Query         psy13123
Match_columns 129
No_of_seqs    106 out of 2416
Neff          11.6
Searched_HMMs 46136
Date          Fri Aug 16 20:12:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13123.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13123hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 4.8E-32   1E-36  162.7   5.2  107   14-122   159-265 (279)
  2 KOG2462|consensus              100.0   7E-31 1.5E-35  157.7   5.2  114   14-129   128-244 (279)
  3 KOG3576|consensus               99.8 2.4E-21 5.2E-26  112.4   2.6  118   11-128   112-240 (267)
  4 KOG1074|consensus               99.8   9E-21 1.9E-25  128.5   0.7   56   73-128   880-935 (958)
  5 KOG1074|consensus               99.8 5.1E-20 1.1E-24  124.9   1.3   56   73-128   606-661 (958)
  6 KOG3608|consensus               99.7 3.3E-18 7.1E-23  106.8   4.5  119    4-124   195-316 (467)
  7 KOG3623|consensus               99.7 2.8E-17   6E-22  110.8   2.7   79   42-120   892-970 (1007)
  8 KOG3623|consensus               99.6 2.5E-16 5.5E-21  106.2   3.5   85    9-93    887-971 (1007)
  9 KOG3608|consensus               99.6 9.8E-16 2.1E-20   95.9   5.8  110   18-129   181-293 (467)
 10 KOG3576|consensus               99.6 1.1E-16 2.4E-21   93.2   1.4   83   42-124   115-197 (267)
 11 PLN03086 PRLI-interacting fact  99.4 1.4E-12   3E-17   87.7   7.5  102   14-122   451-562 (567)
 12 PHA00733 hypothetical protein   99.4 5.4E-13 1.2E-17   74.3   3.9   83   41-125    37-124 (128)
 13 PHA02768 hypothetical protein;  99.1 2.4E-11 5.1E-16   56.9   1.7   43   72-116     5-47  (55)
 14 PLN03086 PRLI-interacting fact  99.0   7E-10 1.5E-14   75.0   6.5   80   43-128   452-541 (567)
 15 PHA02768 hypothetical protein;  99.0 1.2E-10 2.6E-15   54.6   1.7   42   17-60      6-47  (55)
 16 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.6E-10 5.6E-15   46.0   2.1   25   87-111     1-25  (26)
 17 PHA00616 hypothetical protein   99.0 2.9E-10 6.3E-15   50.8   1.9   30  100-129     1-30  (44)
 18 PHA00733 hypothetical protein   99.0 1.1E-09 2.5E-14   61.1   4.2   94    2-97     26-124 (128)
 19 PHA00616 hypothetical protein   98.8 4.6E-09   1E-13   47.0   1.9   34   16-49      1-34  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.7   2E-08 4.3E-13   40.4   2.6   23   60-82      2-24  (26)
 21 KOG3993|consensus               98.5 1.9E-08 4.2E-13   65.1   0.4  107   16-122   295-480 (500)
 22 PHA00732 hypothetical protein   98.5 1.2E-07 2.6E-12   48.5   2.4   37   44-83      1-38  (79)
 23 PF00096 zf-C2H2:  Zinc finger,  98.5 1.4E-07   3E-12   36.8   1.8   23  101-123     1-23  (23)
 24 KOG3993|consensus               98.4 5.5E-08 1.2E-12   63.1   0.1  108   17-124   268-380 (500)
 25 PHA00732 hypothetical protein   98.4 2.2E-07 4.7E-12   47.5   2.1   48   16-69      1-49  (79)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2   1E-06 2.2E-11   34.2   1.7   23   17-39      1-23  (23)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.2   1E-06 2.2E-11   35.7   1.3   25  100-124     1-25  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.3E-06   5E-11   33.4   2.2   24  101-124     1-24  (24)
 29 PF05605 zf-Di19:  Drought indu  98.1 1.1E-05 2.4E-10   38.3   4.4   49   73-124     3-53  (54)
 30 PF05605 zf-Di19:  Drought indu  98.0 2.4E-05 5.1E-10   37.2   4.7   47   17-66      3-51  (54)
 31 PF09237 GAGA:  GAGA factor;  I  97.9 1.5E-05 3.3E-10   36.6   2.6   33   96-128    20-52  (54)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.9   6E-06 1.3E-10   33.3   1.2   25   16-40      1-25  (27)
 33 smart00355 ZnF_C2H2 zinc finge  97.9 1.7E-05 3.6E-10   31.4   2.5   24  101-124     1-24  (26)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.6E-05 3.5E-10   30.9   2.0   23   17-39      1-23  (24)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.6E-05 3.5E-10   42.4   2.4   73   18-95      1-73  (100)
 36 PF09237 GAGA:  GAGA factor;  I  97.7  0.0001 2.3E-09   33.9   3.3   33   12-44     20-52  (54)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.6 5.4E-05 1.2E-09   40.4   2.7   73   46-123     1-73  (100)
 38 smart00355 ZnF_C2H2 zinc finge  97.4 0.00016 3.5E-09   28.3   2.3   23   17-39      1-23  (26)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.4 0.00021 4.5E-09   27.9   2.1   23  101-124     1-23  (24)
 40 PF12874 zf-met:  Zinc-finger o  97.3 0.00015 3.2E-09   28.5   1.2   23  101-123     1-23  (25)
 41 COG5189 SFP1 Putative transcri  97.2 7.7E-05 1.7E-09   47.4   0.2   51   70-120   347-418 (423)
 42 PRK04860 hypothetical protein;  97.2 0.00027 5.9E-09   41.1   2.4   38   72-113   119-156 (160)
 43 COG5189 SFP1 Putative transcri  97.2 0.00015 3.3E-09   46.1   0.9   70   14-93    347-419 (423)
 44 PF12874 zf-met:  Zinc-finger o  97.0 0.00039 8.4E-09   27.3   1.1   22   17-38      1-22  (25)
 45 PRK04860 hypothetical protein;  97.0  0.0004 8.6E-09   40.5   1.4   25   58-82    129-153 (160)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00087 1.9E-08   26.0   1.5   23   17-40      1-23  (24)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00054 1.2E-08   27.5   0.1   22  101-122     2-23  (27)
 48 TIGR00622 ssl1 transcription f  96.5  0.0037 8.1E-08   34.1   2.8   80   43-124    14-105 (112)
 49 PF13913 zf-C2HC_2:  zinc-finge  96.1  0.0076 1.7E-07   23.7   2.1   21  101-122     3-23  (25)
 50 smart00451 ZnF_U1 U1-like zinc  95.6   0.012 2.5E-07   24.9   1.7   23  100-122     3-25  (35)
 51 KOG1146|consensus               95.4  0.0075 1.6E-07   45.5   1.3   80   11-93    460-539 (1406)
 52 KOG2893|consensus               94.6  0.0079 1.7E-07   37.1  -0.4   41   75-119    13-53  (341)
 53 cd00350 rubredoxin_like Rubred  94.5   0.028   6E-07   23.7   1.3   10   73-82      2-11  (33)
 54 KOG2785|consensus               94.0    0.41 8.8E-06   31.9   6.3   51   72-122   166-242 (390)
 55 COG4049 Uncharacterized protei  93.7   0.038 8.2E-07   26.0   1.1   23   98-120    15-37  (65)
 56 PF12013 DUF3505:  Protein of u  93.5    0.29 6.2E-06   26.7   4.4   25  101-125    81-109 (109)
 57 KOG2231|consensus               93.3    0.22 4.8E-06   35.7   4.6   95   24-123   122-235 (669)
 58 TIGR00622 ssl1 transcription f  92.9    0.15 3.2E-06   28.0   2.7   85   15-107    14-110 (112)
 59 PF13719 zinc_ribbon_5:  zinc-r  92.9   0.097 2.1E-06   22.6   1.7   32   74-110     4-35  (37)
 60 cd00729 rubredoxin_SM Rubredox  91.7    0.12 2.7E-06   21.9   1.2   25   72-108     2-26  (34)
 61 PF13717 zinc_ribbon_4:  zinc-r  91.6    0.17 3.7E-06   21.7   1.6   33   73-110     3-35  (36)
 62 COG5048 FOG: Zn-finger [Genera  91.6   0.025 5.4E-07   37.9  -1.6   56   72-127   289-350 (467)
 63 TIGR02098 MJ0042_CXXC MJ0042 f  91.2    0.16 3.5E-06   21.9   1.4   14   73-86      3-16  (38)
 64 KOG2231|consensus               90.7    0.58 1.3E-05   33.7   4.2   79   47-126   118-208 (669)
 65 smart00614 ZnF_BED BED zinc fi  90.2    0.24 5.2E-06   22.9   1.5   23  101-123    19-47  (50)
 66 PF02892 zf-BED:  BED zinc fing  90.0     0.3 6.5E-06   21.9   1.8   25   97-121    13-41  (45)
 67 PF09538 FYDLN_acid:  Protein o  90.0    0.16 3.6E-06   27.7   1.0   29   18-57     11-39  (108)
 68 COG1592 Rubrerythrin [Energy p  89.5    0.22 4.8E-06   29.4   1.3   10   44-53    134-143 (166)
 69 KOG2482|consensus               89.5    0.58 1.3E-05   30.9   3.2  103   17-121   196-355 (423)
 70 COG2888 Predicted Zn-ribbon RN  88.8    0.21 4.6E-06   23.9   0.7   49   17-80     10-58  (61)
 71 TIGR00373 conserved hypothetic  88.6     0.6 1.3E-05   27.4   2.7   33   41-82    106-138 (158)
 72 KOG1146|consensus               88.5   0.097 2.1E-06   40.0  -0.7   23   99-122  1328-1350(1406)
 73 KOG2186|consensus               88.4    0.29 6.3E-06   30.8   1.4   48   44-94      3-50  (276)
 74 COG5048 FOG: Zn-finger [Genera  88.4   0.068 1.5E-06   35.8  -1.5   57   16-72    289-351 (467)
 75 smart00531 TFIIE Transcription  87.0       1 2.2E-05   26.1   3.0   38   41-82     96-133 (147)
 76 smart00734 ZnF_Rad18 Rad18-lik  86.7    0.83 1.8E-05   18.0   1.8   19  102-121     3-21  (26)
 77 KOG2186|consensus               86.7    0.36 7.7E-06   30.4   1.0   49   17-68      4-52  (276)
 78 PRK06266 transcription initiat  86.6    0.67 1.5E-05   27.8   2.2   34   41-83    114-147 (178)
 79 TIGR02605 CxxC_CxxC_SSSS putat  86.3    0.16 3.5E-06   23.6  -0.5   12   17-28      6-17  (52)
 80 PF09986 DUF2225:  Uncharacteri  86.3   0.084 1.8E-06   32.5  -1.8   21   14-34      3-23  (214)
 81 PRK14890 putative Zn-ribbon RN  86.0    0.84 1.8E-05   22.0   1.9    9   99-107    47-55  (59)
 82 TIGR00373 conserved hypothetic  85.6     1.2 2.7E-05   26.1   2.9   35   67-110   104-138 (158)
 83 PRK00398 rpoP DNA-directed RNA  85.4    0.33 7.1E-06   22.0   0.3   10   17-26      4-13  (46)
 84 PF05443 ROS_MUCR:  ROS/MUCR tr  85.1     0.5 1.1E-05   26.9   1.0   24  100-126    72-95  (132)
 85 PF13878 zf-C2H2_3:  zinc-finge  85.0     1.7 3.7E-05   19.2   2.5   23   17-39     14-38  (41)
 86 smart00834 CxxC_CXXC_SSSS Puta  84.9    0.19 4.1E-06   22.0  -0.6   30   16-52      5-34  (41)
 87 KOG2593|consensus               84.5    0.33 7.2E-06   32.9   0.2   39   11-52    123-161 (436)
 88 PF04959 ARS2:  Arsenite-resist  84.3    0.49 1.1E-05   29.2   0.9   23   72-94     77-99  (214)
 89 KOG4173|consensus               83.7     1.2 2.6E-05   27.2   2.3   74   45-121    80-167 (253)
 90 smart00659 RPOLCX RNA polymera  82.7    0.74 1.6E-05   20.8   0.9   11   17-27      3-13  (44)
 91 KOG2482|consensus               82.6     2.5 5.4E-05   28.1   3.5   53   16-68    144-219 (423)
 92 COG5236 Uncharacterized conser  82.4     1.5 3.3E-05   29.1   2.5   20  103-122   223-242 (493)
 93 PRK00464 nrdR transcriptional   81.2    0.23 4.9E-06   29.0  -1.3   12   73-84     29-40  (154)
 94 TIGR02300 FYDLN_acid conserved  80.8    0.95 2.1E-05   25.4   1.1   30   17-57     10-39  (129)
 95 COG3357 Predicted transcriptio  79.0     1.2 2.5E-05   23.5   1.0   14   43-56     57-70  (97)
 96 PF06524 NOA36:  NOA36 protein;  77.2    0.88 1.9E-05   28.9   0.3   26   98-123   207-232 (314)
 97 PF15269 zf-C2H2_7:  Zinc-finge  76.5     2.2 4.8E-05   19.2   1.4   22  101-122    21-42  (54)
 98 KOG4167|consensus               76.2    0.87 1.9E-05   33.2   0.1   28   14-41    790-817 (907)
 99 KOG2785|consensus               75.8     5.9 0.00013   26.8   3.7   52   43-94    165-242 (390)
100 PRK03824 hypA hydrogenase nick  75.3       1 2.2E-05   25.7   0.2   14   72-85     70-83  (135)
101 PF08790 zf-LYAR:  LYAR-type C2  75.2    0.29 6.2E-06   19.8  -1.5    9  102-110     2-10  (28)
102 PF07754 DUF1610:  Domain of un  75.2     1.2 2.5E-05   17.3   0.3    9   16-24     16-24  (24)
103 PF10571 UPF0547:  Uncharacteri  75.1     1.6 3.4E-05   17.3   0.6   10  102-111    16-25  (26)
104 PRK03564 formate dehydrogenase  74.9    0.45 9.7E-06   31.1  -1.5   72   15-108   186-260 (309)
105 PF12013 DUF3505:  Protein of u  74.5     8.6 0.00019   20.9   3.7   24   17-40     81-108 (109)
106 PHA00626 hypothetical protein   74.0     1.8 3.9E-05   20.6   0.8   15   99-113    22-36  (59)
107 PF09845 DUF2072:  Zn-ribbon co  73.8     1.1 2.4E-05   25.4   0.0   28   16-53      1-28  (131)
108 COG1996 RPC10 DNA-directed RNA  73.6       2 4.3E-05   19.9   0.9   10   73-82      7-16  (49)
109 COG1997 RPL43A Ribosomal prote  72.8     1.5 3.2E-05   22.9   0.4   34   43-86     34-67  (89)
110 PRK04023 DNA polymerase II lar  72.5     4.4 9.5E-05   31.1   2.8    9  101-109   664-672 (1121)
111 KOG2807|consensus               72.0     4.5 9.9E-05   26.8   2.5   24  100-123   345-368 (378)
112 PRK09678 DNA-binding transcrip  71.9     1.2 2.5E-05   22.5  -0.1   15   70-84     25-41  (72)
113 KOG4173|consensus               71.9     2.6 5.7E-05   25.9   1.3   48   18-65    108-167 (253)
114 KOG3408|consensus               71.4     4.2   9E-05   22.7   1.9   29   10-38     51-79  (129)
115 PF08274 PhnA_Zn_Ribbon:  PhnA   68.8     1.5 3.3E-05   18.0  -0.1    7   73-79     20-26  (30)
116 PF07975 C1_4:  TFIIH C1-like d  68.3    0.88 1.9E-05   21.3  -0.9   24   16-39     21-44  (51)
117 PF09723 Zn-ribbon_8:  Zinc rib  68.1       2 4.4E-05   19.0   0.3   12  101-112     6-17  (42)
118 PF13453 zf-TFIIB:  Transcripti  67.0       2 4.3E-05   18.8   0.1   15   45-59     20-34  (41)
119 PF05191 ADK_lid:  Adenylate ki  66.6     1.1 2.3E-05   19.3  -0.8    9   18-26      3-11  (36)
120 KOG4167|consensus               66.5     1.4 3.1E-05   32.2  -0.6   25  100-124   792-816 (907)
121 PF03604 DNA_RNApol_7kD:  DNA d  65.7       4 8.6E-05   17.0   0.9    9  100-108    17-25  (32)
122 COG1198 PriA Primosomal protei  64.7     2.3 4.9E-05   31.4   0.1   12   18-29    437-448 (730)
123 PF02176 zf-TRAF:  TRAF-type zi  64.6     5.2 0.00011   18.9   1.3   25   86-110    24-52  (60)
124 COG5151 SSL1 RNA polymerase II  64.5     8.9 0.00019   25.3   2.6   78   44-123   322-411 (421)
125 cd00924 Cyt_c_Oxidase_Vb Cytoc  63.6       3 6.4E-05   22.4   0.4   17   11-28     75-91  (97)
126 COG1655 Uncharacterized protei  63.2     1.3 2.7E-05   27.7  -1.1   24   16-39     19-42  (267)
127 PLN02294 cytochrome c oxidase   63.1     3.2 6.9E-05   24.7   0.5   16   14-29    139-154 (174)
128 PF07282 OrfB_Zn_ribbon:  Putat  62.2     7.1 0.00015   19.1   1.6   10  100-109    46-55  (69)
129 KOG2893|consensus               62.1     2.1 4.7E-05   26.9  -0.3   47   14-65      9-55  (341)
130 PF14446 Prok-RING_1:  Prokaryo  62.0     1.3 2.8E-05   21.0  -1.0   11   18-28      7-17  (54)
131 smart00154 ZnF_AN1 AN1-like Zi  61.9     3.5 7.5E-05   18.0   0.4   14   16-29     12-25  (39)
132 COG5236 Uncharacterized conser  61.6      42 0.00091   22.8   5.3   73   18-95    222-304 (493)
133 TIGR01562 FdhE formate dehydro  61.6       2 4.3E-05   28.2  -0.5   48   17-80    185-232 (305)
134 PF05290 Baculo_IE-1:  Baculovi  60.5      11 0.00024   21.6   2.2   15   41-55     77-91  (140)
135 PF04959 ARS2:  Arsenite-resist  60.2     4.8  0.0001   25.0   0.9   25   45-69     78-102 (214)
136 TIGR01206 lysW lysine biosynth  60.0     3.7   8E-05   19.5   0.3   10   73-82      3-12  (54)
137 KOG2923|consensus               59.5     5.9 0.00013   19.4   1.0   12   41-52     41-52  (67)
138 KOG2807|consensus               58.9      13 0.00027   24.8   2.6   30   72-107   345-374 (378)
139 KOG2593|consensus               57.3      16 0.00036   25.3   3.0   38   40-80    124-161 (436)
140 COG2331 Uncharacterized protei  56.4       7 0.00015   19.9   1.0   32   15-53     11-42  (82)
141 KOG1280|consensus               56.2      12 0.00026   25.1   2.2   22   16-37     79-100 (381)
142 PF01927 Mut7-C:  Mut7-C RNAse   56.2     7.7 0.00017   22.4   1.3   49   73-121    92-145 (147)
143 KOG0978|consensus               56.0     2.2 4.7E-05   31.2  -1.2   15  102-116   680-694 (698)
144 PF12760 Zn_Tnp_IS1595:  Transp  55.2      12 0.00026   16.8   1.6   10   99-108    36-45  (46)
145 PTZ00255 60S ribosomal protein  54.5     3.3 7.2E-05   21.9  -0.4   34   43-86     35-68  (90)
146 COG4530 Uncharacterized protei  54.2     6.9 0.00015   21.5   0.8   26   18-54     11-36  (129)
147 smart00661 RPOL9 RNA polymeras  54.0       8 0.00017   17.7   0.9   11   72-82     20-30  (52)
148 COG3364 Zn-ribbon containing p  53.8     8.7 0.00019   20.8   1.1   14   16-29      2-15  (112)
149 PRK14714 DNA polymerase II lar  52.9      18 0.00038   28.9   2.9   10   72-81    692-701 (1337)
150 PF01428 zf-AN1:  AN1-like Zinc  52.0     4.7  0.0001   17.9  -0.0   15   15-29     12-26  (43)
151 PF13451 zf-trcl:  Probable zin  51.4     6.4 0.00014   18.3   0.4   13   15-27      3-15  (49)
152 PRK12380 hydrogenase nickel in  51.0     7.4 0.00016   21.5   0.6   11   45-55     71-81  (113)
153 smart00440 ZnF_C2C2 C2C2 Zinc   50.6       1 2.2E-05   19.8  -2.3   10  101-110    29-38  (40)
154 PF12773 DZR:  Double zinc ribb  49.9      16 0.00034   16.5   1.6    8   73-80     30-37  (50)
155 COG3677 Transposase and inacti  49.9     8.6 0.00019   21.8   0.8   36   73-113    31-66  (129)
156 PF14787 zf-CCHC_5:  GAG-polypr  49.6     5.1 0.00011   17.2  -0.1   15  102-116     4-18  (36)
157 COG1656 Uncharacterized conser  49.3      16 0.00035   21.7   1.9   49   73-121    98-151 (165)
158 TIGR00100 hypA hydrogenase nic  49.2     9.1  0.0002   21.2   0.8   12   73-84     71-82  (115)
159 COG1675 TFA1 Transcription ini  49.1      21 0.00046   21.6   2.3   35   39-82    108-142 (176)
160 TIGR00280 L37a ribosomal prote  48.9     3.6 7.7E-05   21.8  -0.7   34   43-86     34-67  (91)
161 PF04216 FdhE:  Protein involve  48.8    0.64 1.4E-05   30.1  -4.3   74   17-108   173-246 (290)
162 PF14311 DUF4379:  Domain of un  48.1      17 0.00037   17.0   1.6   12   73-84     29-40  (55)
163 COG3091 SprT Zn-dependent meta  47.9     8.7 0.00019   22.5   0.6   35   71-110   116-150 (156)
164 COG0068 HypF Hydrogenase matur  46.8     2.3   5E-05   31.1  -2.1   58   45-109   124-182 (750)
165 PF01780 Ribosomal_L37ae:  Ribo  46.6     2.3 4.9E-05   22.5  -1.7   33   43-85     34-66  (90)
166 COG5216 Uncharacterized conser  45.9     9.6 0.00021   18.3   0.5   11   41-51     41-51  (67)
167 TIGR03829 YokU_near_AblA uncha  45.6      15 0.00032   19.5   1.2   17   17-33     36-52  (89)
168 PTZ00043 cytochrome c oxidase   44.9     9.6 0.00021   23.9   0.5   34   13-49    178-211 (268)
169 PRK00432 30S ribosomal protein  44.8      12 0.00026   17.4   0.7   10  100-109    37-46  (50)
170 PF10537 WAC_Acf1_DNA_bd:  ATP-  44.6      53  0.0011   17.9   3.8   41   15-56      2-42  (102)
171 PTZ00448 hypothetical protein;  44.2      21 0.00045   24.3   2.0   23  100-122   314-336 (373)
172 COG1571 Predicted DNA-binding   43.5      17 0.00037   25.2   1.5   11   72-82    367-377 (421)
173 KOG2071|consensus               43.3      19  0.0004   26.1   1.7   28   13-40    415-442 (579)
174 PRK00564 hypA hydrogenase nick  42.8      11 0.00023   21.0   0.4   11   45-55     72-82  (117)
175 TIGR00686 phnA alkylphosphonat  42.3      13 0.00029   20.4   0.8   28   18-56      4-31  (109)
176 PF04423 Rad50_zn_hook:  Rad50   42.2     9.4  0.0002   17.8   0.2   13  102-114    22-34  (54)
177 PF10013 DUF2256:  Uncharacteri  41.8      20 0.00043   16.0   1.1   13  102-114    10-22  (42)
178 COG1773 Rubredoxin [Energy pro  41.7      12 0.00025   17.9   0.4   14   72-85      3-16  (55)
179 PRK03976 rpl37ae 50S ribosomal  41.0     5.1 0.00011   21.2  -0.9   33   43-85     35-67  (90)
180 PHA02998 RNA polymerase subuni  40.8     3.2 6.9E-05   24.9  -1.8   38   73-113   144-184 (195)
181 KOG2907|consensus               40.0     8.6 0.00019   21.2  -0.2    9   45-53    103-111 (116)
182 PF15135 UPF0515:  Uncharacteri  39.9      15 0.00031   23.5   0.8   16   10-25    106-121 (278)
183 PF14122 YokU:  YokU-like prote  39.2      22 0.00047   18.7   1.2   19   15-33     34-52  (87)
184 COG4957 Predicted transcriptio  38.9      21 0.00046   20.5   1.2   25   17-44     77-101 (148)
185 TIGR00244 transcriptional regu  38.7     4.1   9E-05   23.6  -1.6   17   44-60     28-44  (147)
186 PF10276 zf-CHCC:  Zinc-finger   38.6     9.5 0.00021   16.8  -0.1   11   16-26     29-39  (40)
187 PF07295 DUF1451:  Protein of u  38.3      11 0.00023   22.0   0.0    8   45-52    113-120 (146)
188 KOG2636|consensus               38.0      26 0.00057   24.5   1.8   29   92-120   393-422 (497)
189 PRK12496 hypothetical protein;  37.9      24 0.00052   21.0   1.5   10   17-26    128-137 (164)
190 TIGR00595 priA primosomal prot  37.9      23  0.0005   25.2   1.6   10   43-52    252-261 (505)
191 PF14353 CpXC:  CpXC protein     37.8      13 0.00028   20.8   0.3   17   16-32     38-54  (128)
192 cd00730 rubredoxin Rubredoxin;  37.7      13 0.00028   17.3   0.3   12   17-28      2-13  (50)
193 COG1326 Uncharacterized archae  37.1      39 0.00084   20.8   2.2   11   72-82     30-40  (201)
194 KOG3014|consensus               36.9      27 0.00059   22.4   1.6   31   10-40     28-63  (257)
195 PLN02748 tRNA dimethylallyltra  36.6      30 0.00065   24.5   1.9   24   99-122   417-441 (468)
196 COG1327 Predicted transcriptio  36.3     5.8 0.00012   23.2  -1.2   16   44-59     28-43  (156)
197 PF01155 HypA:  Hydrogenase exp  36.2      16 0.00034   20.2   0.5   13   73-85     71-83  (113)
198 PF14369 zf-RING_3:  zinc-finge  36.0      20 0.00044   15.2   0.7   31   16-55      2-32  (35)
199 PF10263 SprT-like:  SprT-like   35.9      14  0.0003   21.4   0.3   32   72-111   123-154 (157)
200 PF04780 DUF629:  Protein of un  35.7      31 0.00067   24.4   1.9   23   17-39     58-80  (466)
201 PF12230 PRP21_like_P:  Pre-mRN  35.3      12 0.00027   23.3   0.0   26   99-125   167-192 (229)
202 PF06397 Desulfoferrod_N:  Desu  35.3      15 0.00032   15.8   0.2   12   15-26      5-16  (36)
203 PRK10220 hypothetical protein;  35.3      24 0.00051   19.5   1.0   29   18-57      5-33  (111)
204 PF12907 zf-met2:  Zinc-binding  34.9      33 0.00072   15.1   1.3   22   17-38      2-26  (40)
205 KOG1842|consensus               34.6      28  0.0006   24.4   1.5   21  101-121    16-36  (505)
206 COG4888 Uncharacterized Zn rib  34.3     4.3 9.2E-05   21.9  -1.8   38   14-55     20-57  (104)
207 PF00301 Rubredoxin:  Rubredoxi  34.2      14  0.0003   16.9   0.1   11   17-27      2-12  (47)
208 PF14803 Nudix_N_2:  Nudix N-te  34.1     2.7 5.9E-05   17.8  -2.1    8   73-80     23-30  (34)
209 KOG1842|consensus               33.7      32  0.0007   24.1   1.7   24   16-39     15-38  (505)
210 PRK03681 hypA hydrogenase nick  33.7      16 0.00034   20.3   0.2   10   73-82     71-80  (114)
211 PF02891 zf-MIZ:  MIZ/SP-RING z  32.2      26 0.00057   16.1   0.8    7  101-107    42-48  (50)
212 TIGR00627 tfb4 transcription f  31.9      38 0.00083   22.2   1.7   11   73-83    256-266 (279)
213 PF09963 DUF2197:  Uncharacteri  31.7      30 0.00065   16.6   1.0   36   18-53      4-40  (56)
214 PF02591 DUF164:  Putative zinc  31.5      56  0.0012   15.3   1.9   11   70-80     44-54  (56)
215 COG1594 RPB9 DNA-directed RNA   31.4       6 0.00013   21.9  -1.6   10   73-82    101-110 (113)
216 PF01286 XPA_N:  XPA protein N-  30.3      21 0.00045   15.2   0.3   12   18-29      5-16  (34)
217 COG1066 Sms Predicted ATP-depe  29.7      30 0.00064   24.2   1.0    9   44-52      7-15  (456)
218 PF10083 DUF2321:  Uncharacteri  29.2      22 0.00048   21.0   0.3   20   96-115    64-83  (158)
219 COG2879 Uncharacterized small   29.0      83  0.0018   15.5   2.4   17  112-128    24-40  (65)
220 COG0675 Transposase and inacti  28.7      35 0.00076   22.3   1.3   15   99-113   321-335 (364)
221 TIGR03831 YgiT_finger YgiT-typ  28.5      22 0.00048   15.5   0.2   13   16-28     32-44  (46)
222 smart00731 SprT SprT homologue  27.8      25 0.00053   20.3   0.4   33   72-111   112-144 (146)
223 PF08792 A2L_zn_ribbon:  A2L zi  27.7      30 0.00065   14.4   0.5   10   17-26     22-31  (33)
224 COG4338 Uncharacterized protei  27.3      27 0.00059   16.1   0.4   12  103-114    15-26  (54)
225 PF11931 DUF3449:  Domain of un  27.3      21 0.00045   22.0   0.0   27   93-119    94-121 (196)
226 PRK04351 hypothetical protein;  27.1      21 0.00045   20.9  -0.0   33   72-112   112-144 (149)
227 cd01121 Sms Sms (bacterial rad  27.0      30 0.00066   23.6   0.7   22   45-80      1-22  (372)
228 PRK11823 DNA repair protein Ra  27.0      34 0.00074   24.0   1.0   24   43-80      6-29  (446)
229 PF01363 FYVE:  FYVE zinc finge  26.9      40 0.00086   16.4   1.0   11   45-55     10-20  (69)
230 PRK14873 primosome assembly pr  26.8      42 0.00091   25.0   1.4   34   18-52    385-418 (665)
231 cd00065 FYVE FYVE domain; Zinc  26.7      53  0.0012   15.1   1.4   10   73-82     19-28  (57)
232 PF11023 DUF2614:  Protein of u  26.4      37  0.0008   18.9   0.8   10   43-52     68-77  (114)
233 TIGR01384 TFS_arch transcripti  26.0      34 0.00073   18.4   0.7   27   46-84      2-28  (104)
234 smart00064 FYVE Protein presen  26.0      48  0.0011   16.0   1.2   11   45-55     11-21  (68)
235 PRK00420 hypothetical protein;  25.9      41  0.0009   18.7   1.0   12   72-83     40-51  (112)
236 PF15616 TerY-C:  TerY-C metal   25.5     7.3 0.00016   22.2  -2.0   13   69-81    102-114 (131)
237 TIGR00416 sms DNA repair prote  25.1      37  0.0008   23.9   0.9   24   43-80      6-29  (454)
238 PF11672 DUF3268:  Protein of u  25.0      26 0.00057   19.1   0.1   11   44-54      2-12  (102)
239 PF08209 Sgf11:  Sgf11 (transcr  25.0      60  0.0013   13.6   1.2    8   46-53      6-13  (33)
240 PRK00762 hypA hydrogenase nick  24.6      28  0.0006   19.6   0.2   11   73-84     71-81  (124)
241 COG4391 Uncharacterized protei  24.6      35 0.00075   16.7   0.5   11   17-27     49-59  (62)
242 smart00647 IBR In Between Ring  24.1      43 0.00094   15.7   0.8   13   99-111    39-51  (64)
243 TIGR00319 desulf_FeS4 desulfof  23.8      32 0.00069   14.2   0.3   12   15-26      6-17  (34)
244 PF10122 Mu-like_Com:  Mu-like   23.6      18 0.00039   16.9  -0.5    7  101-107    25-31  (51)
245 PF13824 zf-Mss51:  Zinc-finger  23.6      46   0.001   15.9   0.8   15   96-110    10-24  (55)
246 cd00974 DSRD Desulforedoxin (D  23.5      32  0.0007   14.2   0.3   11   16-26      4-14  (34)
247 COG4896 Uncharacterized protei  23.5 1.1E+02  0.0024   15.0   2.1   11   43-53     30-40  (68)
248 PF06676 DUF1178:  Protein of u  23.0      62  0.0013   19.0   1.4   16   72-87     32-47  (148)
249 KOG0717|consensus               22.8      55  0.0012   23.2   1.3   22  101-122   293-314 (508)
250 PF01194 RNA_pol_N:  RNA polyme  22.8      56  0.0012   15.9   1.0   16   72-87      4-19  (60)
251 KOG4727|consensus               22.7      57  0.0012   19.7   1.2   22   72-93     75-96  (193)
252 TIGR03830 CxxCG_CxxCG_HTH puta  22.3      73  0.0016   17.5   1.6   21   16-36     31-51  (127)
253 PRK05978 hypothetical protein;  21.7      46   0.001   19.5   0.7    9  102-110    54-62  (148)
254 KOG2857|consensus               21.7      46 0.00099   19.4   0.7   22  100-121    17-38  (157)
255 PF14255 Cys_rich_CPXG:  Cystei  21.6      43 0.00092   15.7   0.5    9  102-110     2-10  (52)
256 PRK08222 hydrogenase 4 subunit  21.6      77  0.0017   19.2   1.7   19   99-117   113-131 (181)
257 COG3880 Modulator of heat shoc  21.5      16 0.00034   21.9  -1.2    9   18-26     76-84  (176)
258 PLN03238 probable histone acet  21.3 1.2E+02  0.0025   20.2   2.4   24   71-94     47-70  (290)
259 PF14690 zf-ISL3:  zinc-finger   21.2      44 0.00096   14.7   0.5    7   17-23      3-9   (47)
260 COG5188 PRP9 Splicing factor 3  21.0      73  0.0016   21.8   1.6   21   17-37    239-259 (470)
261 PF01215 COX5B:  Cytochrome c o  20.9      36 0.00078   19.7   0.2   14   98-111   110-123 (136)
262 PRK05580 primosome assembly pr  20.9      68  0.0015   24.0   1.6   12   42-53    419-430 (679)
263 TIGR00515 accD acetyl-CoA carb  20.5      74  0.0016   21.0   1.5   32   45-85     27-58  (285)
264 PF02748 PyrI_C:  Aspartate car  20.3      50  0.0011   15.5   0.6   17   12-28     31-47  (52)
265 PF13821 DUF4187:  Domain of un  20.3      63  0.0014   15.3   0.9   15  102-116    29-43  (55)
266 PF08271 TF_Zn_Ribbon:  TFIIB z  20.3      42 0.00091   14.7   0.3   11   72-82     19-29  (43)
267 KOG1994|consensus               20.2      69  0.0015   20.4   1.3   23   70-92    237-259 (268)
268 PF01096 TFIIS_C:  Transcriptio  20.0      34 0.00073   14.8  -0.0   10  101-110    29-38  (39)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=4.8e-32  Score=162.69  Aligned_cols=107  Identities=37%  Similarity=0.756  Sum_probs=77.8

