Diaphorina citri psyllid: psy13111

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MSSYAHSDQCQNGRVDPEYQKNLSKPGLVATAIGQNHSAAGPMPIPKVNNYHQTYSPWAFSVPGSSPHSPLKYMKLSYASAPGKLPSSPTRKVRGDSKKCRKVYGMEHRDLWCTQCKWKKACSRFGD
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHccccHHHHHHcccc
***************************************************************************************************CRKVYGMEHRDLWCTQCKWKKACSRFG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYAHSDQCQNGRVDPEYQKNLSKPGLVATAIGQNHSAAGPMPIPKVNNYHQTYSPWAFSVPGSSPHSPLKYMKLSYASAPGKLPSSPTRKVRGDSKKCRKVYGMEHRDLWCTQCKWKKACSRFGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 704 confidentQ1LY51

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted