Diaphorina citri psyllid: psy13141


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MACRDLGKANGVRESIITKTNNHQVVVKKLDLASLDSVREFAAQILDEEKHIHVLINNAGQGGILNRITKDGLQLGMQIDQSEV
cccccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHHcccccc
*ACRDLGKANGVRESIITKTNNHQVVVKKLDLASLDSVREFAAQILDEEKHIHVLINNAGQGGILNRITKDGLQLGMQIDQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACRDLGKANGVRESIITKTNNHQVVVKKLDLASLDSVREFAAQILDEEKHIHVLINNAGQGGILNRITKDGLQLGMQIDQSEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0016616 [MF]oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0003674, GO:0016614, GO:0016491
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0065007 [BP]biological regulationprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL