport of aspartate, malate, fumarate and succinate in many species [, , ], and are thought to function as antiporters with any two of these substrates. Since DcuA is encoded in an operon with the gene for aspartase, and DcuB is encoded in an operon with the gene for fumarase, their physiological functions may be to catalyze aspartate:fumarate and fumarate:malate exchange during the anaerobic utilization of aspartate and fumarate, respectively []. The Escherichia coli DcuA and DcuB proteins have very different expression patterns []. DcuA is constitutively expressed; DcuB is strongly induced anaerobically by FNR and C4-dicarboxylates, while it is repressed by nitrate and subject to CRP-mediated catabolite repression.; GO: 0015556 C4-dicarboxylate transmembrane transporter activity, 0015740 C4-dicarboxylate transport, 0016021 integral to membrane
Probab=36.73 E-value=17 Score=32.23 Aligned_cols=13 Identities=46% Similarity=0.736 Sum_probs=10.8
Q ss_pred CCChHHHHhhhcC
Q psy13111 14 RVDPEYQKNLSKP 26 (127)
Q Consensus 14 heDPeyq~~l~~~ 26 (127)
.+|||||+.+..+
T Consensus 192 ~~Dp~yq~rl~~g 204 (364)
T PF03605_consen 192 DDDPEYQERLADG 204 (364)
T ss_pred ccCHHHHHHHhcc
Confidence 6899999998743
No 7
>PHA02278 thioredoxin-like protein
Probab=35.31 E-value=12 Score=26.30 Aligned_cols=10 Identities=20% Similarity=0.468 Sum_probs=7.9
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
--||.+||.-
T Consensus 23 A~WCgpCk~m 32 (103)
T PHA02278 23 QDNCGKCEIL 32 (103)
T ss_pred CCCCHHHHhH
Confidence 4699999953
No 8
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif. CDSP32 is a stress-inducible TRX, i.e., it acts as a TRX by reducing protein disulfides and is induced by environmental and oxidative stress conditions. It plays a critical role in plastid defense against oxidative damage, a role related to its function as a physiological electron donor to BAS1, a plastidic 2-cys peroxiredoxin. Plants lacking CDSP32 exhibit decreased photosystem II photochemical efficiencies and chlorophyll retention compared to WT controls, as well as an increased proportion of BAS1 in its overoxidized monomeric form.
Probab=35.06 E-value=12 Score=25.25 Aligned_cols=9 Identities=0% Similarity=-0.484 Sum_probs=7.1
Q ss_pred chhhhcccc
Q psy13111 110 DLWCTQCKW 118 (127)
Q Consensus 110 ~~WC~~Cr~ 118 (127)
-.||.+|+.
T Consensus 24 a~wC~~C~~ 32 (103)
T cd02985 24 LKHSGPSVK 32 (103)
T ss_pred CCCCHhHHH
Confidence 359999985
No 9
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1. TRP14 catalyzes the reduction of small disulfide-containing peptides but does not reduce disulfides of ribonucleotide reductase, peroxiredoxin and methionine sulfoxide reductase, which are TRX1 substrates. TRP14 also plays a role in tumor necrosis factor (TNF)-alpha signaling pathways, distinct from that of TRX1. Its depletion promoted TNF-alpha induced activation of c-Jun N-terminal kinase and mitogen-activated protein kinases.
Probab=31.27 E-value=17 Score=26.67 Aligned_cols=12 Identities=25% Similarity=0.855 Sum_probs=9.3
Q ss_pred ccchhhhccccc
Q psy13111 108 HRDLWCTQCKWK 119 (127)
Q Consensus 108 ~~~~WC~~Cr~K 119 (127)
..+.||.+||.-
T Consensus 35 ~~~~WC~pCr~~ 46 (119)
T cd02952 35 DGQSWCPDCVKA 46 (119)
T ss_pred CCCCCCHhHHhh
Confidence 456899999954
No 10
>KOG1435|consensus
Probab=31.19 E-value=13 Score=33.74 Aligned_cols=27 Identities=22% Similarity=0.729 Sum_probs=19.3
Q ss_pred cCCCCcchhhhhhcccccchhhhccccc
Q psy13111 92 KVRGDSKKCRKVYGMEHRDLWCTQCKWK 119 (127)
Q Consensus 92 ~~r~~~KKCR~~yGm~~~~~WC~~Cr~K 119 (127)
|...|+.|||+.||-+=+ .-|++|+..
T Consensus 396 R~~RDe~rC~~KYG~~W~-~Yc~~Vpyr 422 (428)
T KOG1435|consen 396 RAARDEHRCRSKYGEDWE-EYCRKVPYR 422 (428)
T ss_pred HHhhhHHHHHHHHhhhHH-HHHhhCCcc
Confidence 345566999999998544 448887753
No 11
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase.
Probab=31.16 E-value=15 Score=24.43 Aligned_cols=13 Identities=31% Similarity=0.810 Sum_probs=9.3
Q ss_pred ccchhhhcccccc
Q psy13111 108 HRDLWCTQCKWKK 120 (127)
Q Consensus 108 ~~~~WC~~Cr~KK 120 (127)
--..||.+||.-.
T Consensus 22 f~a~wC~~C~~~~ 34 (104)
T cd03000 22 FYAPWCGHCKKLE 34 (104)
T ss_pred EECCCCHHHHhhC
Confidence 3457999998643
No 12
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which
Probab=30.24 E-value=16 Score=24.54 Aligned_cols=10 Identities=40% Similarity=1.062 Sum_probs=7.6
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
--||.+|+.-
T Consensus 26 a~wC~~Ck~~ 35 (102)
T cd02948 26 QEWCGPCKAV 35 (102)
T ss_pred CCcCHhHHHH
Confidence 4699999853
No 13
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]
Probab=30.09 E-value=16 Score=21.70 Aligned_cols=10 Identities=30% Similarity=1.159 Sum_probs=8.4
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||..|++-
T Consensus 41 ~~~C~~C~~~ 50 (127)
T COG0526 41 APWCPPCRAE 50 (127)
T ss_pred cCcCHHHHhh
Confidence 7899999874
No 14
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER.
Probab=30.07 E-value=16 Score=24.85 Aligned_cols=11 Identities=18% Similarity=0.504 Sum_probs=8.2
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
..||.+|+.-.
T Consensus 27 a~WC~~C~~~~ 37 (100)
T cd02999 27 ASWCPFSASFR 37 (100)
T ss_pred CCCCHHHHhHh
Confidence 46999998643
No 15
>PF13451 zf-trcl: Probable zinc-binding domain
Probab=28.49 E-value=18 Score=23.67 Aligned_cols=18 Identities=17% Similarity=0.578 Sum_probs=14.4
Q ss_pred hcccccchhhhccccccc
Q psy13111 104 YGMEHRDLWCTQCKWKKA 121 (127)
Q Consensus 104 yGm~~~~~WC~~Cr~KK~ 121 (127)
-|+++.-..|..||.+++
T Consensus 27 Kgf~n~p~RC~~CR~~rk 44 (49)
T PF13451_consen 27 KGFDNEPKRCPSCRQARK 44 (49)
T ss_pred cCCcCCCccCHHHHHHHH
Confidence 366778888999998875
No 16
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=28.10 E-value=18 Score=23.21 Aligned_cols=11 Identities=9% Similarity=-0.266 Sum_probs=8.1
Q ss_pred cchhhhccccc
Q psy13111 109 RDLWCTQCKWK 119 (127)
Q Consensus 109 ~~~WC~~Cr~K 119 (127)
-.-||.+|+.-
T Consensus 20 ~a~wC~~C~~~ 30 (96)
T cd02956 20 WAPRSPPSKEL 30 (96)
T ss_pred ECCCChHHHHH
Confidence 34699999854
No 17
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain. Denaturation studies indicate that the reduced form is more stable than the oxidized form, suggesting that the protein is involved in disulfide bond formation. In vitro, ERp19 has been shown to possess thiol-disulfide oxidase activity which is dependent on the presence of both active site cysteines. Although described as protein disulfide isomerase (PDI)-like, the protein does not complement for PDI activity. ERp19 shows a wide tissue distribution but is most abundant in liver, testis, heart and kidney.
Probab=28.07 E-value=18 Score=25.60 Aligned_cols=11 Identities=45% Similarity=1.084 Sum_probs=8.3
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
-.||.+|+.-+
T Consensus 28 a~WC~~C~~~~ 38 (117)
T cd02959 28 KTWCGACKALK 38 (117)
T ss_pred CCcCHHHHHHH
Confidence 47999998643
No 18
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=27.16 E-value=19 Score=23.02 Aligned_cols=11 Identities=36% Similarity=1.023 Sum_probs=8.3
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
..||.+|+..+
T Consensus 25 a~wC~~C~~~~ 35 (102)
T cd03005 25 APWCGHCKRLA 35 (102)
T ss_pred CCCCHHHHHhC
Confidence 45999998653
No 19
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=27.12 E-value=19 Score=23.01 Aligned_cols=10 Identities=40% Similarity=1.099 Sum_probs=7.4
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||..|+.-
T Consensus 26 a~wC~~C~~~ 35 (104)
T cd02997 26 APWCGHCKKM 35 (104)
T ss_pred CCCCHHHHHh
Confidence 3599999853
No 20
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein. It is a component of U5 snRNP, which pre-assembles with U4/U6 snRNPs to form a [U4/U6:U5] tri-snRNP complex required for pre-mRNA splicing. Dim1 interacts with multiple splicing-associated proteins, suggesting that it functions at multiple control points in the splicing of pre-mRNA as part of a large spliceosomal complex involving many protein-protein interactions. U5 snRNP contains seven core proteins (common to all snRNPs) and nine U5-specific proteins, one of which is Dim1. Dim1 adopts a thioredoxin fold but does not contain the redox active CXXC motif. It is essential for G2/M phase transition, as a consequence to its role in pre-mRNA splicing.
Probab=26.71 E-value=20 Score=26.30 Aligned_cols=9 Identities=22% Similarity=0.471 Sum_probs=7.5
Q ss_pred chhhhcccc
Q psy13111 110 DLWCTQCKW 118 (127)
Q Consensus 110 ~~WC~~Cr~ 118 (127)
-.||.+||.
T Consensus 23 A~WCgpCk~ 31 (114)
T cd02954 23 RDWDPVCMQ 31 (114)
T ss_pred CCCChhHHH
Confidence 469999985
No 21
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC.
Probab=26.38 E-value=20 Score=23.31 Aligned_cols=13 Identities=31% Similarity=0.961 Sum_probs=9.2
Q ss_pred ccccchhhhcccc
Q psy13111 106 MEHRDLWCTQCKW 118 (127)
Q Consensus 106 m~~~~~WC~~Cr~ 118 (127)
++=-..||.+|+.
T Consensus 21 v~f~a~wC~~C~~ 33 (101)
T cd02994 21 IEFYAPWCPACQQ 33 (101)
T ss_pred EEEECCCCHHHHH
Confidence 3444569999985
No 22
>PF01222 ERG4_ERG24: Ergosterol biosynthesis ERG4/ERG24 family; InterPro: IPR001171 The two fungal enzymes, C-14 sterol reductase (gene ERG24 in budding yeast and erg3 in Neurospora crassa) and C-24(28) sterol reductase (gene ERG4 in budding yeast and sts1 in fission yeast), are involved in ergosterol biosynthesis. They act by reducing double bonds in precursors of ergosterol []. These proteins are highly hydrophobic and seem to contain seven or eight transmembrane regions. Chicken lamin B receptor that is thought to anchor the lamina to the inner nuclear membrane belongs to this family.; GO: 0016020 membrane
Probab=26.30 E-value=15 Score=32.43 Aligned_cols=24 Identities=42% Similarity=0.901 Sum_probs=17.4
Q ss_pred CcCCCCcchhhhhhcccccchhhhcccc
Q psy13111 91 RKVRGDSKKCRKVYGMEHRDLWCTQCKW 118 (127)
Q Consensus 91 ~~~r~~~KKCR~~yGm~~~~~WC~~Cr~ 118 (127)
-|...|.+||++.||= .|-..|++
T Consensus 399 hR~~RD~~rC~~KYG~----~W~~Yc~~ 422 (432)
T PF01222_consen 399 HRARRDEERCRKKYGK----DWDEYCKR 422 (432)
T ss_pred hhHHHHHHHHHHhhCH----HHHHHHHh
Confidence 4557889999999994 45555543
No 23
>PF01586 Basic: Myogenic Basic domain; InterPro: IPR002546 This basic domain is found in the MyoD family of muscle specific proteins that control muscle development. The bHLH region of the MyoD family includes the basic domain and the Helix-loop-helix (HLH) motif. The bHLH region mediates specific DNA binding []. With 12 residues of the basic domain involved in DNA binding []. The basic domain forms an extended alpha helix in the structure.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007517 muscle organ development, 0005634 nucleus; PDB: 1MDY_C.
Probab=25.31 E-value=24 Score=25.56 Aligned_cols=11 Identities=55% Similarity=1.395 Sum_probs=1.3
Q ss_pred hh-hhccccccc
Q psy13111 111 LW-CTQCKWKKA 121 (127)
Q Consensus 111 ~W-C~~Cr~KK~ 121 (127)
+| |++|+||..
T Consensus 72 ~WACKaCKRKt~ 83 (86)
T PF01586_consen 72 LWACKACKRKTV 83 (86)
T ss_dssp -------S---T
T ss_pred HHHhHhhhccCc
Confidence 68 999999853
No 24
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional
Probab=25.16 E-value=45 Score=25.09 Aligned_cols=21 Identities=19% Similarity=0.303 Sum_probs=16.6
Q ss_pred cCCCCChHHHHhhhcCccchh
Q psy13111 11 QNGRVDPEYQKNLSKPGLVAT 31 (127)
Q Consensus 11 rPPheDPeyq~~l~~~~~~~~ 31 (127)
-|.|.|+||.+.....++++.
T Consensus 36 nPlh~D~e~A~~~~fg~~iA~ 56 (159)
T PRK13692 36 DAAYFEEDAAAELGYKGLLAP 56 (159)
T ss_pred CCCccCHHHHHhcCCCCcccC
Confidence 589999999998876666553
No 25
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha). DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=25.05 E-value=22 Score=23.38 Aligned_cols=11 Identities=36% Similarity=1.075 Sum_probs=8.3
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
-.||.+|+.-+
T Consensus 20 a~wC~~C~~~~ 30 (104)
T cd02953 20 ADWCVTCKVNE 30 (104)
T ss_pred cchhHHHHHHH
Confidence 46999998643
No 26
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity.
Probab=24.37 E-value=23 Score=23.09 Aligned_cols=10 Identities=40% Similarity=1.072 Sum_probs=7.6
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||.+|+.-
T Consensus 27 a~wC~~C~~~ 36 (109)
T cd03002 27 APWCGHCKNL 36 (109)
T ss_pred CCCCHHHHhh
Confidence 4599999864
No 27
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A ....