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHH
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHID   93 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   93 (129)
                      .+.+.|+.|++.|.....|..|+++|+  .+..|.+||+.|...+.|+.|+++|+||+||.|+.|+++|.+.++|..|++
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            445677777777777777777777775  667777777777777777777777777777777777777777777777777


Q ss_pred             HhcCCCcccCCccccccCCHHHHHHHHHH
Q psy13123         94 AHLGVKKFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus        94 ~~~~~~~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      +|.+.|.|.|..|+|.|...+-|.+|.-.
T Consensus       237 THS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  237 THSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            77777777777777777777777777543


No 2  
>KOG2462|consensus
Probab=99.97  E-value=7e-31  Score=157.73  Aligned_cols=114  Identities=37%  Similarity=0.777  Sum_probs=106.9

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCC---CCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHH
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYG---SSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKR   90 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~---~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~   90 (129)
                      ..-|.|..||+.+.+.++|.+|.++|-.   .+.+.|..|++.|..-..|..|+++|+  .+.+|.+||+.|..++.|+.
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            3448999999999999999999999853   567999999999999999999999998  57899999999999999999


Q ss_pred             HHHHhcCCCcccCCccccccCCHHHHHHHHHHhcccCCC
Q psy13123         91 HIDAHLGVKKFACETCGKLFSSKHGLKYHVRTHKGECKR  129 (129)
Q Consensus        91 h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~e~p~  129 (129)
                      |+++|+|||||.|..|+|+|..+++|+.|++||.+.|+|
T Consensus       206 HiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~  244 (279)
T KOG2462|consen  206 HIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKH  244 (279)
T ss_pred             ccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccc
Confidence            999999999999999999999999999999999999887


No 3  
>KOG3576|consensus
Probab=99.83  E-value=2.4e-21  Score=112.38  Aligned_cols=118  Identities=31%  Similarity=0.640  Sum_probs=106.2

Q ss_pred             CCCCCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHH
Q psy13123         11 ATTTSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKR   90 (129)
Q Consensus        11 ~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~   90 (129)
                      -++...|.|..|++.|.....|.+|+..|...+.+.|..||+.|...-+|.+|++.|+|-+||.|..|+++|++.-.|..
T Consensus       112 ssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            34455699999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcC-----------CCcccCCccccccCCHHHHHHHHHHhcccCC
Q psy13123         91 HIDAHLG-----------VKKFACETCGKLFSSKHGLKYHVRTHKGECK  128 (129)
Q Consensus        91 h~~~~~~-----------~~~~~C~~C~~~f~~~~~l~~h~~~h~~e~p  128 (129)
                      |.+.-++           ++.|.|..||.+-.....+..|+..|+..-|
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            9875433           4679999999999999999999998876543


No 4  
>KOG1074|consensus
Probab=99.80  E-value=9e-21  Score=128.46  Aligned_cols=56  Identities=36%  Similarity=0.669  Sum_probs=53.2

Q ss_pred             eecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHHHHhcccCC
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHVRTHKGECK  128 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~e~p  128 (129)
                      ..|.+|++.|...++|.+|+++|+++|||.|..|+++|....+|..|+.+|.+..|
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence            56999999999999999999999999999999999999999999999999988765


No 5  
>KOG1074|consensus
Probab=99.77  E-value=5.1e-20  Score=124.88  Aligned_cols=56  Identities=32%  Similarity=0.650  Sum_probs=51.4

Q ss_pred             eecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHHHHhcccCC
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHVRTHKGECK  128 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~e~p  128 (129)
                      -.|..|.++..-...|+.|.+.|+||+||+|.+||++|..+.+|..|+-+|....|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~  661 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP  661 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc
Confidence            46999999999999999999999999999999999999999999999999875443


No 6  
>KOG3608|consensus
Probab=99.73  E-value=3.3e-18  Score=106.82  Aligned_cols=119  Identities=28%  Similarity=0.507  Sum_probs=98.9

Q ss_pred             CCCCCCCCCCCCccccCcchhccCChhhHHHHHHH--hCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeeccccccc
Q psy13123          4 IRPRDPLATTTSAYQCGECGKQFTRKFSLNAHLHV--HYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKA   81 (129)
Q Consensus         4 l~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~--~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~   81 (129)
                      |..|.++|++++..-|+.||..|..+..|..|.+-  ..+..+|.|..|.+.|.....|..|+..|..  .|.|+.|.-.
T Consensus       195 LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn--~ykCplCdmt  272 (467)
T KOG3608|consen  195 LREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN--CYKCPLCDMT  272 (467)
T ss_pred             HHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh--cccccccccC
Confidence            56678888888888888888888888888888653  3355678888888888888888888877664  6889999888


Q ss_pred             ccChhHHHHHHH-HhcCCCcccCCccccccCCHHHHHHHHHHhc
Q psy13123         82 FVRASDLKRHID-AHLGVKKFACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus        82 ~~~~~~l~~h~~-~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      ....+.|..|++ .|..++||+|+.|.+.|...++|.+|+.+|.
T Consensus       273 c~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  273 CSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             CCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            888899999988 4778899999999999999999999999886


No 7  
>KOG3623|consensus
Probab=99.67  E-value=2.8e-17  Score=110.76  Aligned_cols=79  Identities=34%  Similarity=0.668  Sum_probs=50.1

Q ss_pred             CCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHH
Q psy13123         42 SSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHV  120 (129)
Q Consensus        42 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~  120 (129)
                      ...|.|+.|.+.|...++|.+|.-.|+|.+||.|..|.++|...-.|..|++.|.|||||.|+.|+|.|..+..+.+|+
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            3456666666666666666666666666666666666666666666666666666666666666666666666666654


No 8  
>KOG3623|consensus
Probab=99.62  E-value=2.5e-16  Score=106.24  Aligned_cols=85  Identities=32%  Similarity=0.681  Sum_probs=80.2

Q ss_pred             CCCCCCCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHH
Q psy13123          9 PLATTTSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDL   88 (129)
Q Consensus         9 ~~~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l   88 (129)
                      ...+.+..|.|.+|+++|...+.|.+|.=.|+|.+||.|.+|.+.|+-+..|..|++.|.|++||.|..|++.|..++..
T Consensus       887 ~~kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSY  966 (1007)
T KOG3623|consen  887 HAKTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSY  966 (1007)
T ss_pred             cccCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccch
Confidence            44566778999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HHHHH
Q psy13123         89 KRHID   93 (129)
Q Consensus        89 ~~h~~   93 (129)
                      ..||.
T Consensus       967 SQHMN  971 (1007)
T KOG3623|consen  967 SQHMN  971 (1007)
T ss_pred             Hhhhc
Confidence            88875


No 9  
>KOG3608|consensus
Probab=99.62  E-value=9.8e-16  Score=95.93  Aligned_cols=110  Identities=27%  Similarity=0.546  Sum_probs=99.9

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhC--CCCCeecccccccccChhHHHHHHHHh
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHG--GLKPYVCTYCGKAFVRASDLKRHIDAH   95 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~--~~~~~~c~~c~~~~~~~~~l~~h~~~~   95 (129)
                      .|..|-+.+.++..|.+|++.|++++...|+.||..|.....|..|.+-.+  ..++|.|..|.+.|.....|..|+..|
T Consensus       181 ~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  181 NWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             cchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            367799999999999999999999999999999999999999999987644  456899999999999999999999988


Q ss_pred             cCCCcccCCccccccCCHHHHHHHHHH-hcccCCC
Q psy13123         96 LGVKKFACETCGKLFSSKHGLKYHVRT-HKGECKR  129 (129)
Q Consensus        96 ~~~~~~~C~~C~~~f~~~~~l~~h~~~-h~~e~p~  129 (129)
                        .+-|+|+.|..+.+..+.|++|++. |..++|+
T Consensus       261 --vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpf  293 (467)
T KOG3608|consen  261 --VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPF  293 (467)
T ss_pred             --hhcccccccccCCCChHHHHHHHHhhhccCCCc
Confidence              4679999999999999999999998 6777774


No 10 
>KOG3576|consensus
Probab=99.62  E-value=1.1e-16  Score=93.20  Aligned_cols=83  Identities=34%  Similarity=0.764  Sum_probs=78.0

Q ss_pred             CCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHHH
Q psy13123         42 SSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus        42 ~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  121 (129)
                      ...+.|..|++.|....-|.+|++.|...+.+.|..||+.|-+.-+|..|.++|+|.+||+|..|+|+|.+.-.|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            45599999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             Hhc
Q psy13123        122 THK  124 (129)
Q Consensus       122 ~h~  124 (129)
                      .-+
T Consensus       195 kvh  197 (267)
T KOG3576|consen  195 KVH  197 (267)
T ss_pred             HHc
Confidence            543


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.40  E-value=1.4e-12  Score=87.68  Aligned_cols=102  Identities=23%  Similarity=0.571  Sum_probs=84.1

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccC---------
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVR---------   84 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~---------   84 (129)
                      ++.+.|+.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+..+.+.+++.|..|+..+..         
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhh
Confidence            44578999999996 678999999875  889999 99754 66889999999999999999999988842         


Q ss_pred             -hhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHHHH
Q psy13123         85 -ASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus        85 -~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                       ...|..|.... +.+++.|..||+.+... ++..|+..
T Consensus       526 ~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        526 RLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             hhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHH
Confidence             34788888875 88999999999988554 66677665


No 12 
>PHA00733 hypothetical protein
Probab=99.38  E-value=5.4e-13  Score=74.34  Aligned_cols=83  Identities=20%  Similarity=0.372  Sum_probs=63.4

Q ss_pred             CCCCccCCcchhhhcchhHHHHHH-----HHhCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHH
Q psy13123         41 GSSNYKCPLCGKFFIQLCHMKDHI-----QAHGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHG  115 (129)
Q Consensus        41 ~~~~~~c~~c~~~~~~~~~l~~~~-----~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~  115 (129)
                      ..+++.|.+|...+.....|..+.     ....+.++|.|..|++.|.....|..|+..+  +.++.|..|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            356678888877777666555541     1234467899999999999999998888865  457899999999999999


