Diaphorina citri psyllid: psy13121

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
LIEQENASGEADYLLESTPTSLFNSTQQWDYPNAWAPLQAFIIQGLDYTQDKLAKQVAYRLAEKWLFTNYMGYETSKAMFEKYDVELIGKTGNGGEYEAQTGFGWTNGFAFELLNRYGKTISFNNTQGSYYNKIPGSGYLSGYYPSFMSGRPSFMSAG
ccHcHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
********GEADYLLESTPTSLFNSTQQWDYPNAWAPLQAFIIQGLDYTQDKLAKQVAYRLAEKWLFTNYMGYETSKAMFEKYDVELIGKTGNGGEYEAQTGFGWTNGFAFELLNRYGKTISFNNTQGSYYNKIPGSGYLSGYYPS************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LIEQENASGEADYLLESTPTSLFNSTQQWDYPNAWAPLQAFIIQGLDYTQDKLAKQVAYRLAEKWLFTNYMGYETSKAMFEKYDVELIGKTGNGGEYEAQTGFGWTNGFAFELLNRYGKTISFNNTQGSYYNKIPGSGYLSGYYPSFMSGRPSFMSAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trehalase Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.confidentQ9JLT2
Trehalase Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose.confidentO43280
Trehalase confidentA8J4S9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004555 [MF]alpha,alpha-trehalase activityprobableGO:0015927, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004553
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JG0, chain A
Confidence level:very confident
Coverage over the Query: 14-127
View the alignment between query and template
View the model in PyMOL