Probab=23.68 E-value=22 Score=23.01 Aligned_cols=12 Identities=33% Similarity=0.850 Sum_probs=9.1
Q ss_pred cchhhhcccccc
Q psy13111 109 RDLWCTQCKWKK 120 (127)
Q Consensus 109 ~~~WC~~Cr~KK 120 (127)
.-.||..|+.-+
T Consensus 25 ~a~wC~~C~~l~ 36 (82)
T PF13899_consen 25 GADWCPPCKKLE 36 (82)
T ss_dssp ETTTTHHHHHHH
T ss_pred ECCCCHhHHHHH
Confidence 357999998754
No 28
>KOG1818|consensus
Probab=23.65 E-value=25 Score=33.24 Aligned_cols=31 Identities=23% Similarity=0.563 Sum_probs=26.1
Q ss_pred CCCcCCCCcchhhhhhcccccchhhhccccc
Q psy13111 89 PTRKVRGDSKKCRKVYGMEHRDLWCTQCKWK 119 (127)
Q Consensus 89 ~~~~~r~~~KKCR~~yGm~~~~~WC~~Cr~K 119 (127)
|..-+..+-.|||+.||+-++.--|..|-++
T Consensus 160 pdW~D~~~C~rCr~~F~~~~rkHHCr~CG~v 190 (634)
T KOG1818|consen 160 PDWIDSEECLRCRVKFGLTNRKHHCRNCGQV 190 (634)
T ss_pred cccccccccceeeeeeeeccccccccccchh
Confidence 3455667889999999999999999999883
No 29
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=23.22 E-value=25 Score=23.00 Aligned_cols=10 Identities=20% Similarity=0.521 Sum_probs=7.8
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||.+|+.-
T Consensus 27 a~wC~~C~~~ 36 (101)
T cd03003 27 SPRCSHCHDL 36 (101)
T ss_pred CCCChHHHHh
Confidence 4799999853
No 30
>KOG0910|consensus
Probab=22.81 E-value=27 Score=27.40 Aligned_cols=9 Identities=44% Similarity=1.295 Sum_probs=7.1
Q ss_pred chhhhcccc
Q psy13111 110 DLWCTQCKW 118 (127)
Q Consensus 110 ~~WC~~Cr~ 118 (127)
-.||.+|+-
T Consensus 70 A~WCgPCk~ 78 (150)
T KOG0910|consen 70 AEWCGPCKM 78 (150)
T ss_pred cCcCccHhH
Confidence 469999973
No 31
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit.
Probab=22.42 E-value=29 Score=22.84 Aligned_cols=9 Identities=33% Similarity=0.593 Sum_probs=7.4
Q ss_pred chhhhcccc
Q psy13111 110 DLWCTQCKW 118 (127)
Q Consensus 110 ~~WC~~Cr~ 118 (127)
..||..|+.
T Consensus 30 ~~wC~~C~~ 38 (114)
T cd02967 30 SPTCPVCKK 38 (114)
T ss_pred CCCCcchHh
Confidence 569999985
No 32
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network.
Probab=22.08 E-value=28 Score=23.79 Aligned_cols=9 Identities=33% Similarity=0.970 Sum_probs=7.3
Q ss_pred hhhhccccc
Q psy13111 111 LWCTQCKWK 119 (127)
Q Consensus 111 ~WC~~Cr~K 119 (127)
.||.+|+.-
T Consensus 34 ~wC~~C~~~ 42 (111)
T cd02963 34 DWCFSCIHI 42 (111)
T ss_pred CccHhHHHh
Confidence 699999854
No 33
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=21.99 E-value=29 Score=26.18 Aligned_cols=10 Identities=20% Similarity=0.428 Sum_probs=7.8
Q ss_pred cchhhhcccc
Q psy13111 109 RDLWCTQCKW 118 (127)
Q Consensus 109 ~~~WC~~Cr~ 118 (127)
=..||.+||.
T Consensus 58 WAsWCppCr~ 67 (153)
T TIGR02738 58 YQSTCPYCHQ 67 (153)
T ss_pred ECCCChhHHH
Confidence 3469999985
No 34
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway. (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit. The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer. A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=21.87 E-value=54 Score=21.86 Aligned_cols=16 Identities=25% Similarity=0.225 Sum_probs=12.5
Q ss_pred cCCCCChHHHHhhhcC
Q psy13111 11 QNGRVDPEYQKNLSKP 26 (127)
Q Consensus 11 rPPheDPeyq~~l~~~ 26 (127)
.|-|.|+||.+....+
T Consensus 29 npiH~D~~~A~~~g~~ 44 (128)
T cd03449 29 NPIHLDEEYAKKTRFG 44 (128)
T ss_pred CCccCCHHHHhhCCCC
Confidence 5889999998875533
No 35
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT contains an N-terminal TRX-like domain, which does not contain the catalytic CXXC motif, followed by one to three glutaredoxin domains. The TRX-like domain is required for interaction with PKC theta. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli.
Probab=20.93 E-value=30 Score=22.07 Aligned_cols=10 Identities=30% Similarity=0.747 Sum_probs=7.6
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||..|+.-
T Consensus 23 ~~~C~~C~~~ 32 (97)
T cd02984 23 APWAEPCKQM 32 (97)
T ss_pred CCCCHHHHHH
Confidence 4699999854
No 36
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=20.89 E-value=30 Score=22.01 Aligned_cols=11 Identities=36% Similarity=0.981 Sum_probs=8.0
Q ss_pred ccchhhhcccc
Q psy13111 108 HRDLWCTQCKW 118 (127)
Q Consensus 108 ~~~~WC~~Cr~ 118 (127)
--..||..|+.
T Consensus 25 f~~~~C~~C~~ 35 (104)
T cd02995 25 FYAPWCGHCKA 35 (104)
T ss_pred EECCCCHHHHH
Confidence 34479999985
No 37
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=20.77 E-value=30 Score=22.61 Aligned_cols=9 Identities=33% Similarity=1.154 Sum_probs=7.1
Q ss_pred chhhhcccc
Q psy13111 110 DLWCTQCKW 118 (127)
Q Consensus 110 ~~WC~~Cr~ 118 (127)
..||.+|+.
T Consensus 28 a~wC~~C~~ 36 (104)
T cd03004 28 APWCGPCQA 36 (104)
T ss_pred CCCCHHHHH
Confidence 359999985
No 38
>PTZ00051 thioredoxin; Provisional
Probab=20.75 E-value=31 Score=22.14 Aligned_cols=10 Identities=40% Similarity=1.076 Sum_probs=7.6
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||..|+.-
T Consensus 27 ~~~C~~C~~~ 36 (98)
T PTZ00051 27 AEWCGPCKRI 36 (98)
T ss_pred CCCCHHHHHH
Confidence 4699999854
No 39
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=20.75 E-value=31 Score=21.92 Aligned_cols=11 Identities=36% Similarity=0.963 Sum_probs=8.1
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
..||..|+.-+
T Consensus 27 a~~C~~C~~~~ 37 (105)
T cd02998 27 APWCGHCKNLA 37 (105)
T ss_pred CCCCHHHHhhC
Confidence 46999998543
No 40
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=20.64 E-value=30 Score=22.14 Aligned_cols=10 Identities=40% Similarity=1.072 Sum_probs=7.7
Q ss_pred chhhhccccc
Q psy13111 110 DLWCTQCKWK 119 (127)
Q Consensus 110 ~~WC~~Cr~K 119 (127)
..||.+|+.-
T Consensus 27 a~~C~~C~~~ 36 (103)
T cd03001 27 APWCGHCKNL 36 (103)
T ss_pred CCCCHHHHHH
Confidence 3699999864
No 41
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=20.32 E-value=29 Score=23.42 Aligned_cols=11 Identities=27% Similarity=0.902 Sum_probs=8.4
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
..||.+|+.-+
T Consensus 30 a~wC~~C~~~~ 40 (109)
T cd02993 30 APWCPFCQAME 40 (109)
T ss_pred CCCCHHHHHHh
Confidence 46999998654
No 42
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=20.03 E-value=32 Score=22.84 Aligned_cols=11 Identities=18% Similarity=0.537 Sum_probs=8.5
Q ss_pred chhhhcccccc
Q psy13111 110 DLWCTQCKWKK 120 (127)
Q Consensus 110 ~~WC~~Cr~KK 120 (127)
..||..|+.-+
T Consensus 27 a~wC~~C~~~~ 37 (108)
T cd02996 27 ADWCRFSQMLH 37 (108)
T ss_pred CCCCHHHHhhH
Confidence 46999998654
Done!