Q ss_pred             HHHHHHHhcc
Q psy13123        116 LKYHVRTHKG  125 (129)
Q Consensus       116 l~~h~~~h~~  125 (129)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999887654


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.13  E-value=2.4e-11  Score=56.94  Aligned_cols=43  Identities=16%  Similarity=0.517  Sum_probs=34.6

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHH
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGL  116 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l  116 (129)
                      .|.|+.||+.|...+.|..|+++|+  ++++|..|++.|.+.+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            4678888888888888888888887  678888888888776655


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.05  E-value=7e-10  Score=74.97  Aligned_cols=80  Identities=21%  Similarity=0.565  Sum_probs=65.9

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCccccccCC----------
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSS----------  112 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~----------  112 (129)
                      ..+.|+.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+..+..++++.|..|++.|..          
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhh
Confidence            3478999999886 577999999874  789999 99754 66899999999999999999999999852          


Q ss_pred             HHHHHHHHHHhcccCC
Q psy13123        113 KHGLKYHVRTHKGECK  128 (129)
Q Consensus       113 ~~~l~~h~~~h~~e~p  128 (129)
                      .+.|..|..+. |.+|
T Consensus       527 ~s~Lt~HE~~C-G~rt  541 (567)
T PLN03086        527 LRGMSEHESIC-GSRT  541 (567)
T ss_pred             hhhHHHHHHhc-CCcc
Confidence            45788998884 6554


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.03  E-value=1.2e-10  Score=54.59  Aligned_cols=42  Identities=26%  Similarity=0.587  Sum_probs=28.4

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHH
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHM   60 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l   60 (129)
                      |.|+.||+.|...+.|..|++.|+  +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            567777777777777777777776  566677777666655443


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.01  E-value=2.6e-10  Score=45.98  Aligned_cols=25  Identities=48%  Similarity=1.020  Sum_probs=18.9

Q ss_pred             HHHHHHHHhcCCCcccCCccccccC
Q psy13123         87 DLKRHIDAHLGVKKFACETCGKLFS  111 (129)
Q Consensus        87 ~l~~h~~~~~~~~~~~C~~C~~~f~  111 (129)
                      +|..|++.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3667777788888888888877775


No 17 
>PHA00616 hypothetical protein
Probab=98.98  E-value=2.9e-10  Score=50.82  Aligned_cols=30  Identities=23%  Similarity=0.492  Sum_probs=19.8

Q ss_pred             cccCCccccccCCHHHHHHHHHHhcccCCC
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRTHKGECKR  129 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~h~~e~p~  129 (129)
                      ||.|..||+.|.+.++|..|++.|++++|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~   30 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKL   30 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcc
Confidence            456666666666666666666666666653


No 18 
>PHA00733 hypothetical protein
Probab=98.96  E-value=1.1e-09  Score=61.08  Aligned_cols=94  Identities=22%  Similarity=0.332  Sum_probs=76.1

Q ss_pred             CCCCCCCCCCCCCCccccCcchhccCChhhHHHH--HH---HhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecc
Q psy13123          2 REIRPRDPLATTTSAYQCGECGKQFTRKFSLNAH--LH---VHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCT   76 (129)
Q Consensus         2 ~~l~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~h--~~---~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~   76 (129)
                      ++|+++-......+.+.|..|...|.....|..+  +.   .+.+.+++.|..|++.|.....|..|+..+  ..++.|.
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            3556655666677889999999999887777655  21   234578999999999999999999998865  3578999


Q ss_pred             cccccccChhHHHHHHHHhcC
Q psy13123         77 YCGKAFVRASDLKRHIDAHLG   97 (129)
Q Consensus        77 ~c~~~~~~~~~l~~h~~~~~~   97 (129)
                      .|++.|.....|..|+...++
T Consensus       104 ~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        104 VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999887654


No 19 
>PHA00616 hypothetical protein
Probab=98.77  E-value=4.6e-09  Score=46.98  Aligned_cols=34  Identities=26%  Similarity=0.421  Sum_probs=25.6

Q ss_pred             ccccCcchhccCChhhHHHHHHHhCCCCCccCCc
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPL   49 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~   49 (129)
                      ||.|..||+.|...+.|..|++.+++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5677778887777777777777777777777653


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.70  E-value=2e-08  Score=40.41  Aligned_cols=23  Identities=52%  Similarity=1.305  Sum_probs=12.1

Q ss_pred             HHHHHHHhCCCCCeecccccccc
Q psy13123         60 MKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        60 l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      |..|++.|++++||.|+.|++.|
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEE
T ss_pred             HHHHhhhcCCCCCCCCCCCcCee
Confidence            44455555555555555555544


No 21 
>KOG3993|consensus
Probab=98.53  E-value=1.9e-08  Score=65.13  Aligned_cols=107  Identities=26%  Similarity=0.459  Sum_probs=65.0

Q ss_pred             ccccCcchhccCChhhHHHHHHHhCC---------------------------------CCCccCCcchhhhcchhHHHH
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHYG---------------------------------SSNYKCPLCGKFFIQLCHMKD   62 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~~---------------------------------~~~~~c~~c~~~~~~~~~l~~   62 (129)
                      -|+|++|++.|...-+|..|.+.|-.                                 +..|.|..|++.|.....|..
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            37888888888888888888877621                                 112677777777777777777


Q ss_pred             HHHHhCCCC------C----------------------------------------eecccccccccChhHHHHHHHHhc
Q psy13123         63 HIQAHGGLK------P----------------------------------------YVCTYCGKAFVRASDLKRHIDAHL   96 (129)
Q Consensus        63 ~~~~~~~~~------~----------------------------------------~~c~~c~~~~~~~~~l~~h~~~~~   96 (129)
                      |+.+|....      +                                        ..+..++..+..+..--.+.+...
T Consensus       375 Hqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~  454 (500)
T KOG3993|consen  375 HQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGI  454 (500)
T ss_pred             hHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccc
Confidence            765543210      0                                        112223322222222112222222


Q ss_pred             CCCcccCCccccccCCHHHHHHHHHH
Q psy13123         97 GVKKFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus        97 ~~~~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      .+..|.|.+|.-.|..+.+|.+|...
T Consensus       455 ~~q~f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  455 AEQGFTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             hhhccccccchHhhhcCcchHhHhhh
Confidence            23458899999999999999998765


No 22 
>PHA00732 hypothetical protein
Probab=98.48  E-value=1.2e-07  Score=48.48  Aligned_cols=37  Identities=32%  Similarity=0.753  Sum_probs=23.2

Q ss_pred             CccCCcchhhhcchhHHHHHHHH-hCCCCCeeccccccccc
Q psy13123         44 NYKCPLCGKFFIQLCHMKDHIQA-HGGLKPYVCTYCGKAFV   83 (129)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~~~~~-~~~~~~~~c~~c~~~~~   83 (129)
                      |+.|..|++.|.....|..|++. |.+   +.|..|++.|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~   38 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR   38 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC
Confidence            35667777777777777777653 432   35666766665


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.45  E-value=1.4e-07  Score=36.78  Aligned_cols=23  Identities=57%  Similarity=1.051  Sum_probs=18.8

Q ss_pred             ccCCccccccCCHHHHHHHHHHh
Q psy13123        101 FACETCGKLFSSKHGLKYHVRTH  123 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~h  123 (129)
                      |.|+.|++.|...+.|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57888888888888888888764


No 24 
>KOG3993|consensus
Probab=98.40  E-value=5.5e-08  Score=63.11  Aligned_cols=108  Identities=24%  Similarity=0.438  Sum_probs=61.7

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCee-cccc--cccccChhHHHHHHH
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYV-CTYC--GKAFVRASDLKRHID   93 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~-c~~c--~~~~~~~~~l~~h~~   93 (129)
                      |+|..|-..|.+.-.|.+|.........|.|+.|++.|.-..+|..|.+=|--..-.- -..-  .+.....+..+.--+
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            6677777777777777776665555566777777777777777777765443211000 0000  000000010000000


Q ss_pred             H--hcCCCcccCCccccccCCHHHHHHHHHHhc
Q psy13123         94 A--HLGVKKFACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus        94 ~--~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      .  ...+-.|.|..|+|.|....-|+.|+-+|.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence            0  012336999999999999999999988875


No 25 
>PHA00732 hypothetical protein
Probab=98.39  E-value=2.2e-07  Score=47.51  Aligned_cols=48  Identities=27%  Similarity=0.592  Sum_probs=39.1

Q ss_pred             ccccCcchhccCChhhHHHHHHH-hCCCCCccCCcchhhhcchhHHHHHHHHhCC
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHV-HYGSSNYKCPLCGKFFIQLCHMKDHIQAHGG   69 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~   69 (129)
                      ||.|..|++.|.....|..|++. |.+   +.|+.|++.|.   .+..|+++...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            58899999999999999999984 653   58999999998   47777755443


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.21  E-value=1e-06  Score=34.25  Aligned_cols=23  Identities=43%  Similarity=0.944  Sum_probs=18.1

Q ss_pred             cccCcchhccCChhhHHHHHHHh
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56888888888888888887753


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.17  E-value=1e-06  Score=35.69  Aligned_cols=25  Identities=48%  Similarity=0.903  Sum_probs=20.6

Q ss_pred             cccCCccccccCCHHHHHHHHHHhc
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5788888888888888888888775


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.15  E-value=2.3e-06  Score=33.39  Aligned_cols=24  Identities=54%  Similarity=1.027  Sum_probs=17.4

Q ss_pred             ccCCccccccCCHHHHHHHHHHhc
Q psy13123        101 FACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      |.|+.|++.|.....|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            568888888888888888887763


No 29 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.11  E-value=1.1e-05  Score=38.32  Aligned_cols=49  Identities=29%  Similarity=0.638  Sum_probs=26.3

Q ss_pred             eecccccccccChhHHHHHHHH-hcCC-CcccCCccccccCCHHHHHHHHHHhc
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDA-HLGV-KKFACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~-~~~~-~~~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      |.|+.|++ ..+...|..|... |..+ +.+.|+.|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            55666666 3445556666543 3322 3466666665433  36666666543


No 30 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.03  E-value=2.4e-05  Score=37.16  Aligned_cols=47  Identities=28%  Similarity=0.536  Sum_probs=23.8

Q ss_pred             cccCcchhccCChhhHHHHHHH-hCCC-CCccCCcchhhhcchhHHHHHHHH
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHV-HYGS-SNYKCPLCGKFFIQLCHMKDHIQA   66 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~-~~~~-~~~~c~~c~~~~~~~~~l~~~~~~   66 (129)
                      |.|+.|++ ..+...|..|... |..+ +.+.|+.|...+.  .+|..|+..
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~   51 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNS   51 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHH
Confidence            56666666 3445556666443 3322 3456666655322  245555543


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.90  E-value=1.5e-05  Score=36.57  Aligned_cols=33  Identities=15%  Similarity=0.349  Sum_probs=22.8

Q ss_pred             cCCCcccCCccccccCCHHHHHHHHHHhcccCC
Q psy13123         96 LGVKKFACETCGKLFSSKHGLKYHVRTHKGECK  128 (129)
Q Consensus        96 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~e~p  128 (129)
                      ..+.|-.|++|+..+.+..+|++|+.+.++-+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            356788899999999999999999988877766


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.90  E-value=6e-06  Score=33.33  Aligned_cols=25  Identities=36%  Similarity=0.818  Sum_probs=19.7

Q ss_pred             ccccCcchhccCChhhHHHHHHHhC
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHY   40 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~   40 (129)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5778888888888888888887664


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.89  E-value=1.7e-05  Score=31.35  Aligned_cols=24  Identities=54%  Similarity=1.053  Sum_probs=19.5

Q ss_pred             ccCCccccccCCHHHHHHHHHHhc
Q psy13123        101 FACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      |.|..|++.|...+.|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468888888888888888888764


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.85  E-value=1.6e-05  Score=30.88  Aligned_cols=23  Identities=43%  Similarity=0.915  Sum_probs=15.9

Q ss_pred             cccCcchhccCChhhHHHHHHHh
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      |.|+.|++.|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56778888888888888877654


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.82  E-value=1.6e-05  Score=42.44  Aligned_cols=73  Identities=21%  Similarity=0.436  Sum_probs=17.7

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHh
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAH   95 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~   95 (129)
                      .|..|+..|.....+..|+...++......    ..+.....+........ ...+.|..|+..|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~----~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQ----KYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccccc----ccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            377788888888888888764443322111    11112222222222211 12577888888888888888887753


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.66  E-value=0.0001  Score=33.89  Aligned_cols=33  Identities=18%  Similarity=0.334  Sum_probs=17.3

Q ss_pred             CCCCccccCcchhccCChhhHHHHHHHhCCCCC
Q psy13123         12 TTTSAYQCGECGKQFTRKFSLNAHLHVHYGSSN   44 (129)
Q Consensus        12 ~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~   44 (129)
                      ..+.|..|++|+..+....+|.+|+...++.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            344566677777777777777777766555544


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.64  E-value=5.4e-05  Score=40.39  Aligned_cols=73  Identities=23%  Similarity=0.472  Sum_probs=21.6

Q ss_pred             cCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHHHHHh
Q psy13123         46 KCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYHVRTH  123 (129)
Q Consensus        46 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h  123 (129)
                      +|..|+..|.....|..|+....+... .   ....+.....+..+.... ....+.|..|++.|.....|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~-~---~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI-P---DQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Ccccccccccccccccccccccccccc-c---cccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            488999999999999999976554321 1   111122333333333321 123689999999999999999999974


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.45  E-value=0.00016  Score=28.33  Aligned_cols=23  Identities=48%  Similarity=1.031  Sum_probs=16.4

Q ss_pred             cccCcchhccCChhhHHHHHHHh
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      |.|..|++.|.....+..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45777777777777777777654


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.38  E-value=0.00021  Score=27.85  Aligned_cols=23  Identities=35%  Similarity=0.707  Sum_probs=15.7

Q ss_pred             ccCCccccccCCHHHHHHHHHHhc
Q psy13123        101 FACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      |+|..|+.... ...|..|++.|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56778887776 778888877764


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.29  E-value=0.00015  Score=28.52  Aligned_cols=23  Identities=43%  Similarity=0.944  Sum_probs=17.2

Q ss_pred             ccCCccccccCCHHHHHHHHHHh
Q psy13123        101 FACETCGKLFSSKHGLKYHVRTH  123 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~h  123 (129)
                      |.|..|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            46777888888888888887654


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.24  E-value=7.7e-05  Score=47.40  Aligned_cols=51  Identities=37%  Similarity=0.721  Sum_probs=36.1

Q ss_pred             CCCeeccc--ccccccChhHHHHHHHHh-------------------cCCCcccCCccccccCCHHHHHHHH
Q psy13123         70 LKPYVCTY--CGKAFVRASDLKRHIDAH-------------------LGVKKFACETCGKLFSSKHGLKYHV  120 (129)
Q Consensus        70 ~~~~~c~~--c~~~~~~~~~l~~h~~~~-------------------~~~~~~~C~~C~~~f~~~~~l~~h~  120 (129)
                      ++||.|++  |.+.+.....|.-|+.-.                   ..+|||.|.+|+|.+...-.|.-|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            46777766  667777777776665432                   2358999999999988777766554


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=97.24  E-value=0.00027  Score=41.13  Aligned_cols=38  Identities=29%  Similarity=0.712  Sum_probs=31.8

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccccccCCH
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSK  113 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~  113 (129)
                      +|.|. |+.   ....+..|.++++++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58897 886   566778999999999999999999888654


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.16  E-value=0.00015  Score=46.12  Aligned_cols=70  Identities=23%  Similarity=0.392  Sum_probs=43.4

Q ss_pred             CCccccCc--chhccCChhhHHHHHHHhC-CCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHH
Q psy13123         14 TSAYQCGE--CGKQFTRKFSLNAHLHVHY-GSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKR   90 (129)
Q Consensus        14 ~~~~~C~~--C~~~~~~~~~l~~h~~~~~-~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~   90 (129)
                      ++||+|++  |.+.|+..-.|..|+..-+ ..+..+-+.          -..+.......+||+|.+|++.+.....|.-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~----------p~~~~~F~~~~KPYrCevC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS----------PEKMNIFSAKDKPYRCEVCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCC----------ccccccccccCCceeccccchhhccCcccee
Confidence            48899976  8888888888888876432 222211110          0001112344678899999888888777766


Q ss_pred             HHH
Q psy13123         91 HID   93 (129)
Q Consensus        91 h~~   93 (129)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            643


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.00  E-value=0.00039  Score=27.28  Aligned_cols=22  Identities=36%  Similarity=0.756  Sum_probs=16.0

Q ss_pred             cccCcchhccCChhhHHHHHHH
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHV   38 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~   38 (129)
                      |.|..|++.|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4677777777777777777654


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=96.98  E-value=0.0004  Score=40.47  Aligned_cols=25  Identities=24%  Similarity=0.571  Sum_probs=12.1

Q ss_pred             hHHHHHHHHhCCCCCeecccccccc
Q psy13123         58 CHMKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        58 ~~l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      ..+..|.++++++++|.|..|+..|
T Consensus       129 ~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        129 LTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             CHHHHHHHHhcCCccEECCCCCcee
Confidence            3344444555555555555554443


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.85  E-value=0.00087  Score=26.01  Aligned_cols=23  Identities=35%  Similarity=0.678  Sum_probs=15.8

Q ss_pred             cccCcchhccCChhhHHHHHHHhC
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHY   40 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~   40 (129)
                      |.|+.|+.+.. ...|..|+..+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            57888888887 778888877653


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.61  E-value=0.00054  Score=27.48  Aligned_cols=22  Identities=45%  Similarity=0.976  Sum_probs=17.5

Q ss_pred             ccCCccccccCCHHHHHHHHHH
Q psy13123        101 FACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5688888888888888887765


No 48 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=96.48  E-value=0.0037  Score=34.05  Aligned_cols=80  Identities=21%  Similarity=0.417  Sum_probs=44.8

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCC------------CeecccccccccChhHHHHHHHHhcCCCcccCCcccccc
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLK------------PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLF  110 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~------------~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  110 (129)
                      .|..|+.|+........|.+.-----..+            ...|..|...|.......  ...-.....|.|+.|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~--~~~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSP--FDELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccc--ccccccccceeCCCCCCcc
Confidence            45667777776666666665321100001            113777777665432110  0001223468899998888


Q ss_pred             CCHHHHHHHHHHhc
Q psy13123        111 SSKHGLKYHVRTHK  124 (129)
Q Consensus       111 ~~~~~l~~h~~~h~  124 (129)
                      -.+-+.-.|...|.
T Consensus        92 C~dCD~fiHe~Lh~  105 (112)
T TIGR00622        92 CVDCDVFVHESLHC  105 (112)
T ss_pred             ccccchhhhhhccC
Confidence            88888888876663


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.10  E-value=0.0076  Score=23.69  Aligned_cols=21  Identities=29%  Similarity=0.722  Sum_probs=13.0

Q ss_pred             ccCCccccccCCHHHHHHHHHH
Q psy13123        101 FACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      ..|+.||+.| ..+.|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 55556666543


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.57  E-value=0.012  Score=24.94  Aligned_cols=23  Identities=22%  Similarity=0.618  Sum_probs=18.8

Q ss_pred             cccCCccccccCCHHHHHHHHHH
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46789999999988888888764


No 51 
>KOG1146|consensus
Probab=95.43  E-value=0.0075  Score=45.52  Aligned_cols=80  Identities=16%  Similarity=0.269  Sum_probs=41.3

Q ss_pred             CCCCCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHH
Q psy13123         11 ATTTSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKR   90 (129)
Q Consensus        11 ~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~   90 (129)
                      ++-.+.++|+.|+..|+....|..||+..+-+...  ..|. .+.....+.+....-.+.++|.|..|...+....+|.+
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~--~~c~-~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsi  536 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS--AYCK-AGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSI  536 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccch--hHhH-hccccccccccccccCCCCcccceeeeeeeecchHHHH
Confidence            33446677888888888888888888763322111  1111 11111111111112223345666666666666666666


Q ss_pred             HHH
Q psy13123         91 HID   93 (129)
Q Consensus        91 h~~   93 (129)
                      |+.
T Consensus       537 hlq  539 (1406)
T KOG1146|consen  537 HLQ  539 (1406)
T ss_pred             HHH
Confidence            654


No 52 
>KOG2893|consensus
Probab=94.57  E-value=0.0079  Score=37.11  Aligned_cols=41  Identities=39%  Similarity=0.724  Sum_probs=27.4

Q ss_pred             cccccccccChhHHHHHHHHhcCCCcccCCccccccCCHHHHHHH
Q psy13123         75 CTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSKHGLKYH  119 (129)
Q Consensus        75 c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~h  119 (129)
                      |=.|++.|.+.-.|+.|++.    +.|+|.+|.|.+-....|..|
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceee
Confidence            44577777777777766653    457777777766566666666


No 53 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.45  E-value=0.028  Score=23.67  Aligned_cols=10  Identities=50%  Similarity=1.398  Sum_probs=5.6

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      |+|..||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4566666544


No 54 
>KOG2785|consensus
Probab=93.99  E-value=0.41  Score=31.91  Aligned_cols=51  Identities=27%  Similarity=0.540  Sum_probs=38.9

Q ss_pred             CeecccccccccChhHHHHHHHHhcCC-----------------------CcccCCccc---cccCCHHHHHHHHHH
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGV-----------------------KKFACETCG---KLFSSKHGLKYHVRT  122 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~C~~C~---~~f~~~~~l~~h~~~  122 (129)
                      |-.|..|+..+.+......||..+++-                       +-+-|..|+   +.|.+....+.|+..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            456888888888887788888776652                       236677888   888888888888775


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.75  E-value=0.038  Score=26.01  Aligned_cols=23  Identities=26%  Similarity=0.612  Sum_probs=10.7

Q ss_pred             CCcccCCccccccCCHHHHHHHH
Q psy13123         98 VKKFACETCGKLFSSKHGLKYHV  120 (129)
Q Consensus        98 ~~~~~C~~C~~~f~~~~~l~~h~  120 (129)
                      |-.+.|+.|+..|.+.-++.+|.
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHh
Confidence            33444444444444444444443


No 56 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.49  E-value=0.29  Score=26.71  Aligned_cols=25  Identities=32%  Similarity=0.743  Sum_probs=22.7

