Diaphorina citri psyllid: psy13157


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430----
MQTVKFRIIIRSVIASLDTLGILGSTVTKYLLEKLITACRVINHTPICTCPQGYVGDAFSGCYPKPPEHPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPHGVCVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICNVENHAVMCTCPPGTTGSPFIQCKPVQNEPVYTNPCQPSPCGPNSQCREINSQAVCSCLPNYFGSPPACRPECTVNSDCLQSKACFNQKCVDPCPGTCGQNANCRVINHSPICTCKPGFTGDALVYCNRIPPSRPLESPPEYVNPCVPSPCGPYAQCRDINGSPSCSCLPNYIGAPPNCRPECVQNSECPHDKACINEKCADPCLGSCGYGAVCTVINHSPICTCPEGFIGDAFSSCYPKPPEPIEPVIQEDTCNCVPNAECRDGVCLCLPDYYGDGYVSCRPECVQNSDCPRNKACIRNKCKNPCTPGTCGEGAICDVVNHAVSCTCPPGTTGSPFVQCKTIQYEPVYTNPCQPSPCGPNSQCREVNHQAVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEASRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEACINEKCQDPCPGSCGYNAECKVINHTPICTCPQGFIGDAFSGCYPKPPEPEQPVIQEDTCNCVPNAECRDGTFLAEQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPSNKACIRNKCKNPCVPGTCGQGAVCDVINHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAPVYTNPCQPSPCGPNSQCREVNKQSVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNRIHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPACRPECTVNSDCPLNKACQNQKCVDPCPGTCGQNANCKVINHSPICTCKPGYTGDALSYCNRIPPPPPPQEPICTCKPGYTGDALSYCNRIPPPPPPQDDVPEPVNPCYPSPCGLYSECRNVNGAPSCSCLINYIGSPPNCRPECIQNSLLLGQSLLRTHSAVQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVSAVQPVIQEDTCNCVPNAECRDGVCVCLPEYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVHPICSCPQGYIGDGFNGCYPKPPEGLSPGTSVFCHSYVYG
cccccEEEEEcccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccEEEEcccccEEEcccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccccccccccccEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEECcccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccCCcccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccCCccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEccccccEEcccccccccccccccccccccccccccccccccccc
*QTVKFRIIIRSVIASLDTLGILGSTVTKYLLEKLITACRVINHTPICTCPQGYVGDAFSGCYPKPPEHPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPHGVCVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICNVENHAVMCTCPPGTTGSPFIQCKPVQNEPVYTNPCQPSPCGPNSQCREINSQAVCSCLPNYFGSPPACRPECTVNSDCLQSKACFNQKCVDPCPGTCGQNANCRVINHSPICTCKPGFTGDALVYCNRIPPSRPLESPPEYVNPCVPSPCGPYAQCRDINGSPSCSCLPNYIGAPPNCRPECVQNSECPHDKACINEKCADPCLGSCGYGAVCTVINHSPICTCPEGFIGDAFSSCYPKPPEPIEPVIQEDTCNCVPNAECRDGVCLCLPDYYGDGYVSCRPECVQNSDCPRNKACIRNKCKNPCTPGTCGEGAICDVVNHAVSCTCPPGTTGSPFVQCKTIQYEPVYTNPCQPSPCGPNSQCREVNHQAVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEASRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEACINEKCQDPCPGSCGYNAECKVINHTPICTCPQGFIGDAFSGCYPKPPEPEQPVIQEDTCNCVPNAECRDGTFLAEQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPSNKACIRNKCKNPCVPGTCGQGAVCDVINHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAPVYTNPCQPSPCGPNSQCREVNKQSVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNRIHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPACRPECTVNSDCPLNKACQNQKCVDPCPGTCGQNANCKVINHSPICTCKPGYTGDALSYCNRIPPPPPPQEPICTCKPGYTGDALSYCNRIPPPPPPQDDVPEPVNPCYPSPCGLYSECRNVNGAPSCSCLINYIGSPPNCRPECIQNSLLLGQSLLRTHSAVQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVSAVQPVIQEDTCNCVPNAECRDGVCVCLPEYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVHPICSCPQGYIGDGFNGCYPKPPEGLSPGTSVFCHSY*Y*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTVKFRIIIRSVIASLDTLGILGSTVTKYLLEKLITACRVINHTPICTCPQGYVGDAFSGCYPKPPEHPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPHGVCVCLPDYYGDGYVSCRPECVLNSDCPSNKACIRNKCKNPCVPGTCGEGAICNVENHAVMCTCPPGTTGSPFIQCKPVQNEPVYTNPCQPSPCGPNSQCREINSQAVCSCLPNYFGSPPACRPECTVNSDCLQSKACFNQKCVDPCPGTCGQNANCRVINHSPICTCKPGFTGDALVYCNRIPPSRPLESPPEYVNPCVPSPCGPYAQCRDINGSPSCSCLPNYIGAPPNCRPECVQNSECPHDKACINEKCADPCLGSCGYGAVCTVINHSPICTCPEGFIGDAFSSCYPKPPEPIEPVIQEDTCNCVPNAECRDGVCLCLPDYYGDGYVSCRPECVQNSDCPRNKACIRNKCKNPCTPGTCGEGAICDVVNHAVSCTCPPGTTGSPFVQCKTIQYEPVYTNPCQPSPCGPNSQCREVNHQAVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNKIPPRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEASRPPPQEDVPEPVNPCYPSPCGPYSQCRDIGGSPSCSCLPNYIGSPPNCRPECVMNSECPSHEACINEKCQDPCPGSCGYNAECKVINHTPICTCPQGFIGDAFSGCYPKPPEPEQPVIQEDTCNCVPNAECRDGTFLAEQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPSNKACIRNKCKNPCVPGTCGQGAVCDVINHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAPVYTNPCQPSPCGPNSQCREVNKQSVCSCLPNYFGSPPACRPECTVNSDCPLDKACVNQKCVDPCPGSCGQNANCRVINHSPVCSCKPGFTGEPRIRCNRIHAVMCTCPPGTTGSPFVQCKPIQNEPVYTNPCQPSPCGPNSQCREVNKQAVCSCLPNYFGSPPACRPECTVNSDCPLNKACQNQKCVDPCPGTCGQNANCKVINHSPICTCKPGYTGDALSYCNRIPPPPPPQEPICTCKPGYTGDALSYCNRIPPPPPPQDDVPEPVNPCYPSPCGLYSECRNVNGAPSCSCLINYIGSPPNCRPECIQNSLLLGQSLLRTHSAVQPVIQEDTCNCVPNAECRDGVCVCLPDYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVSAVQPVIQEDTCNCVPNAECRDGVCVCLPEYYGDGYVSCRPECVLNNDCPRNKACIKYKCKNPCVHPICSCPQGYIGDGFNGCYPKPPEGLSPGTSVFCHSYVYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0008362 [BP]chitin-based embryonic cuticle biosynthetic processprobableGO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0007475 [BP]apposition of dorsal and ventral imaginal disc-derived wing surfacesprobableGO:0048563, GO:0048569, GO:0008587, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035107, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040005 [BP]chitin-based cuticle attachment to epitheliumprobableGO:0032501, GO:0044707, GO:0007591, GO:0022404, GO:0008150, GO:0042303, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K6S, chain B
Confidence level:very confident
Coverage over the Query: 73-100,112-130,143-289,306-320
View the alignment between query and template
View the model in PyMOL
Template: 3K6S, chain B
Confidence level:very confident
Coverage over the Query: 153-290,303-342
View the alignment between query and template
View the model in PyMOL
Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 196-244,257-354
View the alignment between query and template
View the model in PyMOL
Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 624-659,685-736,749-777
View the alignment between query and template
View the model in PyMOL
Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 943-1103
View the alignment between query and template
View the model in PyMOL
Template: 2BOU, chain A
Confidence level:very confident
Coverage over the Query: 573-607,622-664,678-733
View the alignment between query and template
View the model in PyMOL
Template: 2GY5, chain A
Confidence level:confident
Coverage over the Query: 962-989,1012-1166,1179-1190,1210-1247
View the alignment between query and template
View the model in PyMOL
Template: 3FCS, chain B
Confidence level:confident
Coverage over the Query: 467-607,619-661,687-724
View the alignment between query and template
View the model in PyMOL
Template: 3FCS, chain B
Confidence level:confident
Coverage over the Query: 150-290,303-350,366-397
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:confident
Coverage over the Query: 1048-1116,1132-1190,1207-1246
View the alignment between query and template
View the model in PyMOL
Template: 2GY5, chain A
Confidence level:confident
Coverage over the Query: 1089-1116,1133-1166,1179-1190,1210-1303
View the alignment between query and template
View the model in PyMOL
Template: 4FBR, chain A
Confidence level:confident
Coverage over the Query: 318-349,368-410,448-449,465-479,494-583,598-607,621-660,685-724,750-776
View the alignment between query and template
View the model in PyMOL
Template: 4FBR, chain A
Confidence level:confident
Coverage over the Query: 38-120,131-242,257-287,303-342,368-394
View the alignment between query and template
View the model in PyMOL
Template: 4AQS, chain A
Confidence level:confident
Coverage over the Query: 163-244,258-291,307-347,373-397,430-502
View the alignment between query and template
View the model in PyMOL
Template: 1KLO, chain A
Confidence level:confident
Coverage over the Query: 1216-1302,1328-1366
View the alignment between query and template
View the model in PyMOL
Template: 2P28, chain B
Confidence level:confident
Coverage over the Query: 417-544
View the alignment between query and template
View the model in PyMOL
Template: 2DTG, chain E
Confidence level:probable
Coverage over the Query: 70-81,92-158,172-177,193-282
View the alignment between query and template
View the model in PyMOL