Diaphorina citri psyllid: psy13152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-
MIATLLSRHAESEVAALNRRIQLLEEDLERSEERLATATAKLAEASQAADESERDWITRGQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcc
**************AALNRRIQLLEEDLERSE*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIATLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWITRGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tropomyosin isoforms c/e Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction. Involved in muscle actin filament organization and muscle arm extension and morphology. Also has a role in male mating behavior by regulating the copulatory spicules. Binds to F-actin.confidentQ27249
Tropomyosin alpha-3 chain Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.confidentQ63610
Tropomyosin Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction.confidentQ9NG56

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031941 [CC]filamentous actinprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005862 [CC]muscle thin filament tropomyosinprobableGO:0015629, GO:0030016, GO:0030017, GO:0043229, GO:0043228, GO:0043226, GO:0005856, GO:0005575, GO:0044430, GO:0005737, GO:0044424, GO:0005865, GO:0036379, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0043292, GO:0044422, GO:0044449
GO:0048738 [BP]cardiac muscle tissue developmentprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0072359, GO:0009888, GO:0044767, GO:0014706, GO:0072358, GO:0008150, GO:0060537, GO:0048731, GO:0007275, GO:0044699
GO:0032587 [CC]ruffle membraneprobableGO:0001726, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0032059 [CC]blebprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005200 [MF]structural constituent of cytoskeletonprobableGO:0003674, GO:0005198
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032781 [BP]positive regulation of ATPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0050789, GO:0043085, GO:0043462, GO:0031329, GO:0051345, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0019219, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0030049 [BP]muscle filament slidingprobableGO:0032501, GO:0044707, GO:0006936, GO:0009987, GO:0003012, GO:0006928, GO:0030048, GO:0033275, GO:0044763, GO:0030029, GO:0008150, GO:0070252, GO:0044699, GO:0003008
GO:0070865 [CC]investment coneprobableGO:0005856, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0070864, GO:0043226, GO:0044422
GO:0008015 [BP]blood circulationprobableGO:0032501, GO:0044707, GO:0003013, GO:0008150, GO:0044699, GO:0003008
GO:0008016 [BP]regulation of heart contractionprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0002102 [CC]podosomeprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448
GO:0051693 [BP]actin filament cappingprobableGO:0033043, GO:1901879, GO:0051129, GO:0051128, GO:0008064, GO:0043244, GO:0050789, GO:0044699, GO:0043242, GO:0030832, GO:0030833, GO:0030834, GO:0030835, GO:0030837, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0032970, GO:0065008, GO:0009987, GO:0031333, GO:1901880, GO:0044763, GO:0032956, GO:0043254, GO:0050794, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9C, chain A
Confidence level:very confident
Coverage over the Query: 27-59
View the alignment between query and template
View the model in PyMOL