Q ss_pred             ccC----CccccccCCHHHHHHHHHHhcc
Q psy13123        101 FAC----ETCGKLFSSKHGLKYHVRTHKG  125 (129)
Q Consensus       101 ~~C----~~C~~~f~~~~~l~~h~~~h~~  125 (129)
                      |.|    ..|+..+.....+..|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998764


No 57 
>KOG2231|consensus
Probab=93.34  E-value=0.22  Score=35.72  Aligned_cols=95  Identities=19%  Similarity=0.373  Sum_probs=50.7

Q ss_pred             hccCChhhHHHHHH-HhCCCCCccCCc-------chhhhcchhHHHHHHHH-hCCCC----CeecccccccccChhHHHH
Q psy13123         24 KQFTRKFSLNAHLH-VHYGSSNYKCPL-------CGKFFIQLCHMKDHIQA-HGGLK----PYVCTYCGKAFVRASDLKR   90 (129)
Q Consensus        24 ~~~~~~~~l~~h~~-~~~~~~~~~c~~-------c~~~~~~~~~l~~~~~~-~~~~~----~~~c~~c~~~~~~~~~l~~   90 (129)
                      ..|.....|..|+. .|..-.-..|..       +.+.| ....|..|++. ..+++    .-.|..|...|.....+..
T Consensus       122 ~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Y-t~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~r  200 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLY-TRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYR  200 (669)
T ss_pred             cchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehe-hHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHH
Confidence            33446678888885 443222222221       22223 33445555543 22222    2357778888888888888


Q ss_pred             HHHHhcCCCcccCCcc------ccccCCHHHHHHHHHHh
Q psy13123         91 HIDAHLGVKKFACETC------GKLFSSKHGLKYHVRTH  123 (129)
Q Consensus        91 h~~~~~~~~~~~C~~C------~~~f~~~~~l~~h~~~h  123 (129)
                      |++..+.    .|..|      +.-|..-.+|..|.|.+
T Consensus       201 H~~~~h~----~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  201 HLRFDHE----FCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             hhcccee----heeecCcccccchhcccchHHHHHhhhc
Confidence            8775543    33333      34455666677776653


No 58 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.93  E-value=0.15  Score=28.01  Aligned_cols=85  Identities=21%  Similarity=0.327  Sum_probs=53.4

Q ss_pred             CccccCcchhccCChhhHHHHHHHhCC-----CC-------CccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccc
Q psy13123         15 SAYQCGECGKQFTRKFSLNAHLHVHYG-----SS-------NYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~~~l~~h~~~~~~-----~~-------~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      -|..|+.||-+......|.+....--.     +.       ...|-.|...|.........  .......|.|..|...|
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCCCCCcc
Confidence            367899999988888877765422111     11       12477788877654311100  02223468999999999


Q ss_pred             cChhHHHHHHHHhcCCCcccCCccc
Q psy13123         83 VRASDLKRHIDAHLGVKKFACETCG  107 (129)
Q Consensus        83 ~~~~~l~~h~~~~~~~~~~~C~~C~  107 (129)
                      -..-+...|...|      .|+.|.
T Consensus        92 C~dCD~fiHe~Lh------~CPGC~  110 (112)
T TIGR00622        92 CVDCDVFVHESLH------CCPGCI  110 (112)
T ss_pred             ccccchhhhhhcc------CCcCCC
Confidence            9888888886655      466653


No 59 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=92.92  E-value=0.097  Score=22.62  Aligned_cols=32  Identities=31%  Similarity=0.724  Sum_probs=16.3

Q ss_pred             ecccccccccChhHHHHHHHHhcCCCcccCCcccccc
Q psy13123         74 VCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLF  110 (129)
Q Consensus        74 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  110 (129)
                      .|+.|+..|.-..+-.     ..+.+..+|..|+..|
T Consensus         4 ~CP~C~~~f~v~~~~l-----~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKL-----PAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHHc-----ccCCcEEECCCCCcEe
Confidence            4666666555544311     1233455666666555


No 60 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.69  E-value=0.12  Score=21.85  Aligned_cols=25  Identities=28%  Similarity=0.657  Sum_probs=14.3

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCcccc
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGK  108 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~  108 (129)
                      .|+|..||..+...            +.|..|+.||-
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            36777777655432            13456777764


No 61 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.60  E-value=0.17  Score=21.73  Aligned_cols=33  Identities=21%  Similarity=0.562  Sum_probs=17.2

Q ss_pred             eecccccccccChhHHHHHHHHhcCCCcccCCcccccc
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLF  110 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  110 (129)
                      ..|+.|+..|.-.+...     -...+..+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~i-----p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKI-----PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHC-----CCCCcEEECCCCCCEe
Confidence            35666666665554422     1223445666666655


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.59  E-value=0.025  Score=37.87  Aligned_cols=56  Identities=41%  Similarity=0.743  Sum_probs=36.3

Q ss_pred             CeecccccccccChhHHHHHHH--HhcCC--CcccCC--ccccccCCHHHHHHHHHHhcccC
Q psy13123         72 PYVCTYCGKAFVRASDLKRHID--AHLGV--KKFACE--TCGKLFSSKHGLKYHVRTHKGEC  127 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~h~~~h~~e~  127 (129)
                      ++.|..|...|.....+..|.+  .|.++  +++.|.  .|++.|.+...+..|..+|++-.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCC
Confidence            4556666666666666666666  56666  666666  57777777666666666665433


No 63 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=91.23  E-value=0.16  Score=21.90  Aligned_cols=14  Identities=21%  Similarity=0.553  Sum_probs=7.1

Q ss_pred             eecccccccccChh
Q psy13123         73 YVCTYCGKAFVRAS   86 (129)
Q Consensus        73 ~~c~~c~~~~~~~~   86 (129)
                      +.|+.|+..|.-..
T Consensus         3 ~~CP~C~~~~~v~~   16 (38)
T TIGR02098         3 IQCPNCKTSFRVVD   16 (38)
T ss_pred             EECCCCCCEEEeCH
Confidence            34555655554443


No 64 
>KOG2231|consensus
Probab=90.68  E-value=0.58  Score=33.75  Aligned_cols=79  Identities=20%  Similarity=0.318  Sum_probs=46.4

Q ss_pred             CCcchhhhcchhHHHHHHHHhCC-CCCeeccccccccc------ChhHHHHHHHHh-cCCCc----ccCCccccccCCHH
Q psy13123         47 CPLCGKFFIQLCHMKDHIQAHGG-LKPYVCTYCGKAFV------RASDLKRHIDAH-LGVKK----FACETCGKLFSSKH  114 (129)
Q Consensus        47 c~~c~~~~~~~~~l~~~~~~~~~-~~~~~c~~c~~~~~------~~~~l~~h~~~~-~~~~~----~~C~~C~~~f~~~~  114 (129)
                      |..| ..|.....|..|+...+. ..-..|....+.|.      ....++.|+... .++..    ..|..|...|-...
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~  196 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDD  196 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHH
Confidence            4444 445577788888865432 11112332222222      235566666542 22332    45888999999999


Q ss_pred             HHHHHHHHhccc
Q psy13123        115 GLKYHVRTHKGE  126 (129)
Q Consensus       115 ~l~~h~~~h~~e  126 (129)
                      .|.+|++.++.+
T Consensus       197 el~rH~~~~h~~  208 (669)
T KOG2231|consen  197 ELYRHLRFDHEF  208 (669)
T ss_pred             HHHHhhccceeh
Confidence            999999976544


No 65 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=90.22  E-value=0.24  Score=22.90  Aligned_cols=23  Identities=39%  Similarity=0.798  Sum_probs=15.3

Q ss_pred             ccCCccccccCCH-----HHHHHHHH-Hh
Q psy13123        101 FACETCGKLFSSK-----HGLKYHVR-TH  123 (129)
Q Consensus       101 ~~C~~C~~~f~~~-----~~l~~h~~-~h  123 (129)
                      ..|..|++.+...     ++|.+|++ +|
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            4577777766554     57778877 44


No 66 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=90.05  E-value=0.3  Score=21.85  Aligned_cols=25  Identities=36%  Similarity=0.685  Sum_probs=13.7

Q ss_pred             CCCcccCCccccccCCH----HHHHHHHH
Q psy13123         97 GVKKFACETCGKLFSSK----HGLKYHVR  121 (129)
Q Consensus        97 ~~~~~~C~~C~~~f~~~----~~l~~h~~  121 (129)
                      +.....|..|++.+...    +.|..|++
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            34556777787776654    67777774


No 67 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.03  E-value=0.16  Score=27.71  Aligned_cols=29  Identities=31%  Similarity=0.717  Sum_probs=17.2

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcch
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQL   57 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   57 (129)
                      .|+.||..|...           +..|..|+.||..|...
T Consensus        11 ~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            566777666432           23566677776666554


No 68 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.50  E-value=0.22  Score=29.38  Aligned_cols=10  Identities=40%  Similarity=1.162  Sum_probs=5.5

Q ss_pred             CccCCcchhh
Q psy13123         44 NYKCPLCGKF   53 (129)
Q Consensus        44 ~~~c~~c~~~   53 (129)
                      .|.|+.||.+
T Consensus       134 ~~vC~vCGy~  143 (166)
T COG1592         134 VWVCPVCGYT  143 (166)
T ss_pred             EEEcCCCCCc
Confidence            4556666543


No 69 
>KOG2482|consensus
Probab=89.48  E-value=0.58  Score=30.86  Aligned_cols=103  Identities=23%  Similarity=0.363  Sum_probs=60.5

Q ss_pred             cccCcchhccCChhhHHHHHHH--hCCCCC--------ccCC--cchhhhcch-hHHHHHHHH--hCC------------
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHV--HYGSSN--------YKCP--LCGKFFIQL-CHMKDHIQA--HGG------------   69 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~--~~~~~~--------~~c~--~c~~~~~~~-~~l~~~~~~--~~~------------   69 (129)
                      +.|-.|.+.|.++..|..||+.  |....|        |.-.  .-++.+... ..+  .+..  ..+            
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~--dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSED--DRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhh--hhhhhccccccccchhhhhcC
Confidence            6799999999999999999975  322222        1111  111211111 000  0111  111            


Q ss_pred             -CCC--eecccccccccChhHHHHHHHHhcC---------------------------CCcccCCccccccCCHHHHHHH
Q psy13123         70 -LKP--YVCTYCGKAFVRASDLKRHIDAHLG---------------------------VKKFACETCGKLFSSKHGLKYH  119 (129)
Q Consensus        70 -~~~--~~c~~c~~~~~~~~~l~~h~~~~~~---------------------------~~~~~C~~C~~~f~~~~~l~~h  119 (129)
                       ..+  .+|..|.....+...+..|++.-+.                           .+.-.|-.|.-.|.....|..|
T Consensus       274 ~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~h  353 (423)
T KOG2482|consen  274 DAEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIH  353 (423)
T ss_pred             CCCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhh
Confidence             112  4788888877778888888874221                           1124466787889999998888


Q ss_pred             HH
Q psy13123        120 VR  121 (129)
Q Consensus       120 ~~  121 (129)
                      +-
T Consensus       354 m~  355 (423)
T KOG2482|consen  354 MV  355 (423)
T ss_pred             cc
Confidence            65


No 70 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.80  E-value=0.21  Score=23.94  Aligned_cols=49  Identities=29%  Similarity=0.701  Sum_probs=29.0

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      -.|..||....-          ..+...|.|+.||+.......     +.-....+|.|+.||.
T Consensus        10 ~~CtSCg~~i~p----------~e~~v~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          10 PVCTSCGREIAP----------GETAVKFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             ceeccCCCEecc----------CCceeEeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            467777765422          123456889999866554432     2222345789998873


No 71 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.58  E-value=0.6  Score=27.39  Aligned_cols=33  Identities=21%  Similarity=0.420  Sum_probs=17.7

Q ss_pred             CCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccc
Q psy13123         41 GSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        41 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      +..-|.|+.|+..|.....+.         ..|.|+.||...
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            344466666666555554432         146666666543


No 72 
>KOG1146|consensus
Probab=88.46  E-value=0.097  Score=40.05  Aligned_cols=23  Identities=30%  Similarity=0.681  Sum_probs=17.8

Q ss_pred             CcccCCccccccCCHHHHHHHHHH
Q psy13123         99 KKFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus        99 ~~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      .+| |..|...|+....|.+|+++
T Consensus      1328 ~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1328 TYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             ccc-chHHHhhcchhHHHHHHHHH
Confidence            345 88888888888888888876


No 73 
>KOG2186|consensus
Probab=88.45  E-value=0.29  Score=30.76  Aligned_cols=48  Identities=25%  Similarity=0.591  Sum_probs=33.5

Q ss_pred             CccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHH
Q psy13123         44 NYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDA   94 (129)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~   94 (129)
                      .|.|..||....-.. +..|+..-++ ..|.|..|+..|.. .+...|.+-
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            367888888766444 6668766555 57888889888877 455566553


No 74 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.44  E-value=0.068  Score=35.80  Aligned_cols=57  Identities=35%  Similarity=0.732  Sum_probs=39.7

Q ss_pred             ccccCcchhccCChhhHHHHHH--HhCCC--CCccCC--cchhhhcchhHHHHHHHHhCCCCC
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLH--VHYGS--SNYKCP--LCGKFFIQLCHMKDHIQAHGGLKP   72 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~~~~~~~~~~~   72 (129)
                      ++.|..|...|.....+..|..  .|+++  +++.|+  .|++.|.....+..|...+.+..+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  351 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP  351 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc
Confidence            5667777777777777777777  67777  677777  677777777766666666665443


No 75 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=87.04  E-value=1  Score=26.06  Aligned_cols=38  Identities=24%  Similarity=0.524  Sum_probs=18.5

Q ss_pred             CCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccc
Q psy13123         41 GSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        41 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      +...|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            3445667777666654332211   011 2236666666544


No 76 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=86.71  E-value=0.83  Score=18.00  Aligned_cols=19  Identities=16%  Similarity=0.434  Sum_probs=13.0

Q ss_pred             cCCccccccCCHHHHHHHHH
Q psy13123        102 ACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus       102 ~C~~C~~~f~~~~~l~~h~~  121 (129)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577887777 5566667764


No 77 
>KOG2186|consensus
Probab=86.67  E-value=0.36  Score=30.37  Aligned_cols=49  Identities=22%  Similarity=0.593  Sum_probs=37.2

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhC
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHG   68 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~   68 (129)
                      |.|..||.+.+.. .+..|+-.-++ .-|.|..|++.|.. .+...|...-+
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            7899999988654 45568877766 77899999999987 55666765444


No 78 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=86.60  E-value=0.67  Score=27.78  Aligned_cols=34  Identities=24%  Similarity=0.481  Sum_probs=20.8

Q ss_pred             CCCCccCCcchhhhcchhHHHHHHHHhCCCCCeeccccccccc
Q psy13123         41 GSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFV   83 (129)
Q Consensus        41 ~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~   83 (129)
                      +..-|.|+.|+..|.....+.         ..|.|+.||..+.
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            345577777777666655432         2577777776443


No 79 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=86.30  E-value=0.16  Score=23.61  Aligned_cols=12  Identities=42%  Similarity=1.243  Sum_probs=7.8

Q ss_pred             cccCcchhccCC
Q psy13123         17 YQCGECGKQFTR   28 (129)
Q Consensus        17 ~~C~~C~~~~~~   28 (129)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            667777776643


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=86.27  E-value=0.084  Score=32.51  Aligned_cols=21  Identities=29%  Similarity=0.556  Sum_probs=14.8

Q ss_pred             CCccccCcchhccCChhhHHH
Q psy13123         14 TSAYQCGECGKQFTRKFSLNA   34 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~   34 (129)
                      ++...|+.|+..|..+.....
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~   23 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSG   23 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcC
Confidence            456789999998887655433


No 81 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=85.96  E-value=0.84  Score=21.96  Aligned_cols=9  Identities=33%  Similarity=1.298  Sum_probs=4.7

Q ss_pred             CcccCCccc
Q psy13123         99 KKFACETCG  107 (129)
Q Consensus        99 ~~~~C~~C~  107 (129)
                      .+|.|+.||
T Consensus        47 ~~Y~CP~CG   55 (59)
T PRK14890         47 NPYTCPKCG   55 (59)
T ss_pred             CceECCCCC
Confidence            345555554


No 82 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.59  E-value=1.2  Score=26.11  Aligned_cols=35  Identities=17%  Similarity=0.493  Sum_probs=26.6

Q ss_pred             hCCCCCeecccccccccChhHHHHHHHHhcCCCcccCCcccccc
Q psy13123         67 HGGLKPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLF  110 (129)
Q Consensus        67 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  110 (129)
                      .....-|.|+.|+..|+....+.         --|.|+.||...
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            44456799999998887776664         259999999764


No 83 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=85.37  E-value=0.33  Score=22.00  Aligned_cols=10  Identities=40%  Similarity=1.474  Sum_probs=5.7

Q ss_pred             cccCcchhcc
Q psy13123         17 YQCGECGKQF   26 (129)
Q Consensus        17 ~~C~~C~~~~   26 (129)
                      |.|+.||..+
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            5566666554


No 84 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.13  E-value=0.5  Score=26.86  Aligned_cols=24  Identities=46%  Similarity=0.822  Sum_probs=14.0

Q ss_pred             cccCCccccccCCHHHHHHHHHHhccc
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRTHKGE  126 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~h~~e  126 (129)
                      ...|-+||+.|...   .+|+++|+|-
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             eeEEccCCcccchH---HHHHHHccCC
Confidence            45688888888654   7888888553


No 85 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=85.00  E-value=1.7  Score=19.22  Aligned_cols=23  Identities=22%  Similarity=0.442  Sum_probs=15.4

Q ss_pred             cccCcchhccCCh--hhHHHHHHHh
Q psy13123         17 YQCGECGKQFTRK--FSLNAHLHVH   39 (129)
Q Consensus        17 ~~C~~C~~~~~~~--~~l~~h~~~~   39 (129)
                      -.|+.||+.|...  .+...|.+.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            5788899887643  4456666655


No 86 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.87  E-value=0.19  Score=21.97  Aligned_cols=30  Identities=30%  Similarity=0.798  Sum_probs=15.5

Q ss_pred             ccccCcchhccCChhhHHHHHHHhCCCCCccCCcchh
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGK   52 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   52 (129)
                      .|.|..||..|......       .......|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~-------~~~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI-------SDDPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEec-------CCCCCCCCCCCCC
Confidence            36677777766433221       1133445666665


No 87 
>KOG2593|consensus
Probab=84.46  E-value=0.33  Score=32.86  Aligned_cols=39  Identities=26%  Similarity=0.627  Sum_probs=20.0

Q ss_pred             CCCCCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchh
Q psy13123         11 ATTTSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGK   52 (129)
Q Consensus        11 ~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   52 (129)
                      -+....|.|+.|.+.|...   ...+........|.|..|+.
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~L---ea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSL---EALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             ccccccccCCccccchhhh---HHHHhhcccCceEEEecCCC
Confidence            3444456677777666333   23333333345566666653


No 88 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=84.34  E-value=0.49  Score=29.21  Aligned_cols=23  Identities=30%  Similarity=0.665  Sum_probs=11.0

Q ss_pred             CeecccccccccChhHHHHHHHH
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDA   94 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~   94 (129)
                      .|.|..|++.|.....+..|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            35555555555555555555543


No 89 
>KOG4173|consensus
Probab=83.68  E-value=1.2  Score=27.25  Aligned_cols=74  Identities=27%  Similarity=0.578  Sum_probs=52.3

Q ss_pred             ccCCc--chhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHh----------cCCCcccC--Ccccccc
Q psy13123         45 YKCPL--CGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAH----------LGVKKFAC--ETCGKLF  110 (129)
Q Consensus        45 ~~c~~--c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~----------~~~~~~~C--~~C~~~f  110 (129)
                      +.|+.  |...|........|...-++.   .|.+|.++|...-.|..|+.-.          .|.-.|.|  ..|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            56765  666777777677665543332   7999999998888888887533          33456888  4599999


Q ss_pred             CCHHHHHHHHH
Q psy13123        111 SSKHGLKYHVR  121 (129)
Q Consensus       111 ~~~~~l~~h~~  121 (129)
                      .....-..|+.
T Consensus       157 kT~r~RkdH~I  167 (253)
T KOG4173|consen  157 KTSRDRKDHMI  167 (253)
T ss_pred             hhhhhhhhHHH
Confidence            88888777754


No 90 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.74  E-value=0.74  Score=20.75  Aligned_cols=11  Identities=55%  Similarity=1.419  Sum_probs=6.2

Q ss_pred             cccCcchhccC
Q psy13123         17 YQCGECGKQFT   27 (129)
Q Consensus        17 ~~C~~C~~~~~   27 (129)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            55666666543


No 91 
>KOG2482|consensus
Probab=82.59  E-value=2.5  Score=28.10  Aligned_cols=53  Identities=25%  Similarity=0.479  Sum_probs=37.1

Q ss_pred             ccccCcchhccC-ChhhHHHHHHH-hC---C------------------CCCccCCcchhhhcchhHHHHHHHHhC
Q psy13123         16 AYQCGECGKQFT-RKFSLNAHLHV-HY---G------------------SSNYKCPLCGKFFIQLCHMKDHIQAHG   68 (129)
Q Consensus        16 ~~~C~~C~~~~~-~~~~l~~h~~~-~~---~------------------~~~~~c~~c~~~~~~~~~l~~~~~~~~   68 (129)
                      +..|-.|...+. .++....|+-. |.   |                  -..+.|..|.+.|.....|..||+...
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~  219 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKR  219 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhcc
Confidence            356888886654 45666666642 31   1                  123889999999999999999998643


No 92 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=82.37  E-value=1.5  Score=29.08  Aligned_cols=20  Identities=30%  Similarity=0.582  Sum_probs=10.4

Q ss_pred             CCccccccCCHHHHHHHHHH
Q psy13123        103 CETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       103 C~~C~~~f~~~~~l~~h~~~  122 (129)
                      |..|...|.....|.+|.|.
T Consensus       223 C~FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hhhccceecChHHHHHHHHh
Confidence            44555555555555555443


No 93 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=81.15  E-value=0.23  Score=29.02  Aligned_cols=12  Identities=42%  Similarity=0.883  Sum_probs=6.5

Q ss_pred             eecccccccccC
Q psy13123         73 YVCTYCGKAFVR   84 (129)
Q Consensus        73 ~~c~~c~~~~~~   84 (129)
                      +.|+.||..|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455556555544


No 94 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=80.79  E-value=0.95  Score=25.43  Aligned_cols=30  Identities=20%  Similarity=0.296  Sum_probs=19.0

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcch
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQL   57 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   57 (129)
                      ..|+.||..|...           +..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            3577777776432           34667777777766544


No 95 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=78.95  E-value=1.2  Score=23.48  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=8.8

Q ss_pred             CCccCCcchhhhcc
Q psy13123         43 SNYKCPLCGKFFIQ   56 (129)
Q Consensus        43 ~~~~c~~c~~~~~~   56 (129)
                      .|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45667777766654


No 96 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.17  E-value=0.88  Score=28.88  Aligned_cols=26  Identities=27%  Similarity=0.511  Sum_probs=16.5

Q ss_pred             CCcccCCccccccCCHHHHHHHHHHh
Q psy13123         98 VKKFACETCGKLFSSKHGLKYHVRTH  123 (129)
Q Consensus        98 ~~~~~C~~C~~~f~~~~~l~~h~~~h  123 (129)
                      .+++.|+.||.......+|..-.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            46677888877666665665555544


No 97 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=76.49  E-value=2.2  Score=19.19  Aligned_cols=22  Identities=23%  Similarity=0.413  Sum_probs=15.3

Q ss_pred             ccCCccccccCCHHHHHHHHHH
Q psy13123        101 FACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      |+|-+|..+..-.+.|-.|++.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5577777777777777777653


No 98 
>KOG4167|consensus
Probab=76.17  E-value=0.87  Score=33.19  Aligned_cols=28  Identities=43%  Similarity=0.736  Sum_probs=22.8

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCC
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYG   41 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~   41 (129)
                      ...|.|.+|++.|...-.+..||..|.-
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3458899999999888888899988853


No 99 
>KOG2785|consensus
Probab=75.77  E-value=5.9  Score=26.79  Aligned_cols=52  Identities=19%  Similarity=0.485  Sum_probs=38.3

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCC-----------------------CCeeccccc---ccccChhHHHHHHHH
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGL-----------------------KPYVCTYCG---KAFVRASDLKRHIDA   94 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~-----------------------~~~~c~~c~---~~~~~~~~l~~h~~~   94 (129)
                      .|-.|..|+..+++...-..||..++|-                       ..+.|..|+   +.|.+......||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            3466777777777776667777766652                       347888888   888888889999874


No 100
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=75.29  E-value=1  Score=25.72  Aligned_cols=14  Identities=21%  Similarity=0.603  Sum_probs=9.5

Q ss_pred             CeecccccccccCh
Q psy13123         72 PYVCTYCGKAFVRA   85 (129)
Q Consensus        72 ~~~c~~c~~~~~~~   85 (129)
                      .+.|..||..|...
T Consensus        70 ~~~C~~CG~~~~~~   83 (135)
T PRK03824         70 VLKCRNCGNEWSLK   83 (135)
T ss_pred             EEECCCCCCEEecc
Confidence            46788888766543


No 101
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=75.20  E-value=0.29  Score=19.76  Aligned_cols=9  Identities=44%  Similarity=1.036  Sum_probs=4.7

Q ss_pred             cCCcccccc
Q psy13123        102 ACETCGKLF  110 (129)
Q Consensus       102 ~C~~C~~~f  110 (129)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 102
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=75.19  E-value=1.2  Score=17.30  Aligned_cols=9  Identities=33%  Similarity=1.139  Sum_probs=7.4

Q ss_pred             ccccCcchh
Q psy13123         16 AYQCGECGK   24 (129)
Q Consensus        16 ~~~C~~C~~   24 (129)
                      .|.|+.||+
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            689999984


No 103
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=75.13  E-value=1.6  Score=17.27  Aligned_cols=10  Identities=40%  Similarity=0.919  Sum_probs=5.9

Q ss_pred             cCCccccccC
Q psy13123        102 ACETCGKLFS  111 (129)
Q Consensus       102 ~C~~C~~~f~  111 (129)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            4666666653


No 104
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=74.85  E-value=0.45  Score=31.10  Aligned_cols=72  Identities=21%  Similarity=0.444  Sum_probs=36.8

Q ss_pred             CccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHH
Q psy13123         15 SAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDA   94 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~   94 (129)
                      ....|+.||..-.. +.+  +.....|.+-..|..|+-.+...              ...|+.|+..    ..+. ....
T Consensus       186 ~~~~CPvCGs~P~~-s~v--~~~~~~G~RyL~CslC~teW~~~--------------R~~C~~Cg~~----~~l~-y~~~  243 (309)
T PRK03564        186 QRQFCPVCGSMPVS-SVV--QIGTTQGLRYLHCNLCESEWHVV--------------RVKCSNCEQS----GKLH-YWSL  243 (309)
T ss_pred             CCCCCCCCCCcchh-hee--eccCCCCceEEEcCCCCCccccc--------------CccCCCCCCC----Ccee-eeee
Confidence            34578888875321 111  12224466777888887544321              2368888852    1111 1111


Q ss_pred             h---cCCCcccCCcccc
Q psy13123         95 H---LGVKKFACETCGK  108 (129)
Q Consensus        95 ~---~~~~~~~C~~C~~  108 (129)
                      .   ...+...|..|+.
T Consensus       244 ~~~~~~~r~e~C~~C~~  260 (309)
T PRK03564        244 DSEQAAVKAESCGDCGT  260 (309)
T ss_pred             cCCCcceEeeecccccc
Confidence            1   2345677888864


No 105
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=74.52  E-value=8.6  Score=20.91  Aligned_cols=24  Identities=25%  Similarity=0.523  Sum_probs=17.5

Q ss_pred             ccc----CcchhccCChhhHHHHHHHhC
Q psy13123         17 YQC----GECGKQFTRKFSLNAHLHVHY   40 (129)
Q Consensus        17 ~~C----~~C~~~~~~~~~l~~h~~~~~   40 (129)
                      |.|    ..|+....+...+..|++.++
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            667    777777777777777776554


No 106
>PHA00626 hypothetical protein
Probab=74.00  E-value=1.8  Score=20.56  Aligned_cols=15  Identities=27%  Similarity=0.578  Sum_probs=11.1

Q ss_pred             CcccCCccccccCCH
Q psy13123         99 KKFACETCGKLFSSK  113 (129)
Q Consensus        99 ~~~~C~~C~~~f~~~  113 (129)
                      ..|+|+.||..|...
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            568888888877654


No 107
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=73.76  E-value=1.1  Score=25.37  Aligned_cols=28  Identities=32%  Similarity=0.680  Sum_probs=18.9

Q ss_pred             ccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhh
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKF   53 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   53 (129)
                      |++|-.||..|.+.+.          +.-.-|+.||..
T Consensus         1 PH~Ct~Cg~~f~dgs~----------eil~GCP~CGg~   28 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSK----------EILSGCPECGGN   28 (131)
T ss_pred             CcccCcCCCCcCCCcH----------HHHccCcccCCc
Confidence            6789999999987652          112358888754


No 108
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=73.64  E-value=2  Score=19.90  Aligned_cols=10  Identities=40%  Similarity=1.241  Sum_probs=5.6

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      |.|..|++.+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555554


No 109
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=72.82  E-value=1.5  Score=22.91  Aligned_cols=34  Identities=24%  Similarity=0.643  Sum_probs=22.0

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChh
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRAS   86 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~   86 (129)
                      ..+.|+.|++.-.        .+  .+..-|.|..|+..|...+
T Consensus        34 ~~~~Cp~C~~~~V--------kR--~a~GIW~C~kCg~~fAGga   67 (89)
T COG1997          34 AKHVCPFCGRTTV--------KR--IATGIWKCRKCGAKFAGGA   67 (89)
T ss_pred             cCCcCCCCCCcce--------ee--eccCeEEcCCCCCeecccc
Confidence            4678999987511        11  2234789999998776543


No 110
>PRK04023 DNA polymerase II large subunit; Validated
Probab=72.47  E-value=4.4  Score=31.08  Aligned_cols=9  Identities=44%  Similarity=1.062  Sum_probs=5.5

Q ss_pred             ccCCccccc
Q psy13123        101 FACETCGKL  109 (129)
Q Consensus       101 ~~C~~C~~~  109 (129)
                      +.|+.||..
T Consensus       664 y~CPKCG~E  672 (1121)
T PRK04023        664 DECEKCGRE  672 (1121)
T ss_pred             CcCCCCCCC
Confidence            557777643


No 111
>KOG2807|consensus
Probab=71.95  E-value=4.5  Score=26.75  Aligned_cols=24  Identities=25%  Similarity=0.660  Sum_probs=18.3

Q ss_pred             cccCCccccccCCHHHHHHHHHHh
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRTH  123 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~h  123 (129)
                      .|.|..|...|...-+.-.|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            478888888888887777776655


No 112
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=71.92  E-value=1.2  Score=22.54  Aligned_cols=15  Identities=20%  Similarity=0.560  Sum_probs=6.7

Q ss_pred             CCCeecc--cccccccC
Q psy13123         70 LKPYVCT--YCGKAFVR   84 (129)
Q Consensus        70 ~~~~~c~--~c~~~~~~   84 (129)
                      +..+.|.  .||..|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            3344454  45544433


No 113
>KOG4173|consensus
Probab=71.89  E-value=2.6  Score=25.87  Aligned_cols=48  Identities=31%  Similarity=0.578  Sum_probs=23.9

Q ss_pred             ccCcchhccCChhhHHHHHH-Hh---------CCCCCccCC--cchhhhcchhHHHHHHH
Q psy13123         18 QCGECGKQFTRKFSLNAHLH-VH---------YGSSNYKCP--LCGKFFIQLCHMKDHIQ   65 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~-~~---------~~~~~~~c~--~c~~~~~~~~~l~~~~~   65 (129)
                      .|..|.+.|.+...|..|+. .|         .|...|.|.  .|+..|+....-..|+.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHH
Confidence            45556666655555555542 11         233445552  35555555555555543


No 114
>KOG3408|consensus
Probab=71.44  E-value=4.2  Score=22.74  Aligned_cols=29  Identities=21%  Similarity=0.431  Sum_probs=19.1

Q ss_pred             CCCCCCccccCcchhccCChhhHHHHHHH
Q psy13123         10 LATTTSAYQCGECGKQFTRKFSLNAHLHV   38 (129)
Q Consensus        10 ~~~~~~~~~C~~C~~~~~~~~~l~~h~~~   38 (129)
                      .-.|...|-|-+|.+-|.+...|..|.+.
T Consensus        51 dlPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   51 DLPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            34455567777777777777777777653


No 115
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=68.79  E-value=1.5  Score=17.98  Aligned_cols=7  Identities=57%  Similarity=1.445  Sum_probs=3.2

Q ss_pred             eeccccc
Q psy13123         73 YVCTYCG   79 (129)
Q Consensus        73 ~~c~~c~   79 (129)
                      ++|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444444


No 116
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=68.26  E-value=0.88  Score=21.27  Aligned_cols=24  Identities=25%  Similarity=0.627  Sum_probs=9.9

Q ss_pred             ccccCcchhccCChhhHHHHHHHh
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      .|.|+.|...|-...++-+|...|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-
T ss_pred             eEECCCCCCccccCcChhhhcccc
Confidence            466666666665555555544444


No 117
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=68.07  E-value=2  Score=19.01  Aligned_cols=12  Identities=42%  Similarity=1.154  Sum_probs=8.3

Q ss_pred             ccCCccccccCC
Q psy13123        101 FACETCGKLFSS  112 (129)
Q Consensus       101 ~~C~~C~~~f~~  112 (129)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            668888876643


No 118
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=67.01  E-value=2  Score=18.84  Aligned_cols=15  Identities=27%  Similarity=0.738  Sum_probs=6.3

Q ss_pred             ccCCcchhhhcchhH
Q psy13123         45 YKCPLCGKFFIQLCH   59 (129)
Q Consensus        45 ~~c~~c~~~~~~~~~   59 (129)
                      ..|+.|+..|.....
T Consensus        20 d~C~~C~G~W~d~~e   34 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGE   34 (41)
T ss_pred             EECCCCCeEEccHHH
Confidence            334444444444333


No 119
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=66.64  E-value=1.1  Score=19.29  Aligned_cols=9  Identities=33%  Similarity=1.228  Sum_probs=4.7

Q ss_pred             ccCcchhcc
Q psy13123         18 QCGECGKQF   26 (129)
Q Consensus        18 ~C~~C~~~~   26 (129)
                      .|+.||..|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            355555554


No 120
>KOG4167|consensus
Probab=66.54  E-value=1.4  Score=32.20  Aligned_cols=25  Identities=36%  Similarity=0.816  Sum_probs=22.6

Q ss_pred             cccCCccccccCCHHHHHHHHHHhc
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRTHK  124 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~h~  124 (129)
                      .|-|..|+|.|--.-.+..|+++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4889999999999999999999985


No 121
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=65.74  E-value=4  Score=17.02  Aligned_cols=9  Identities=33%  Similarity=1.088  Sum_probs=4.7

Q ss_pred             cccCCcccc
Q psy13123        100 KFACETCGK  108 (129)
Q Consensus       100 ~~~C~~C~~  108 (129)
                      +..|..||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            346666664


No 122
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=64.65  E-value=2.3  Score=31.42  Aligned_cols=12  Identities=25%  Similarity=0.570  Sum_probs=7.1

Q ss_pred             ccCcchhccCCh
Q psy13123         18 QCGECGKQFTRK   29 (129)
Q Consensus        18 ~C~~C~~~~~~~   29 (129)
                      .|..||..+...
T Consensus       437 ~C~~Cg~v~~Cp  448 (730)
T COG1198         437 LCRDCGYIAECP  448 (730)
T ss_pred             ecccCCCcccCC
Confidence            366666665543


No 123
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=64.58  E-value=5.2  Score=18.91  Aligned_cols=25  Identities=16%  Similarity=0.466  Sum_probs=10.2

Q ss_pred             hHHHHHHHHhcCCCcccCCc----ccccc
Q psy13123         86 SDLKRHIDAHLGVKKFACET----CGKLF  110 (129)
Q Consensus        86 ~~l~~h~~~~~~~~~~~C~~----C~~~f  110 (129)
                      ..|..|....=..++..|..    |+..+
T Consensus        24 ~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen   24 KELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             CCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             HHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            34555555322234455555    55444


No 124
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=64.52  E-value=8.9  Score=25.32  Aligned_cols=78  Identities=24%  Similarity=0.480  Sum_probs=43.5

Q ss_pred             CccCCcchhhhcchhHHHHHHHHhCCCCCe------------ecccccccccChhHHHHHHHHhcCCCcccCCccccccC
Q psy13123         44 NYKCPLCGKFFIQLCHMKDHIQAHGGLKPY------------VCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFS  111 (129)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~------------~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  111 (129)
                      |-.|+.|.........|.+....--..++|            -|..|-..|..+..-..  -..+....|.|..|...|.
T Consensus       322 Pi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~--~~~~ss~rY~Ce~CK~~FC  399 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPF--DESTSSGRYQCELCKSTFC  399 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCCCcc--cccccccceechhhhhhhh
Confidence            456777776666666666543221111222            25556554443322110  0112234589999999999


Q ss_pred             CHHHHHHHHHHh
Q psy13123        112 SKHGLKYHVRTH  123 (129)
Q Consensus       112 ~~~~l~~h~~~h  123 (129)
                      ..-+.-.|...|
T Consensus       400 ~dCdvfiHe~Lh  411 (421)
T COG5151         400 SDCDVFIHETLH  411 (421)
T ss_pred             hhhHHHHHHHHh
Confidence            888888887665


No 125
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=63.57  E-value=3  Score=22.42  Aligned_cols=17  Identities=29%  Similarity=0.675  Sum_probs=12.7

Q ss_pred             CCCCCccccCcchhccCC
Q psy13123         11 ATTTSAYQCGECGKQFTR   28 (129)
Q Consensus        11 ~~~~~~~~C~~C~~~~~~   28 (129)
                      +.+ ++.+|.+||..|+.
T Consensus        75 ~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          75 EKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             eCC-CceeCCCCCcEEEE
Confidence            344 68889999988864


No 126
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.20  E-value=1.3  Score=27.70  Aligned_cols=24  Identities=13%  Similarity=0.448  Sum_probs=16.1

Q ss_pred             ccccCcchhccCChhhHHHHHHHh
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      -+.|++|+..|..+.......++-
T Consensus        19 ~ieCPvC~tkFkkeev~tgsiRii   42 (267)
T COG1655          19 TIECPVCNTKFKKEEVKTGSIRII   42 (267)
T ss_pred             eeccCcccchhhhhheeccceeEe
Confidence            467888888887776655544443


No 127
>PLN02294 cytochrome c oxidase subunit Vb
Probab=63.07  E-value=3.2  Score=24.69  Aligned_cols=16  Identities=19%  Similarity=0.646  Sum_probs=12.3

Q ss_pred             CCccccCcchhccCCh
Q psy13123         14 TSAYQCGECGKQFTRK   29 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~   29 (129)
                      ++|.+|++||..|+.+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4578899999888654


No 128
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=62.19  E-value=7.1  Score=19.15  Aligned_cols=10  Identities=40%  Similarity=0.979  Sum_probs=4.5

Q ss_pred             cccCCccccc
Q psy13123        100 KFACETCGKL  109 (129)
Q Consensus       100 ~~~C~~C~~~  109 (129)
                      .+.|+.||..
T Consensus        46 ~~~C~~Cg~~   55 (69)
T PF07282_consen   46 VFTCPNCGFE   55 (69)
T ss_pred             eEEcCCCCCE
Confidence            3444444444


No 129
>KOG2893|consensus
Probab=62.11  E-value=2.1  Score=26.86  Aligned_cols=47  Identities=21%  Similarity=0.411  Sum_probs=32.0

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHH
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQ   65 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~   65 (129)
                      .++ .|=.|+..|.+..-|..|+..    +-|.|.+|-+...+...|..|..
T Consensus         9 ~kp-wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcm   55 (341)
T KOG2893|consen    9 DKP-WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCM   55 (341)
T ss_pred             CCc-eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehh
Confidence            344 455788888888777776654    34778888876666666665544


No 130
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=61.97  E-value=1.3  Score=20.96  Aligned_cols=11  Identities=45%  Similarity=1.183  Sum_probs=6.4

Q ss_pred             ccCcchhccCC
Q psy13123         18 QCGECGKQFTR   28 (129)
Q Consensus        18 ~C~~C~~~~~~   28 (129)
                      +|..||+.|+.
T Consensus         7 ~C~~Cg~~~~~   17 (54)
T PF14446_consen    7 KCPVCGKKFKD   17 (54)
T ss_pred             cChhhCCcccC
Confidence            46666666543


No 131
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=61.88  E-value=3.5  Score=18.00  Aligned_cols=14  Identities=29%  Similarity=0.999  Sum_probs=11.4

Q ss_pred             ccccCcchhccCCh
Q psy13123         16 AYQCGECGKQFTRK   29 (129)
Q Consensus        16 ~~~C~~C~~~~~~~   29 (129)
                      ||.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999988654


No 132
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=61.62  E-value=42  Score=22.78  Aligned_cols=73  Identities=22%  Similarity=0.481  Sum_probs=43.6

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcch----hhhcchhHHHHHHHHhCCCCCeeccc--cc----ccccChhH
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCG----KFFIQLCHMKDHIQAHGGLKPYVCTY--CG----KAFVRASD   87 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~----~~~~~~~~l~~~~~~~~~~~~~~c~~--c~----~~~~~~~~   87 (129)
                      .|..|..-|.+...|..|++.-+ ++-+.|..-+    ..|+....|..|-...    .|.|.+  |.    .+|.....
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~----hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRNA----HYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhcC----ceEEEEEEEecCcEEEeccHHH
Confidence            37788888888888888877543 3444454322    3466666666664432    245433  32    36777777


Q ss_pred             HHHHHHHh
Q psy13123         88 LKRHIDAH   95 (129)
Q Consensus        88 l~~h~~~~   95 (129)
                      |+.|+..-
T Consensus       297 l~~h~~~~  304 (493)
T COG5236         297 LLEHLTRF  304 (493)
T ss_pred             HHHHHHHH
Confidence            77776543


No 133
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=61.61  E-value=2  Score=28.17  Aligned_cols=48  Identities=19%  Similarity=0.368  Sum_probs=24.9

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      -.|+.||..-.. +. ........|.+-..|..|+-.+...              -..|+.|+.
T Consensus       185 ~~CPvCGs~P~~-s~-~~~~~~~~G~RyL~CslC~teW~~~--------------R~~C~~Cg~  232 (305)
T TIGR01562       185 TLCPACGSPPVA-SM-VRQGGKETGLRYLSCSLCATEWHYV--------------RVKCSHCEE  232 (305)
T ss_pred             CcCCCCCChhhh-hh-hcccCCCCCceEEEcCCCCCccccc--------------CccCCCCCC
Confidence            468888875211 00 0000013456677788776544321              236888875


No 134
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=60.48  E-value=11  Score=21.59  Aligned_cols=15  Identities=20%  Similarity=0.574  Sum_probs=7.9

Q ss_pred             CCCCccCCcchhhhc
Q psy13123         41 GSSNYKCPLCGKFFI   55 (129)
Q Consensus        41 ~~~~~~c~~c~~~~~   55 (129)
                      +.+.|+|..|..+..
T Consensus        77 d~~lYeCnIC~etS~   91 (140)
T PF05290_consen   77 DPKLYECNICKETSA   91 (140)
T ss_pred             CCCceeccCcccccc
Confidence            335566666655433


No 135
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=60.21  E-value=4.8  Score=25.04  Aligned_cols=25  Identities=36%  Similarity=0.816  Sum_probs=12.7

Q ss_pred             ccCCcchhhhcchhHHHHHHHHhCC
Q psy13123         45 YKCPLCGKFFIQLCHMKDHIQAHGG   69 (129)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~~~~~~~~   69 (129)
                      |.|..|++.|.-...+..|+...+.
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCH
Confidence            5566666666666555556555443


No 136
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=60.02  E-value=3.7  Score=19.46  Aligned_cols=10  Identities=30%  Similarity=1.022  Sum_probs=4.6

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      +.|+.|+..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            3455555433


No 137
>KOG2923|consensus
Probab=59.55  E-value=5.9  Score=19.40  Aligned_cols=12  Identities=33%  Similarity=0.899  Sum_probs=6.9

Q ss_pred             CCCCccCCcchh
Q psy13123         41 GSSNYKCPLCGK   52 (129)
Q Consensus        41 ~~~~~~c~~c~~   52 (129)
                      |+....|+-|+.
T Consensus        41 ge~Va~CpsCSL   52 (67)
T KOG2923|consen   41 GEDVARCPSCSL   52 (67)
T ss_pred             CCeeecCCCceE
Confidence            555556666554


No 138
>KOG2807|consensus
Probab=58.91  E-value=13  Score=24.84  Aligned_cols=30  Identities=30%  Similarity=0.667  Sum_probs=21.3

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccc
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCG  107 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~  107 (129)
                      .|.|..|...|-.--+...|-..|      .|+.|.
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence            477888888887777777776655      566664


No 139
>KOG2593|consensus
Probab=57.31  E-value=16  Score=25.26  Aligned_cols=38  Identities=24%  Similarity=0.572  Sum_probs=25.8

Q ss_pred             CCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         40 YGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        40 ~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      +...-|.|+.|++.|.....++   ......-.|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            4556699999999888765443   2333234688998885


No 140
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.43  E-value=7  Score=19.91  Aligned_cols=32  Identities=28%  Similarity=0.719  Sum_probs=18.8

Q ss_pred             CccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhh
Q psy13123         15 SAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKF   53 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   53 (129)
                      ..|+|.+|+..|    .+..+|   +...--.|+.|+..
T Consensus        11 Y~Y~c~~cg~~~----dvvq~~---~ddplt~ce~c~a~   42 (82)
T COG2331          11 YSYECTECGNRF----DVVQAM---TDDPLTTCEECGAR   42 (82)
T ss_pred             eEEeecccchHH----HHHHhc---ccCccccChhhChH
Confidence            458888888865    322222   23344568888764


No 141
>KOG1280|consensus
Probab=56.22  E-value=12  Score=25.12  Aligned_cols=22  Identities=18%  Similarity=0.424  Sum_probs=12.5

Q ss_pred             ccccCcchhccCChhhHHHHHH
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLH   37 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~   37 (129)
                      .|.|+.|+..-.+...+..|..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~  100 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVL  100 (381)
T ss_pred             cccCCcccccccchhHHHHHhh
Confidence            4666666655555555555544


No 142
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=56.20  E-value=7.7  Score=22.45  Aligned_cols=49  Identities=14%  Similarity=0.271  Sum_probs=28.4

Q ss_pred             eecccccccccChhHHHH--HHH---HhcCCCcccCCccccccCCHHHHHHHHH
Q psy13123         73 YVCTYCGKAFVRASDLKR--HID---AHLGVKKFACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~--h~~---~~~~~~~~~C~~C~~~f~~~~~l~~h~~  121 (129)
                      ..|+.|+..+.....-..  -..   ....+..+.|+.||+.|...+++.+-.+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~~~~  145 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRRMEE  145 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHHHHh
Confidence            468888865533221110  001   1122346789999999988888766543


No 143
>KOG0978|consensus
Probab=55.96  E-value=2.2  Score=31.21  Aligned_cols=15  Identities=20%  Similarity=0.567  Sum_probs=9.5

Q ss_pred             cCCccccccCCHHHH
Q psy13123        102 ACETCGKLFSSKHGL  116 (129)
Q Consensus       102 ~C~~C~~~f~~~~~l  116 (129)
                      +||.||.+|....-+
T Consensus       680 KCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  680 KCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCccccc
Confidence            677777777655443


No 144
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=55.19  E-value=12  Score=16.83  Aligned_cols=10  Identities=30%  Similarity=1.102  Sum_probs=5.3

Q ss_pred             CcccCCcccc
Q psy13123         99 KKFACETCGK  108 (129)
Q Consensus        99 ~~~~C~~C~~  108 (129)
                      ..|+|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            4456655543


No 145
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=54.46  E-value=3.3  Score=21.88  Aligned_cols=34  Identities=26%  Similarity=0.724  Sum_probs=22.0

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChh
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRAS   86 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~   86 (129)
                      ..|.|+.|++.-..          -.+...|.|..|++.|...+
T Consensus        35 a~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~AGGA   68 (90)
T PTZ00255         35 AKYFCPFCGKHAVK----------RQAVGIWRCKGCKKTVAGGA   68 (90)
T ss_pred             CCccCCCCCCCcee----------eeeeEEEEcCCCCCEEeCCc
Confidence            47889999753221          12234789999998776543


No 146
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.15  E-value=6.9  Score=21.46  Aligned_cols=26  Identities=27%  Similarity=0.376  Sum_probs=16.7

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhh
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFF   54 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   54 (129)
                      +|+.||+.|..           .+..|..|+.||+.|
T Consensus        11 idPetg~KFYD-----------LNrdPiVsPytG~s~   36 (129)
T COG4530          11 IDPETGKKFYD-----------LNRDPIVSPYTGKSY   36 (129)
T ss_pred             cCccccchhhc-----------cCCCccccCcccccc
Confidence            46677776633           145677777777776


No 147
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=54.01  E-value=8  Score=17.66  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=6.1

Q ss_pred             Ceecccccccc
Q psy13123         72 PYVCTYCGKAF   82 (129)
Q Consensus        72 ~~~c~~c~~~~   82 (129)
                      .+.|+.|+..+
T Consensus        20 ~~vC~~Cg~~~   30 (52)
T smart00661       20 RFVCRKCGYEE   30 (52)
T ss_pred             EEECCcCCCeE
Confidence            45666666543


No 148
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=53.80  E-value=8.7  Score=20.81  Aligned_cols=14  Identities=36%  Similarity=0.833  Sum_probs=9.1

Q ss_pred             ccccCcchhccCCh
Q psy13123         16 AYQCGECGKQFTRK   29 (129)
Q Consensus        16 ~~~C~~C~~~~~~~   29 (129)
                      |+.|--||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45677777777654


No 149
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=52.94  E-value=18  Score=28.87  Aligned_cols=10  Identities=50%  Similarity=1.195  Sum_probs=6.4

Q ss_pred             Ceeccccccc
Q psy13123         72 PYVCTYCGKA   81 (129)
Q Consensus        72 ~~~c~~c~~~   81 (129)
                      .+.|+.|+..
T Consensus       692 vy~CPsCGae  701 (1337)
T PRK14714        692 VYVCPDCGAE  701 (1337)
T ss_pred             ceeCccCCCc
Confidence            4567777754


No 150
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=51.96  E-value=4.7  Score=17.89  Aligned_cols=15  Identities=40%  Similarity=0.990  Sum_probs=9.4

Q ss_pred             CccccCcchhccCCh
Q psy13123         15 SAYQCGECGKQFTRK   29 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~   29 (129)
                      -|+.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899999988654


No 151
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=51.43  E-value=6.4  Score=18.26  Aligned_cols=13  Identities=31%  Similarity=1.030  Sum_probs=6.5

Q ss_pred             CccccCcchhccC
Q psy13123         15 SAYQCGECGKQFT   27 (129)
Q Consensus        15 ~~~~C~~C~~~~~   27 (129)
                      +.+.|..||..|.
T Consensus         3 k~l~C~dCg~~Fv   15 (49)
T PF13451_consen    3 KTLTCKDCGAEFV   15 (49)
T ss_pred             eeEEcccCCCeEE
Confidence            3445555555543


No 152
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=50.98  E-value=7.4  Score=21.50  Aligned_cols=11  Identities=18%  Similarity=0.235  Sum_probs=5.6

Q ss_pred             ccCCcchhhhc
Q psy13123         45 YKCPLCGKFFI   55 (129)
Q Consensus        45 ~~c~~c~~~~~   55 (129)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            45555554443


No 153
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=50.64  E-value=1  Score=19.80  Aligned_cols=10  Identities=30%  Similarity=1.225  Sum_probs=5.4

Q ss_pred             ccCCcccccc
Q psy13123        101 FACETCGKLF  110 (129)
Q Consensus       101 ~~C~~C~~~f  110 (129)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            5565565543


No 154
>PF12773 DZR:  Double zinc ribbon
Probab=49.92  E-value=16  Score=16.55  Aligned_cols=8  Identities=38%  Similarity=1.202  Sum_probs=3.6

Q ss_pred             eecccccc
Q psy13123         73 YVCTYCGK   80 (129)
Q Consensus        73 ~~c~~c~~   80 (129)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34444443


No 155
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=49.85  E-value=8.6  Score=21.84  Aligned_cols=36  Identities=22%  Similarity=0.605  Sum_probs=21.0

Q ss_pred             eecccccccccChhHHHHHHHHhcCCCcccCCccccccCCH
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSSK  113 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~  113 (129)
                      -.|+.|+........     ..-.+...|+|..|++.|...
T Consensus        31 ~~cP~C~s~~~~k~g-----~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          31 VNCPRCKSSNVVKIG-----GIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             CcCCCCCccceeeEC-----CccccccccccCCcCcceeee
Confidence            468887643311111     112336679999999998543


No 156
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=49.56  E-value=5.1  Score=17.18  Aligned_cols=15  Identities=33%  Similarity=0.602  Sum_probs=8.2

Q ss_pred             cCCccccccCCHHHH
Q psy13123        102 ACETCGKLFSSKHGL  116 (129)
Q Consensus       102 ~C~~C~~~f~~~~~l  116 (129)
                      .|..|++.|...++.
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            467777777666554


No 157
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=49.29  E-value=16  Score=21.73  Aligned_cols=49  Identities=16%  Similarity=0.350  Sum_probs=29.4

Q ss_pred             eecccccccccChhHHHHH--HH--H-hcCCCcccCCccccccCCHHHHHHHHH
Q psy13123         73 YVCTYCGKAFVRASDLKRH--ID--A-HLGVKKFACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h--~~--~-~~~~~~~~C~~C~~~f~~~~~l~~h~~  121 (129)
                      -.|+.|+......+.-..-  ..  . -..+.-+.|+.||+.|...+++..-.+
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccCchHHHHHHH
Confidence            4689998654433221100  00  0 112345779999999999999877655


No 158
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=49.15  E-value=9.1  Score=21.21  Aligned_cols=12  Identities=17%  Similarity=0.487  Sum_probs=7.1

Q ss_pred             eecccccccccC
Q psy13123         73 YVCTYCGKAFVR   84 (129)
Q Consensus        73 ~~c~~c~~~~~~   84 (129)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            457777755544


No 159
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=49.11  E-value=21  Score=21.57  Aligned_cols=35  Identities=23%  Similarity=0.509  Sum_probs=17.6

Q ss_pred             hCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccc
Q psy13123         39 HYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAF   82 (129)
Q Consensus        39 ~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~   82 (129)
                      .++..-|.|+.|...+.....+.      .   -|.|+.||...
T Consensus       108 ~~~~~~y~C~~~~~r~sfdeA~~------~---~F~Cp~Cg~~L  142 (176)
T COG1675         108 ETENNYYVCPNCHVKYSFDEAME------L---GFTCPKCGEDL  142 (176)
T ss_pred             hccCCceeCCCCCCcccHHHHHH------h---CCCCCCCCchh
Confidence            34445566666655544333222      1   16677776543


No 160
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=48.88  E-value=3.6  Score=21.80  Aligned_cols=34  Identities=32%  Similarity=0.886  Sum_probs=21.5

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChh
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRAS   86 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~   86 (129)
                      ..|.|+.|++.-..          -.+-..|.|..|++.|...+
T Consensus        34 a~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~AGGA   67 (91)
T TIGR00280        34 AKYVCPFCGKKTVK----------RGSTGIWTCRKCGAKFAGGA   67 (91)
T ss_pred             cCccCCCCCCCceE----------EEeeEEEEcCCCCCEEeCCc
Confidence            46889998753221          12234688999988776543


No 161
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=48.75  E-value=0.64  Score=30.10  Aligned_cols=74  Identities=23%  Similarity=0.478  Sum_probs=25.2

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccChhHHHHHHHHhc
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRASDLKRHIDAHL   96 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   96 (129)
                      -.|+.||..-.- +.+..-..  .|.+-..|..|+-.+....              ..|+.||..-....... ......
T Consensus       173 g~CPvCGs~P~~-s~l~~~~~--~G~R~L~Cs~C~t~W~~~R--------------~~Cp~Cg~~~~~~l~~~-~~e~~~  234 (290)
T PF04216_consen  173 GYCPVCGSPPVL-SVLRGGER--EGKRYLHCSLCGTEWRFVR--------------IKCPYCGNTDHEKLEYF-TVEGEP  234 (290)
T ss_dssp             SS-TTT---EEE-EEEE--------EEEEEETTT--EEE--T--------------TS-TTT---SS-EEE---------
T ss_pred             CcCCCCCCcCce-EEEecCCC--CccEEEEcCCCCCeeeecC--------------CCCcCCCCCCCcceeeE-ecCCCC
Confidence            367778764221 11111001  2556667777765444321              35777775433332221 112223


Q ss_pred             CCCcccCCcccc
Q psy13123         97 GVKKFACETCGK  108 (129)
Q Consensus        97 ~~~~~~C~~C~~  108 (129)
                      +.+.+.|..|+.
T Consensus       235 ~~rve~C~~C~~  246 (290)
T PF04216_consen  235 AYRVEVCESCGS  246 (290)
T ss_dssp             SEEEEEETTTTE
T ss_pred             cEEEEECCcccc
Confidence            456677888863


No 162
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=48.07  E-value=17  Score=16.97  Aligned_cols=12  Identities=25%  Similarity=0.886  Sum_probs=6.8

Q ss_pred             eecccccccccC
Q psy13123         73 YVCTYCGKAFVR   84 (129)
Q Consensus        73 ~~c~~c~~~~~~   84 (129)
                      |+|..|+..+..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            566666655544


No 163
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=47.88  E-value=8.7  Score=22.50  Aligned_cols=35  Identities=31%  Similarity=0.848  Sum_probs=21.5

Q ss_pred             CCeecccccccccChhHHHHHHHHhcCCCcccCCcccccc
Q psy13123         71 KPYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLF  110 (129)
Q Consensus        71 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f  110 (129)
                      -+|.|. |+.-+...   ..|-..-.|+ .|.|..|+...
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gkL  150 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGKL  150 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCceE
Confidence            368888 88765443   2333333455 79999997543


No 164
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=46.78  E-value=2.3  Score=31.09  Aligned_cols=58  Identities=21%  Similarity=0.611  Sum_probs=36.0

Q ss_pred             ccCCcchhhhcchhHHHHHHHHhCCCCCe-ecccccccccChhHHHHHHHHhcCCCcccCCccccc
Q psy13123         45 YKCPLCGKFFIQLCHMKDHIQAHGGLKPY-VCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKL  109 (129)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~  109 (129)
                      -.|..||..|.....|-=. +.+|.-+.| .|+.|.+.+.++.+-..|      -.+..|+.||..
T Consensus       124 ~~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP~  182 (750)
T COG0068         124 INCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFH------AQPIACPKCGPH  182 (750)
T ss_pred             cccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccccc------cccccCcccCCC
Confidence            4577888888765544211 122222223 488898888888775444      246789999864


No 165
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=46.62  E-value=2.3  Score=22.48  Aligned_cols=33  Identities=33%  Similarity=0.842  Sum_probs=20.2

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccCh
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRA   85 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   85 (129)
                      ..|.|+.|++.-....        ..  .-|.|..|+..|...
T Consensus        34 ~ky~Cp~Cgk~~vkR~--------a~--GIW~C~~C~~~~AGG   66 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKRV--------AT--GIWKCKKCGKKFAGG   66 (90)
T ss_dssp             S-BEESSSSSSEEEEE--------ET--TEEEETTTTEEEE-B
T ss_pred             CCCcCCCCCCceeEEe--------ee--EEeecCCCCCEEeCC
Confidence            4688999987533221        22  368899998876543


No 166
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=45.92  E-value=9.6  Score=18.33  Aligned_cols=11  Identities=36%  Similarity=0.999  Sum_probs=5.3

Q ss_pred             CCCCccCCcch
Q psy13123         41 GSSNYKCPLCG   51 (129)
Q Consensus        41 ~~~~~~c~~c~   51 (129)
                      |++...|+.|+
T Consensus        41 GE~VArCPSCS   51 (67)
T COG5216          41 GEVVARCPSCS   51 (67)
T ss_pred             CceEEEcCCce
Confidence            44444555444


No 167
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=45.57  E-value=15  Score=19.47  Aligned_cols=17  Identities=18%  Similarity=0.733  Sum_probs=11.4

Q ss_pred             cccCcchhccCChhhHH
Q psy13123         17 YQCGECGKQFTRKFSLN   33 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~   33 (129)
                      ..|++||..|.+...+.
T Consensus        36 ~~C~~CGe~y~~dev~~   52 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccccCCCcEeecHHHHH
Confidence            56778887776665543


No 168
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=44.93  E-value=9.6  Score=23.92  Aligned_cols=34  Identities=24%  Similarity=0.410  Sum_probs=21.2

Q ss_pred             CCCccccCcchhccCChhhHHHHHHHhCCCCCccCCc
Q psy13123         13 TTSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPL   49 (129)
Q Consensus        13 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~   49 (129)
                      ..++.+|.+||..|+....+.   ....|..|+.-..
T Consensus       178 EGkpqRCpECGqVFKLVr~~~---s~~dg~dp~~~dp  211 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVRVLY---SLPDGEDPFPNDP  211 (268)
T ss_pred             CCCCccCCCCCcEEEEEEEEe---ecCCCCCCCCCCC
Confidence            445789999999997644221   1344666665543


No 169
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=44.76  E-value=12  Score=17.38  Aligned_cols=10  Identities=30%  Similarity=1.032  Sum_probs=4.8

Q ss_pred             cccCCccccc
Q psy13123        100 KFACETCGKL  109 (129)
Q Consensus       100 ~~~C~~C~~~  109 (129)
                      .+.|..||..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            3455555543


No 170
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=44.62  E-value=53  Score=17.89  Aligned_cols=41  Identities=12%  Similarity=0.189  Sum_probs=29.4

Q ss_pred             CccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcc
Q psy13123         15 SAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQ   56 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~   56 (129)
                      ..|.|+..|..|.+.......+... +.+.+.|...|+.-.+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y-~~~vwtC~~TGk~~LT   42 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILY-NQRVWTCEITGKSNLT   42 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHH-hCCeeEEecCCCCCCC
Confidence            3577888888888887776655554 5678888887775443


No 171
>PTZ00448 hypothetical protein; Provisional
Probab=44.23  E-value=21  Score=24.28  Aligned_cols=23  Identities=22%  Similarity=0.545  Sum_probs=19.6

Q ss_pred             cccCCccccccCCHHHHHHHHHH
Q psy13123        100 KFACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      .|.|..|+-.|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888888888775


No 172
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.52  E-value=17  Score=25.20  Aligned_cols=11  Identities=27%  Similarity=0.797  Sum_probs=5.2

Q ss_pred             Ceecccccccc
Q psy13123         72 PYVCTYCGKAF   82 (129)
Q Consensus        72 ~~~c~~c~~~~   82 (129)
                      .|.|+.|++.+
T Consensus       367 g~rC~kCg~~~  377 (421)
T COG1571         367 GFRCKKCGTRA  377 (421)
T ss_pred             CcccccccccC
Confidence            44555555433


No 173
>KOG2071|consensus
Probab=43.26  E-value=19  Score=26.06  Aligned_cols=28  Identities=29%  Similarity=0.583  Sum_probs=21.9

Q ss_pred             CCCccccCcchhccCChhhHHHHHHHhC
Q psy13123         13 TTSAYQCGECGKQFTRKFSLNAHLHVHY   40 (129)
Q Consensus        13 ~~~~~~C~~C~~~~~~~~~l~~h~~~~~   40 (129)
                      .+.|..|..||..|.+......||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3456789999999998887777776663


No 174
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=42.81  E-value=11  Score=21.04  Aligned_cols=11  Identities=27%  Similarity=0.775  Sum_probs=5.3

Q ss_pred             ccCCcchhhhc
Q psy13123         45 YKCPLCGKFFI   55 (129)
Q Consensus        45 ~~c~~c~~~~~   55 (129)
                      ..|..|+..|.
T Consensus        72 ~~C~~Cg~~~~   82 (117)
T PRK00564         72 LECKDCSHVFK   82 (117)
T ss_pred             EEhhhCCCccc
Confidence            45555554433


No 175
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=42.34  E-value=13  Score=20.35  Aligned_cols=28  Identities=21%  Similarity=0.567  Sum_probs=14.6

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcc
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQ   56 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~   56 (129)
                      .|+.|+..|.+..           ...+.|+.|+..|..
T Consensus         4 ~CP~C~seytY~d-----------g~~~iCpeC~~EW~~   31 (109)
T TIGR00686         4 PCPKCNSEYTYHD-----------GTQLICPSCLYEWNE   31 (109)
T ss_pred             cCCcCCCcceEec-----------CCeeECccccccccc
Confidence            4666666554432           223566666655543


No 176
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=42.23  E-value=9.4  Score=17.81  Aligned_cols=13  Identities=31%  Similarity=0.989  Sum_probs=6.8

Q ss_pred             cCCccccccCCHH
Q psy13123        102 ACETCGKLFSSKH  114 (129)
Q Consensus       102 ~C~~C~~~f~~~~  114 (129)
                      .|+.|+..|....
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            8999998886544


No 177
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=41.82  E-value=20  Score=16.04  Aligned_cols=13  Identities=31%  Similarity=0.953  Sum_probs=7.8

Q ss_pred             cCCccccccCCHH
Q psy13123        102 ACETCGKLFSSKH  114 (129)
Q Consensus       102 ~C~~C~~~f~~~~  114 (129)
                      .|..||+.|...-
T Consensus        10 ~C~~C~rpf~WRK   22 (42)
T PF10013_consen   10 ICPVCGRPFTWRK   22 (42)
T ss_pred             cCcccCCcchHHH
Confidence            3666776665543


No 178
>COG1773 Rubredoxin [Energy production and conversion]
Probab=41.75  E-value=12  Score=17.87  Aligned_cols=14  Identities=21%  Similarity=0.726  Sum_probs=11.1

Q ss_pred             CeecccccccccCh
Q psy13123         72 PYVCTYCGKAFVRA   85 (129)
Q Consensus        72 ~~~c~~c~~~~~~~   85 (129)
                      .|+|..||.+|...
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            58899999888654


No 179
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=40.96  E-value=5.1  Score=21.20  Aligned_cols=33  Identities=27%  Similarity=0.721  Sum_probs=21.1

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccCh
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRA   85 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   85 (129)
                      ..|.|+.|++.-..          -.+-..|.|..|+..|...
T Consensus        35 a~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~AGG   67 (90)
T PRK03976         35 AKHVCPVCGRPKVK----------RVGTGIWECRKCGAKFAGG   67 (90)
T ss_pred             cCccCCCCCCCceE----------EEEEEEEEcCCCCCEEeCC
Confidence            46889998754221          1122468899998877654


No 180
>PHA02998 RNA polymerase subunit; Provisional
Probab=40.84  E-value=3.2  Score=24.89  Aligned_cols=38  Identities=18%  Similarity=0.378  Sum_probs=20.3

Q ss_pred             eecccccccccChhHHHHHHHHhcCC---CcccCCccccccCCH
Q psy13123         73 YVCTYCGKAFVRASDLKRHIDAHLGV---KKFACETCGKLFSSK  113 (129)
Q Consensus        73 ~~c~~c~~~~~~~~~l~~h~~~~~~~---~~~~C~~C~~~f~~~  113 (129)
                      ..|+.|+..-.....++.  + .++|   ..|.|..||+.|...
T Consensus       144 v~CPkCg~~~A~f~qlQT--R-SADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMMIQT--R-AADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEEEee--c-cCCCCceEEEEcCCCCCccCCc
Confidence            468888743322222221  1 1222   348898898887543


No 181
>KOG2907|consensus
Probab=39.96  E-value=8.6  Score=21.24  Aligned_cols=9  Identities=44%  Similarity=1.106  Sum_probs=4.2

Q ss_pred             ccCCcchhh
Q psy13123         45 YKCPLCGKF   53 (129)
Q Consensus        45 ~~c~~c~~~   53 (129)
                      |+|+.|+..
T Consensus       103 YTC~kC~~k  111 (116)
T KOG2907|consen  103 YTCPKCKYK  111 (116)
T ss_pred             EEcCcccee
Confidence            455544443


No 182
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=39.87  E-value=15  Score=23.54  Aligned_cols=16  Identities=13%  Similarity=0.675  Sum_probs=10.2

Q ss_pred             CCCCCCccccCcchhc
Q psy13123         10 LATTTSAYQCGECGKQ   25 (129)
Q Consensus        10 ~~~~~~~~~C~~C~~~   25 (129)
                      +.+.++.|-|..|...
T Consensus       106 ip~~drqFaC~~Cd~~  121 (278)
T PF15135_consen  106 IPSVDRQFACSSCDHM  121 (278)
T ss_pred             ccccceeeeccccchH
Confidence            3445567778777654


No 183
>PF14122 YokU:  YokU-like protein
Probab=39.19  E-value=22  Score=18.67  Aligned_cols=19  Identities=21%  Similarity=0.565  Sum_probs=13.2

Q ss_pred             CccccCcchhccCChhhHH
Q psy13123         15 SAYQCGECGKQFTRKFSLN   33 (129)
Q Consensus        15 ~~~~C~~C~~~~~~~~~l~   33 (129)
                      +...|..||+.+.....+.
T Consensus        34 P~i~C~~CgmvYq~d~vi~   52 (87)
T PF14122_consen   34 PAIICSNCGMVYQDDEVIK   52 (87)
T ss_pred             ceeeecCCCcEEehhHHHH
Confidence            3467888888887665543


No 184
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=38.91  E-value=21  Score=20.50  Aligned_cols=25  Identities=48%  Similarity=0.777  Sum_probs=19.4

Q ss_pred             cccCcchhccCChhhHHHHHHHhCCCCC
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVHYGSSN   44 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~   44 (129)
                      ..|-++|+.|+   .|.+|+.+|.+-.|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            46899999884   57889988877554


No 185
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=38.68  E-value=4.1  Score=23.64  Aligned_cols=17  Identities=18%  Similarity=0.383  Sum_probs=10.5

Q ss_pred             CccCCcchhhhcchhHH
Q psy13123         44 NYKCPLCGKFFIQLCHM   60 (129)
Q Consensus        44 ~~~c~~c~~~~~~~~~l   60 (129)
                      .-.|..|++.|.+...+
T Consensus        28 RReC~~C~~RFTTyErv   44 (147)
T TIGR00244        28 RRECLECHERFTTFERA   44 (147)
T ss_pred             cccCCccCCccceeeec
Confidence            35677777777665443


No 186
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=38.59  E-value=9.5  Score=16.82  Aligned_cols=11  Identities=27%  Similarity=0.899  Sum_probs=7.3

Q ss_pred             ccccCcchhcc
Q psy13123         16 AYQCGECGKQF   26 (129)
Q Consensus        16 ~~~C~~C~~~~   26 (129)
                      +-.|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            56677777655


No 187
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=38.31  E-value=11  Score=22.00  Aligned_cols=8  Identities=38%  Similarity=1.041  Sum_probs=4.5

Q ss_pred             ccCCcchh
Q psy13123         45 YKCPLCGK   52 (129)
Q Consensus        45 ~~c~~c~~   52 (129)
                      +.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            55555554


No 188
>KOG2636|consensus
Probab=38.02  E-value=26  Score=24.51  Aligned_cols=29  Identities=21%  Similarity=0.521  Sum_probs=22.5

Q ss_pred             HHHhcCCCcccCCccc-cccCCHHHHHHHH
Q psy13123         92 IDAHLGVKKFACETCG-KLFSSKHGLKYHV  120 (129)
Q Consensus        92 ~~~~~~~~~~~C~~C~-~~f~~~~~l~~h~  120 (129)
                      -+.|.-.+-|.|.+|| +++.-...+.+|.
T Consensus       393 yKLHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  393 YKLHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             HhhcCCCcccceeeccCccccCcHHHHHHh
Confidence            3667778889999999 6777777777773


No 189
>PRK12496 hypothetical protein; Provisional
Probab=37.92  E-value=24  Score=20.96  Aligned_cols=10  Identities=30%  Similarity=0.873  Sum_probs=5.2

Q ss_pred             cccCcchhcc
Q psy13123         17 YQCGECGKQF   26 (129)
Q Consensus        17 ~~C~~C~~~~   26 (129)
                      +.|.-|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            3455555554


No 190
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=37.89  E-value=23  Score=25.20  Aligned_cols=10  Identities=40%  Similarity=1.032  Sum_probs=5.9

Q ss_pred             CCccCCcchh
Q psy13123         43 SNYKCPLCGK   52 (129)
Q Consensus        43 ~~~~c~~c~~   52 (129)
                      .|..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3556666654


No 191
>PF14353 CpXC:  CpXC protein
Probab=37.83  E-value=13  Score=20.85  Aligned_cols=17  Identities=29%  Similarity=1.015  Sum_probs=12.3

Q ss_pred             ccccCcchhccCChhhH
Q psy13123         16 AYQCGECGKQFTRKFSL   32 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l   32 (129)
                      .+.|+.||..+.-...+
T Consensus        38 ~~~CP~Cg~~~~~~~p~   54 (128)
T PF14353_consen   38 SFTCPSCGHKFRLEYPL   54 (128)
T ss_pred             EEECCCCCCceecCCCE
Confidence            47899999988654443


No 192
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=37.71  E-value=13  Score=17.28  Aligned_cols=12  Identities=33%  Similarity=0.988  Sum_probs=8.1

Q ss_pred             cccCcchhccCC
Q psy13123         17 YQCGECGKQFTR   28 (129)
Q Consensus        17 ~~C~~C~~~~~~   28 (129)
                      |+|..||..|.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            567777777653


No 193
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=37.09  E-value=39  Score=20.82  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=6.2

Q ss_pred             Ceecccccccc
Q psy13123         72 PYVCTYCGKAF   82 (129)
Q Consensus        72 ~~~c~~c~~~~   82 (129)
                      ...|..||..+
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            34566666555


No 194
>KOG3014|consensus
Probab=36.95  E-value=27  Score=22.38  Aligned_cols=31  Identities=26%  Similarity=0.520  Sum_probs=21.1

Q ss_pred             CCCCCCcc---ccCcchhccCCh--hhHHHHHHHhC
Q psy13123         10 LATTTSAY---QCGECGKQFTRK--FSLNAHLHVHY   40 (129)
Q Consensus        10 ~~~~~~~~---~C~~C~~~~~~~--~~l~~h~~~~~   40 (129)
                      .-.|++.|   .|.+||+.|...  .+...|...|.
T Consensus        28 ld~Gqk~fg~~~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   28 LDAGQKDFGAVKCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             eecCccccCceehhhcCceecCCCHHHHHHHHHHHH
Confidence            34455444   699999887744  55677888775


No 195
>PLN02748 tRNA dimethylallyltransferase
Probab=36.63  E-value=30  Score=24.48  Aligned_cols=24  Identities=25%  Similarity=0.746  Sum_probs=20.3

Q ss_pred             CcccCCcccc-ccCCHHHHHHHHHH
Q psy13123         99 KKFACETCGK-LFSSKHGLKYHVRT  122 (129)
Q Consensus        99 ~~~~C~~C~~-~f~~~~~l~~h~~~  122 (129)
                      +.|.|..|++ .+.....+..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5688999997 79999999999764


No 196
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=36.29  E-value=5.8  Score=23.17  Aligned_cols=16  Identities=25%  Similarity=0.588  Sum_probs=9.6

Q ss_pred             CccCCcchhhhcchhH
Q psy13123         44 NYKCPLCGKFFIQLCH   59 (129)
Q Consensus        44 ~~~c~~c~~~~~~~~~   59 (129)
                      .-.|..|+..|.+...
T Consensus        28 RReC~~C~~RFTTfE~   43 (156)
T COG1327          28 RRECLECGERFTTFER   43 (156)
T ss_pred             hhcccccccccchhhe
Confidence            3567777776665443


No 197
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=36.15  E-value=16  Score=20.20  Aligned_cols=13  Identities=31%  Similarity=0.690  Sum_probs=7.4

Q ss_pred             eecccccccccCh
Q psy13123         73 YVCTYCGKAFVRA   85 (129)
Q Consensus        73 ~~c~~c~~~~~~~   85 (129)
                      ..|..|+..|...
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            4577777666543


No 198
>PF14369 zf-RING_3:  zinc-finger
Probab=36.03  E-value=20  Score=15.17  Aligned_cols=31  Identities=29%  Similarity=0.607  Sum_probs=16.0

Q ss_pred             ccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhc
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFI   55 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   55 (129)
                      .|.|..|...+.-...         +...-.|+.|+..|.
T Consensus         2 ~ywCh~C~~~V~~~~~---------~~~~~~CP~C~~gFv   32 (35)
T PF14369_consen    2 RYWCHQCNRFVRIAPS---------PDSDVACPRCHGGFV   32 (35)
T ss_pred             CEeCccCCCEeEeCcC---------CCCCcCCcCCCCcEe
Confidence            3667777765432110         111225777777664


No 199
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=35.88  E-value=14  Score=21.38  Aligned_cols=32  Identities=28%  Similarity=0.757  Sum_probs=18.9

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccccccC
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFS  111 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  111 (129)
                      .|.|..|+..+.....+        ....|.|..|+..|.
T Consensus       123 ~~~C~~C~~~~~r~~~~--------~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHRRS--------KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeeccc--------chhhEECCCCCCEEE
Confidence            46788888665333221        123378888886653


No 200
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=35.72  E-value=31  Score=24.38  Aligned_cols=23  Identities=26%  Similarity=0.579  Sum_probs=20.0

Q ss_pred             cccCcchhccCChhhHHHHHHHh
Q psy13123         17 YQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      +.|+.|.+.|.+...+..|+...
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~e   80 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQE   80 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHh
Confidence            56999999999999999998743


No 201
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=35.34  E-value=12  Score=23.35  Aligned_cols=26  Identities=19%  Similarity=0.377  Sum_probs=0.0

Q ss_pred             CcccCCccccccCCHHHHHHHHHHhcc
Q psy13123         99 KKFACETCGKLFSSKHGLKYHVRTHKG  125 (129)
Q Consensus        99 ~~~~C~~C~~~f~~~~~l~~h~~~h~~  125 (129)
                      ....|+.||... ..+.+..|+|+...
T Consensus       167 ~~~~cPitGe~I-P~~e~~eHmRi~Ll  192 (229)
T PF12230_consen  167 KMIICPITGEMI-PADEMDEHMRIELL  192 (229)
T ss_dssp             ---------------------------
T ss_pred             cccccccccccc-cccccccccccccc
Confidence            345666666654 34456666666543


No 202
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.27  E-value=15  Score=15.83  Aligned_cols=12  Identities=33%  Similarity=0.982  Sum_probs=6.2

Q ss_pred             CccccCcchhcc
Q psy13123         15 SAYQCGECGKQF   26 (129)
Q Consensus        15 ~~~~C~~C~~~~   26 (129)
                      ..|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            357888888764


No 203
>PRK10220 hypothetical protein; Provisional
Probab=35.26  E-value=24  Score=19.47  Aligned_cols=29  Identities=24%  Similarity=0.676  Sum_probs=15.8

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhcch
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFIQL   57 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   57 (129)
                      .|++|+..|.+..           ...+.|+.|+.-|...
T Consensus         5 ~CP~C~seytY~d-----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED-----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC-----------CCeEECCcccCcCCcc
Confidence            4666666654432           2246677766555443


No 204
>PF12907 zf-met2:  Zinc-binding
Probab=34.90  E-value=33  Score=15.13  Aligned_cols=22  Identities=23%  Similarity=0.443  Sum_probs=10.5

Q ss_pred             cccCcchhccC---ChhhHHHHHHH
Q psy13123         17 YQCGECGKQFT---RKFSLNAHLHV   38 (129)
Q Consensus        17 ~~C~~C~~~~~---~~~~l~~h~~~   38 (129)
                      +.|..|-.+|.   ....|..|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~en   26 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAEN   26 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHc
Confidence            34666664333   23345555543


No 205
>KOG1842|consensus
Probab=34.64  E-value=28  Score=24.41  Aligned_cols=21  Identities=24%  Similarity=0.449  Sum_probs=10.1

Q ss_pred             ccCCccccccCCHHHHHHHHH
Q psy13123        101 FACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~  121 (129)
                      |.|+.|...|.....|..|.-
T Consensus        16 flCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHh
Confidence            444455555554444444443


No 206
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=34.29  E-value=4.3  Score=21.89  Aligned_cols=38  Identities=18%  Similarity=0.469  Sum_probs=17.6

Q ss_pred             CCccccCcchhccCChhhHHHHHHHhCCCCCccCCcchhhhc
Q psy13123         14 TSAYQCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGKFFI   55 (129)
Q Consensus        14 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   55 (129)
                      ++-|.|+.|+..-.....+.    .-.+.....|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEE
Confidence            34577777775432222111    111233455666665544


No 207
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=34.22  E-value=14  Score=16.92  Aligned_cols=11  Identities=45%  Similarity=1.153  Sum_probs=6.9

Q ss_pred             cccCcchhccC
Q psy13123         17 YQCGECGKQFT   27 (129)
Q Consensus        17 ~~C~~C~~~~~   27 (129)
                      |+|..|+..|.
T Consensus         2 y~C~~CgyvYd   12 (47)
T PF00301_consen    2 YQCPVCGYVYD   12 (47)
T ss_dssp             EEETTTSBEEE
T ss_pred             cCCCCCCEEEc
Confidence            56667776654


No 208
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=34.06  E-value=2.7  Score=17.79  Aligned_cols=8  Identities=50%  Similarity=1.148  Sum_probs=3.7

Q ss_pred             eecccccc
Q psy13123         73 YVCTYCGK   80 (129)
Q Consensus        73 ~~c~~c~~   80 (129)
                      ++|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            34555543


No 209
>KOG1842|consensus
Probab=33.74  E-value=32  Score=24.10  Aligned_cols=24  Identities=29%  Similarity=0.520  Sum_probs=21.2

Q ss_pred             ccccCcchhccCChhhHHHHHHHh
Q psy13123         16 AYQCGECGKQFTRKFSLNAHLHVH   39 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~~~~   39 (129)
                      -|.|+.|...|.....|..|....
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~e   38 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVE   38 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhh
Confidence            489999999999999999998643


No 210
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=33.67  E-value=16  Score=20.26  Aligned_cols=10  Identities=20%  Similarity=0.544  Sum_probs=6.2

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5577777544


No 211
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=32.24  E-value=26  Score=16.14  Aligned_cols=7  Identities=29%  Similarity=1.213  Sum_probs=2.3

Q ss_pred             ccCCccc
Q psy13123        101 FACETCG  107 (129)
Q Consensus       101 ~~C~~C~  107 (129)
                      +.|+.|+
T Consensus        42 W~CPiC~   48 (50)
T PF02891_consen   42 WKCPICN   48 (50)
T ss_dssp             -B-TTT-
T ss_pred             eECcCCc
Confidence            5555554


No 212
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.88  E-value=38  Score=22.15  Aligned_cols=11  Identities=27%  Similarity=0.899  Sum_probs=6.6

Q ss_pred             eeccccccccc
Q psy13123         73 YVCTYCGKAFV   83 (129)
Q Consensus        73 ~~c~~c~~~~~   83 (129)
                      |+|+.|...|-
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            66666665553


No 213
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=31.70  E-value=30  Score=16.57  Aligned_cols=36  Identities=19%  Similarity=0.258  Sum_probs=16.7

Q ss_pred             ccCcchhccCCh-hhHHHHHHHhCCCCCccCCcchhh
Q psy13123         18 QCGECGKQFTRK-FSLNAHLHVHYGSSNYKCPLCGKF   53 (129)
Q Consensus        18 ~C~~C~~~~~~~-~~l~~h~~~~~~~~~~~c~~c~~~   53 (129)
                      +|-.|++.+.-. ..+............|.|..|...
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            456666654432 223332222333445666666543


No 214
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=31.49  E-value=56  Score=15.28  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=6.0

Q ss_pred             CCCeecccccc
Q psy13123         70 LKPYVCTYCGK   80 (129)
Q Consensus        70 ~~~~~c~~c~~   80 (129)
                      +....|+.|++
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            34455666654


No 215
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=31.37  E-value=6  Score=21.89  Aligned_cols=10  Identities=50%  Similarity=1.241  Sum_probs=4.9

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      |.|..||..|
T Consensus       101 y~C~~Cg~~w  110 (113)
T COG1594         101 YKCTRCGYRW  110 (113)
T ss_pred             EEecccCCEe
Confidence            4455555443


No 216
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=30.26  E-value=21  Score=15.16  Aligned_cols=12  Identities=50%  Similarity=1.221  Sum_probs=5.0

Q ss_pred             ccCcchhccCCh
Q psy13123         18 QCGECGKQFTRK   29 (129)
Q Consensus        18 ~C~~C~~~~~~~   29 (129)
                      .|.+|++.|...
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            577777776543


No 217
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=29.70  E-value=30  Score=24.20  Aligned_cols=9  Identities=33%  Similarity=1.021  Sum_probs=5.4

Q ss_pred             CccCCcchh
Q psy13123         44 NYKCPLCGK   52 (129)
Q Consensus        44 ~~~c~~c~~   52 (129)
                      .|.|..||.
T Consensus         7 ~f~C~~CG~   15 (456)
T COG1066           7 AFVCQECGY   15 (456)
T ss_pred             EEEcccCCC
Confidence            366666664


No 218
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=29.19  E-value=22  Score=20.97  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=15.8

Q ss_pred             cCCCcccCCccccccCCHHH
Q psy13123         96 LGVKKFACETCGKLFSSKHG  115 (129)
Q Consensus        96 ~~~~~~~C~~C~~~f~~~~~  115 (129)
                      +.+.|.-|..||+.|++-..
T Consensus        64 ~~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   64 HYEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCCCChhHHhCCCCCchHHH
Confidence            44578889999999988653


No 219
>COG2879 Uncharacterized small protein [Function unknown]
Probab=29.03  E-value=83  Score=15.51  Aligned_cols=17  Identities=12%  Similarity=0.122  Sum_probs=10.3

Q ss_pred             CHHHHHHHHHHhcccCC
Q psy13123        112 SKHGLKYHVRTHKGECK  128 (129)
Q Consensus       112 ~~~~l~~h~~~h~~e~p  128 (129)
                      .=+++-.|+|.++.++|
T Consensus        24 dYdnYVehmr~~hPd~p   40 (65)
T COG2879          24 DYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             cHHHHHHHHHHhCcCCC
Confidence            34456667776666655


No 220
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.65  E-value=35  Score=22.34  Aligned_cols=15  Identities=27%  Similarity=0.784  Sum_probs=7.7

Q ss_pred             CcccCCccccccCCH
Q psy13123         99 KKFACETCGKLFSSK  113 (129)
Q Consensus        99 ~~~~C~~C~~~f~~~  113 (129)
                      +.+.|+.||..+..+
T Consensus       321 r~~~C~~cg~~~~rD  335 (364)
T COG0675         321 RLFKCPRCGFVHDRD  335 (364)
T ss_pred             eeEECCCCCCeehhh
Confidence            445566666554333


No 221
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=28.49  E-value=22  Score=15.48  Aligned_cols=13  Identities=31%  Similarity=0.948  Sum_probs=9.0

Q ss_pred             ccccCcchhccCC
Q psy13123         16 AYQCGECGKQFTR   28 (129)
Q Consensus        16 ~~~C~~C~~~~~~   28 (129)
                      -+.|+.||..+-+
T Consensus        32 ~~~C~~CGE~~~~   44 (46)
T TIGR03831        32 ALVCPQCGEEYLD   44 (46)
T ss_pred             ccccccCCCEeeC
Confidence            3568888877643


No 222
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=27.83  E-value=25  Score=20.31  Aligned_cols=33  Identities=33%  Similarity=0.839  Sum_probs=18.7

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccccccC
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFS  111 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~  111 (129)
                      .|.|..|+..+..      +.+ +..-..|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~~------~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLR------VRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCce------Ecc-ccCcceEEcCCCCCEEE
Confidence            5778878765431      111 12225588888876653


No 223
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=27.65  E-value=30  Score=14.44  Aligned_cols=10  Identities=40%  Similarity=0.810  Sum_probs=5.8

Q ss_pred             cccCcchhcc
Q psy13123         17 YQCGECGKQF   26 (129)
Q Consensus        17 ~~C~~C~~~~   26 (129)
                      ..|..||.+|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4566666554


No 224
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.34  E-value=27  Score=16.08  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=7.2

Q ss_pred             CCccccccCCHH
Q psy13123        103 CETCGKLFSSKH  114 (129)
Q Consensus       103 C~~C~~~f~~~~  114 (129)
                      |+.|++.|....
T Consensus        15 CpvCqRPFsWRk   26 (54)
T COG4338          15 CPVCQRPFSWRK   26 (54)
T ss_pred             hhhhcCchHHHH
Confidence            666666665544


No 225
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=27.27  E-value=21  Score=22.01  Aligned_cols=27  Identities=22%  Similarity=0.559  Sum_probs=0.0

Q ss_pred             HHhcCCCcccCCcccc-ccCCHHHHHHH
Q psy13123         93 DAHLGVKKFACETCGK-LFSSKHGLKYH  119 (129)
Q Consensus        93 ~~~~~~~~~~C~~C~~-~f~~~~~l~~h  119 (129)
                      +.|.-.+-|.|.+||. ++.-...+.+|
T Consensus        94 KLhGL~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   94 KLHGLGVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------------
T ss_pred             HHhCCCCeeeeEeCCCcceecHHHHHHh
Confidence            4455566788888875 33344445544


No 226
>PRK04351 hypothetical protein; Provisional
Probab=27.06  E-value=21  Score=20.91  Aligned_cols=33  Identities=24%  Similarity=0.685  Sum_probs=20.5

Q ss_pred             CeecccccccccChhHHHHHHHHhcCCCcccCCccccccCC
Q psy13123         72 PYVCTYCGKAFVRASDLKRHIDAHLGVKKFACETCGKLFSS  112 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~  112 (129)
                      .|.|..|+..+...      ++ + ....|.|..|+-.+..
T Consensus       112 ~Y~C~~Cg~~~~r~------Rr-~-n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK------RR-I-NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee------ee-c-CCCcEEeCCCCcEeee
Confidence            37788888655332      11 2 2466899999866543


No 227
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=27.05  E-value=30  Score=23.59  Aligned_cols=22  Identities=32%  Similarity=0.614  Sum_probs=14.5

Q ss_pred             ccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         45 YKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      |.|..||....              ...+.|+.|+.
T Consensus         1 ~~c~~cg~~~~--------------~~~g~cp~c~~   22 (372)
T cd01121           1 YVCSECGYVSP--------------KWLGKCPECGE   22 (372)
T ss_pred             CCCCCCCCCCC--------------CccEECcCCCC
Confidence            56888875332              23568999975


No 228
>PRK11823 DNA repair protein RadA; Provisional
Probab=26.97  E-value=34  Score=23.96  Aligned_cols=24  Identities=29%  Similarity=0.513  Sum_probs=16.5

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      ..|.|..||....              ...+.|+.|+.
T Consensus         6 ~~y~C~~Cg~~~~--------------~~~g~Cp~C~~   29 (446)
T PRK11823          6 TAYVCQECGAESP--------------KWLGRCPECGA   29 (446)
T ss_pred             CeEECCcCCCCCc--------------ccCeeCcCCCC
Confidence            4588999986433              24578998874


No 229
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=26.87  E-value=40  Score=16.39  Aligned_cols=11  Identities=45%  Similarity=1.029  Sum_probs=3.7

Q ss_pred             ccCCcchhhhc
Q psy13123         45 YKCPLCGKFFI   55 (129)
Q Consensus        45 ~~c~~c~~~~~   55 (129)
                      ..|..|++.|.
T Consensus        10 ~~C~~C~~~F~   20 (69)
T PF01363_consen   10 SNCMICGKKFS   20 (69)
T ss_dssp             SB-TTT--B-B
T ss_pred             CcCcCcCCcCC
Confidence            34566666653


No 230
>PRK14873 primosome assembly protein PriA; Provisional
Probab=26.81  E-value=42  Score=24.99  Aligned_cols=34  Identities=18%  Similarity=0.530  Sum_probs=16.7

Q ss_pred             ccCcchhccCChhhHHHHHHHhCCCCCccCCcchh
Q psy13123         18 QCGECGKQFTRKFSLNAHLHVHYGSSNYKCPLCGK   52 (129)
Q Consensus        18 ~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   52 (129)
                      .|..||..+....- ...+..|.......|..||.
T Consensus       385 ~C~~Cg~~~~C~~C-~~~L~~h~~~~~l~Ch~CG~  418 (665)
T PRK14873        385 ACARCRTPARCRHC-TGPLGLPSAGGTPRCRWCGR  418 (665)
T ss_pred             EhhhCcCeeECCCC-CCceeEecCCCeeECCCCcC
Confidence            56666666554421 01122333445566777764


No 231
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=26.70  E-value=53  Score=15.11  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=5.0

Q ss_pred             eecccccccc
Q psy13123         73 YVCTYCGKAF   82 (129)
Q Consensus        73 ~~c~~c~~~~   82 (129)
                      ..|..||.+|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            3455555544


No 232
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=26.37  E-value=37  Score=18.88  Aligned_cols=10  Identities=50%  Similarity=1.238  Sum_probs=4.9

Q ss_pred             CCccCCcchh
Q psy13123         43 SNYKCPLCGK   52 (129)
Q Consensus        43 ~~~~c~~c~~   52 (129)
                      ....|+.|++
T Consensus        68 v~V~CP~C~K   77 (114)
T PF11023_consen   68 VQVECPNCGK   77 (114)
T ss_pred             eeeECCCCCC
Confidence            3344555554


No 233
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=26.05  E-value=34  Score=18.36  Aligned_cols=27  Identities=33%  Similarity=0.754  Sum_probs=16.4

Q ss_pred             cCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccC
Q psy13123         46 KCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVR   84 (129)
Q Consensus        46 ~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~   84 (129)
                      .|+.||..+...            ...+.|+.|+.....
T Consensus         2 fC~~Cg~~l~~~------------~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         2 FCPKCGSLMTPK------------NGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCcccCcccccC------------CCeEECcCCCCcccc
Confidence            477777655321            125788888865543


No 234
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK00420 hypothetical protein; Validated
Probab=25.88  E-value=41  Score=18.69  Aligned_cols=12  Identities=33%  Similarity=0.808  Sum_probs=6.8

Q ss_pred             Ceeccccccccc
Q psy13123         72 PYVCTYCGKAFV   83 (129)
Q Consensus        72 ~~~c~~c~~~~~   83 (129)
                      ...|+.|+....
T Consensus        40 ~~~Cp~Cg~~~~   51 (112)
T PRK00420         40 EVVCPVHGKVYI   51 (112)
T ss_pred             ceECCCCCCeee
Confidence            356666665443


No 236
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=25.45  E-value=7.3  Score=22.22  Aligned_cols=13  Identities=31%  Similarity=0.915  Sum_probs=8.4

Q ss_pred             CCCCeeccccccc
Q psy13123         69 GLKPYVCTYCGKA   81 (129)
Q Consensus        69 ~~~~~~c~~c~~~   81 (129)
                      ++....|++|+..
T Consensus       102 g~~~~~CPwCg~~  114 (131)
T PF15616_consen  102 GEGEVTCPWCGNE  114 (131)
T ss_pred             CCCCEECCCCCCe
Confidence            3445678888753


No 237
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=25.14  E-value=37  Score=23.89  Aligned_cols=24  Identities=25%  Similarity=0.434  Sum_probs=17.0

Q ss_pred             CCccCCcchhhhcchhHHHHHHHHhCCCCCeecccccc
Q psy13123         43 SNYKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGK   80 (129)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~   80 (129)
                      ..|.|..||....              ...+.|+.|+.
T Consensus         6 ~~y~C~~Cg~~~~--------------~~~g~Cp~C~~   29 (454)
T TIGR00416         6 SKFVCQHCGADSP--------------KWQGKCPACHA   29 (454)
T ss_pred             CeEECCcCCCCCc--------------cccEECcCCCC
Confidence            3589999986433              24578999975


No 238
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=25.04  E-value=26  Score=19.09  Aligned_cols=11  Identities=36%  Similarity=0.797  Sum_probs=6.6

Q ss_pred             CccCCcchhhh
Q psy13123         44 NYKCPLCGKFF   54 (129)
Q Consensus        44 ~~~c~~c~~~~   54 (129)
                      |-.|+.||..-
T Consensus         2 p~~CpYCg~~~   12 (102)
T PF11672_consen    2 PIICPYCGGPA   12 (102)
T ss_pred             CcccCCCCCee
Confidence            45677777543


No 239
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=25.00  E-value=60  Score=13.62  Aligned_cols=8  Identities=50%  Similarity=1.427  Sum_probs=3.4

Q ss_pred             cCCcchhh
Q psy13123         46 KCPLCGKF   53 (129)
Q Consensus        46 ~c~~c~~~   53 (129)
                      .|+.|++.
T Consensus         6 ~C~nC~R~   13 (33)
T PF08209_consen    6 ECPNCGRP   13 (33)
T ss_dssp             E-TTTSSE
T ss_pred             ECCCCcCC
Confidence            45555543


No 240
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.64  E-value=28  Score=19.62  Aligned_cols=11  Identities=36%  Similarity=0.558  Sum_probs=6.6

Q ss_pred             eecccccccccC
Q psy13123         73 YVCTYCGKAFVR   84 (129)
Q Consensus        73 ~~c~~c~~~~~~   84 (129)
                      +.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            567 77765543


No 241
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.63  E-value=35  Score=16.69  Aligned_cols=11  Identities=18%  Similarity=0.697  Sum_probs=7.6

Q ss_pred             cccCcchhccC
Q psy13123         17 YQCGECGKQFT   27 (129)
Q Consensus        17 ~~C~~C~~~~~   27 (129)
                      -.|+.|+..|+
T Consensus        49 v~CPYC~t~y~   59 (62)
T COG4391          49 VVCPYCSTRYR   59 (62)
T ss_pred             EecCccccEEE
Confidence            45777877664


No 242
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=24.11  E-value=43  Score=15.70  Aligned_cols=13  Identities=31%  Similarity=0.899  Sum_probs=6.6

Q ss_pred             CcccCCccccccC
Q psy13123         99 KKFACETCGKLFS  111 (129)
Q Consensus        99 ~~~~C~~C~~~f~  111 (129)
                      ....|+.|+..|-
T Consensus        39 ~~v~C~~C~~~fC   51 (64)
T smart00647       39 NRVTCPKCGFSFC   51 (64)
T ss_pred             CeeECCCCCCeEC
Confidence            3445555555543


No 243
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=23.76  E-value=32  Score=14.20  Aligned_cols=12  Identities=33%  Similarity=0.985  Sum_probs=9.0

Q ss_pred             CccccCcchhcc
Q psy13123         15 SAYQCGECGKQF   26 (129)
Q Consensus        15 ~~~~C~~C~~~~   26 (129)
                      +-|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468888888765


No 244
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=23.62  E-value=18  Score=16.92  Aligned_cols=7  Identities=29%  Similarity=1.037  Sum_probs=3.0

Q ss_pred             ccCCccc
Q psy13123        101 FACETCG  107 (129)
Q Consensus       101 ~~C~~C~  107 (129)
                      .+|+.|+
T Consensus        25 IKCpRC~   31 (51)
T PF10122_consen   25 IKCPRCK   31 (51)
T ss_pred             EECCCCC
Confidence            3444443


No 245
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=23.55  E-value=46  Score=15.89  Aligned_cols=15  Identities=27%  Similarity=0.552  Sum_probs=11.1

Q ss_pred             cCCCcccCCcccccc
Q psy13123         96 LGVKKFACETCGKLF  110 (129)
Q Consensus        96 ~~~~~~~C~~C~~~f  110 (129)
                      .+...|.|+.||-.+
T Consensus        10 ~~~v~~~Cp~cGipt   24 (55)
T PF13824_consen   10 PAHVNFECPDCGIPT   24 (55)
T ss_pred             ccccCCcCCCCCCcC
Confidence            345679999998754


No 246
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=23.49  E-value=32  Score=14.19  Aligned_cols=11  Identities=36%  Similarity=1.044  Sum_probs=7.7

Q ss_pred             ccccCcchhcc
Q psy13123         16 AYQCGECGKQF   26 (129)
Q Consensus        16 ~~~C~~C~~~~   26 (129)
                      -|+|..||...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47777777664


No 247
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.45  E-value=1.1e+02  Score=15.00  Aligned_cols=11  Identities=36%  Similarity=0.942  Sum_probs=5.4

Q ss_pred             CCccCCcchhh
Q psy13123         43 SNYKCPLCGKF   53 (129)
Q Consensus        43 ~~~~c~~c~~~   53 (129)
                      ..|.|+.|.-.
T Consensus        30 rtymC~eC~~R   40 (68)
T COG4896          30 RTYMCPECEHR   40 (68)
T ss_pred             eeEechhhHhh
Confidence            34555555443


No 248
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=23.03  E-value=62  Score=19.02  Aligned_cols=16  Identities=25%  Similarity=0.436  Sum_probs=9.1

Q ss_pred             CeecccccccccChhH
Q psy13123         72 PYVCTYCGKAFVRASD   87 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~   87 (129)
                      -..|++||..-.....
T Consensus        32 lv~CP~Cgs~~V~K~l   47 (148)
T PF06676_consen   32 LVSCPVCGSTEVSKAL   47 (148)
T ss_pred             CccCCCCCCCeEeeec
Confidence            4567777754444433


No 249
>KOG0717|consensus
Probab=22.84  E-value=55  Score=23.24  Aligned_cols=22  Identities=36%  Similarity=0.670  Sum_probs=18.2

Q ss_pred             ccCCccccccCCHHHHHHHHHH
Q psy13123        101 FACETCGKLFSSKHGLKYHVRT  122 (129)
Q Consensus       101 ~~C~~C~~~f~~~~~l~~h~~~  122 (129)
                      +-|..|+|.|...-.+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6788999999998888888654


No 250
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=22.77  E-value=56  Score=15.92  Aligned_cols=16  Identities=31%  Similarity=0.631  Sum_probs=10.9

Q ss_pred             CeecccccccccChhH
Q psy13123         72 PYVCTYCGKAFVRASD   87 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~   87 (129)
                      |..|..||+...+...
T Consensus         4 PVRCFTCGkvi~~~~e   19 (60)
T PF01194_consen    4 PVRCFTCGKVIGNKWE   19 (60)
T ss_dssp             SSS-STTTSBTCGHHH
T ss_pred             ceecCCCCCChhHhHH
Confidence            5678899988766544


No 251
>KOG4727|consensus
Probab=22.75  E-value=57  Score=19.69  Aligned_cols=22  Identities=23%  Similarity=0.543  Sum_probs=19.5

Q ss_pred             CeecccccccccChhHHHHHHH
Q psy13123         72 PYVCTYCGKAFVRASDLKRHID   93 (129)
Q Consensus        72 ~~~c~~c~~~~~~~~~l~~h~~   93 (129)
                      .|-|.+|.-++..+.++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999999999999874


No 252
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=22.27  E-value=73  Score=17.54  Aligned_cols=21  Identities=14%  Similarity=0.431  Sum_probs=15.0

Q ss_pred             ccccCcchhccCChhhHHHHH
Q psy13123         16 AYQCGECGKQFTRKFSLNAHL   36 (129)
Q Consensus        16 ~~~C~~C~~~~~~~~~l~~h~   36 (129)
                      -+.|+.||..+.+........
T Consensus        31 ~~~C~~CGe~~~~~e~~~~~~   51 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKRNS   51 (127)
T ss_pred             eeECCCCCCEEEcHHHHHHHH
Confidence            367999998887776654443


No 253
>PRK05978 hypothetical protein; Provisional
Probab=21.72  E-value=46  Score=19.54  Aligned_cols=9  Identities=44%  Similarity=1.243  Sum_probs=4.7

Q ss_pred             cCCcccccc
Q psy13123        102 ACETCGKLF  110 (129)
Q Consensus       102 ~C~~C~~~f  110 (129)
                      .|..||..|
T Consensus        54 ~C~~CG~~~   62 (148)
T PRK05978         54 HCAACGEDF   62 (148)
T ss_pred             CccccCCcc
Confidence            455555544


No 254
>KOG2857|consensus
Probab=21.70  E-value=46  Score=19.38  Aligned_cols=22  Identities=27%  Similarity=0.572  Sum_probs=14.4

Q ss_pred             cccCCccccccCCHHHHHHHHH
Q psy13123        100 KFACETCGKLFSSKHGLKYHVR  121 (129)
Q Consensus       100 ~~~C~~C~~~f~~~~~l~~h~~  121 (129)
                      .|+|+.|.--+.+-.-+..|.-
T Consensus        17 KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hccCCCCCCccccchhhhhccC
Confidence            4777777666666666666644


No 255
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=21.62  E-value=43  Score=15.75  Aligned_cols=9  Identities=33%  Similarity=0.995  Sum_probs=5.3

Q ss_pred             cCCcccccc
Q psy13123        102 ACETCGKLF  110 (129)
Q Consensus       102 ~C~~C~~~f  110 (129)
                      .|+.||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            466666554


No 256
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=21.61  E-value=77  Score=19.16  Aligned_cols=19  Identities=16%  Similarity=0.506  Sum_probs=14.7

Q ss_pred             CcccCCccccccCCHHHHH
Q psy13123         99 KKFACETCGKLFSSKHGLK  117 (129)
Q Consensus        99 ~~~~C~~C~~~f~~~~~l~  117 (129)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4678999999998665554


No 257
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=21.53  E-value=16  Score=21.87  Aligned_cols=9  Identities=44%  Similarity=1.246  Sum_probs=4.1

Q ss_pred             ccCcchhcc
Q psy13123         18 QCGECGKQF   26 (129)
Q Consensus        18 ~C~~C~~~~   26 (129)
                      .|+.|+++|
T Consensus        76 ~C~~C~~Tf   84 (176)
T COG3880          76 GCHNCGMTF   84 (176)
T ss_pred             cCccccccH
Confidence            344444444


No 258
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=21.26  E-value=1.2e+02  Score=20.19  Aligned_cols=24  Identities=38%  Similarity=0.782  Sum_probs=14.8

Q ss_pred             CCeecccccccccChhHHHHHHHH
Q psy13123         71 KPYVCTYCGKAFVRASDLKRHIDA   94 (129)
Q Consensus        71 ~~~~c~~c~~~~~~~~~l~~h~~~   94 (129)
                      .-|.|..|-+-|.....+..|+..
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHHHh
Confidence            346666666666666666666553


No 259
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=21.20  E-value=44  Score=14.70  Aligned_cols=7  Identities=43%  Similarity=1.274  Sum_probs=3.3

Q ss_pred             cccCcch
Q psy13123         17 YQCGECG   23 (129)
Q Consensus        17 ~~C~~C~   23 (129)
                      ..|+.||
T Consensus         3 ~~Cp~Cg    9 (47)
T PF14690_consen    3 PRCPHCG    9 (47)
T ss_pred             ccCCCcC
Confidence            3445554


No 260
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=20.99  E-value=73  Score=21.76  Aligned_cols=21  Identities=33%  Similarity=0.781  Sum_probs=17.8

Q ss_pred             cccCcchhccCChhhHHHHHH
Q psy13123         17 YQCGECGKQFTRKFSLNAHLH   37 (129)
Q Consensus        17 ~~C~~C~~~~~~~~~l~~h~~   37 (129)
                      +-|..|++.|.....+..|..
T Consensus       239 ~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         239 VYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             eeeHhhhhHhhhhHHHHHHHh
Confidence            569999999999888888874


No 261
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=20.95  E-value=36  Score=19.66  Aligned_cols=14  Identities=36%  Similarity=0.845  Sum_probs=11.3

Q ss_pred             CCcccCCccccccC
Q psy13123         98 VKKFACETCGKLFS  111 (129)
Q Consensus        98 ~~~~~C~~C~~~f~  111 (129)
                      .++..|..||..|.
T Consensus       110 g~~~RCpeCG~~fk  123 (136)
T PF01215_consen  110 GKPQRCPECGQVFK  123 (136)
T ss_dssp             TSEEEETTTEEEEE
T ss_pred             CCccCCCCCCeEEE
Confidence            46889999998774


No 262
>PRK05580 primosome assembly protein PriA; Validated
Probab=20.87  E-value=68  Score=23.96  Aligned_cols=12  Identities=33%  Similarity=0.764  Sum_probs=6.8

Q ss_pred             CCCccCCcchhh
Q psy13123         42 SSNYKCPLCGKF   53 (129)
Q Consensus        42 ~~~~~c~~c~~~   53 (129)
                      ..+..|+.|+..
T Consensus       419 ~~~~~Cp~Cg~~  430 (679)
T PRK05580        419 PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCcCC
Confidence            345667777543


No 263
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=20.47  E-value=74  Score=20.97  Aligned_cols=32  Identities=25%  Similarity=0.580  Sum_probs=18.3

Q ss_pred             ccCCcchhhhcchhHHHHHHHHhCCCCCeecccccccccCh
Q psy13123         45 YKCPLCGKFFIQLCHMKDHIQAHGGLKPYVCTYCGKAFVRA   85 (129)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~~~~~~~~~~~~~c~~c~~~~~~~   85 (129)
                      ..|+.|+.....+. |..        +-++|+.|+.-|.-.
T Consensus        27 ~~c~~c~~~~~~~~-l~~--------~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LER--------NLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHH-HHh--------hCCCCCCCCCcCcCC
Confidence            56777776543332 221        236788888765543


No 264
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=20.33  E-value=50  Score=15.47  Aligned_cols=17  Identities=18%  Similarity=0.436  Sum_probs=10.1

Q ss_pred             CCCCccccCcchhccCC
Q psy13123         12 TTTSAYQCGECGKQFTR   28 (129)
Q Consensus        12 ~~~~~~~C~~C~~~~~~   28 (129)
                      .+...++|..|+..+..
T Consensus        31 ~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTTCEEEETTT--EEEH
T ss_pred             CCCCEEEeeCCCCEecc
Confidence            34456889999987643


No 265
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.30  E-value=63  Score=15.33  Aligned_cols=15  Identities=27%  Similarity=0.663  Sum_probs=7.4

Q ss_pred             cCCccccccCCHHHH
Q psy13123        102 ACETCGKLFSSKHGL  116 (129)
Q Consensus       102 ~C~~C~~~f~~~~~l  116 (129)
                      -|-+||..|.....|
T Consensus        29 YC~~Cg~~Y~d~~dL   43 (55)
T PF13821_consen   29 YCFWCGTKYDDEEDL   43 (55)
T ss_pred             eeeeeCCccCCHHHH
Confidence            455555555554444


No 266
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=20.29  E-value=42  Score=14.70  Aligned_cols=11  Identities=36%  Similarity=0.945  Sum_probs=5.3

Q ss_pred             Ceecccccccc
Q psy13123         72 PYVCTYCGKAF   82 (129)
Q Consensus        72 ~~~c~~c~~~~   82 (129)
                      .+.|..||.+.
T Consensus        19 ~~vC~~CG~Vl   29 (43)
T PF08271_consen   19 ELVCPNCGLVL   29 (43)
T ss_dssp             EEEETTT-BBE
T ss_pred             eEECCCCCCEe
Confidence            34566666543


No 267
>KOG1994|consensus
Probab=20.22  E-value=69  Score=20.38  Aligned_cols=23  Identities=30%  Similarity=0.723  Sum_probs=19.6

Q ss_pred             CCCeecccccccccChhHHHHHH
Q psy13123         70 LKPYVCTYCGKAFVRASDLKRHI   92 (129)
Q Consensus        70 ~~~~~c~~c~~~~~~~~~l~~h~   92 (129)
                      ...|-|.+||--|.+..+|..|-
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            34689999999999999998773


No 268
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=20.02  E-value=34  Score=14.78  Aligned_cols=10  Identities=30%  Similarity=1.142  Sum_probs=5.5

Q ss_pred             ccCCcccccc
Q psy13123        101 FACETCGKLF  110 (129)
Q Consensus       101 ~~C~~C~~~f  110 (129)
                      |.|..||..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5566665543


Done!