Query         psy13164
Match_columns 193
No_of_seqs    174 out of 2140
Neff          10.2
Searched_HMMs 46136
Date          Fri Aug 16 21:50:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13164.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13164hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 1.2E-26 2.7E-31  168.7   5.5  129   53-183   126-265 (279)
  2 KOG2462|consensus               99.9 3.2E-25 6.9E-30  161.4   5.6  108   84-192   128-246 (279)
  3 KOG1074|consensus               99.6 2.2E-16 4.8E-21  130.0   2.3   38   56-94    352-389 (958)
  4 KOG3608|consensus               99.6   3E-15 6.5E-20  112.8   5.7  130   56-188   236-379 (467)
  5 KOG3576|consensus               99.6 7.6E-16 1.7E-20  107.8   2.1  111   55-187   115-238 (267)
  6 KOG3576|consensus               99.5 1.6E-15 3.6E-20  106.1   1.1   82  105-186   115-198 (267)
  7 KOG1074|consensus               99.5 3.3E-15 7.1E-20  123.2   2.4   54  136-189   881-935 (958)
  8 KOG3623|consensus               99.5 4.5E-15 9.8E-20  120.8   1.4  106   58-183   211-331 (1007)
  9 KOG3608|consensus               99.5 3.7E-14 8.1E-19  107.0   4.4  139   54-192   204-355 (467)
 10 KOG3623|consensus               99.5 1.4E-14   3E-19  118.0   1.8   75  107-181   894-970 (1007)
 11 PHA00733 hypothetical protein   99.1 8.2E-11 1.8E-15   79.1   3.4   80  106-186    39-124 (128)
 12 PHA02768 hypothetical protein;  99.1 4.5E-11 9.7E-16   66.9   1.7   42  135-177     6-47  (55)
 13 PLN03086 PRLI-interacting fact  99.1 2.9E-10 6.3E-15   92.8   6.4  126   56-192   406-544 (567)
 14 PHA02768 hypothetical protein;  98.9 6.8E-10 1.5E-14   62.2   1.7   43  107-150     5-47  (55)
 15 PLN03086 PRLI-interacting fact  98.9 5.2E-09 1.1E-13   85.6   6.3  109   59-183   435-562 (567)
 16 PHA00733 hypothetical protein   98.8 4.7E-09   1E-13   70.6   3.9   56  103-159    69-124 (128)
 17 KOG3993|consensus               98.7 1.4E-08 3.1E-13   78.9   3.1   22  162-183   459-480 (500)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.6 2.2E-08 4.7E-13   48.0   2.3   24  149-172     1-25  (26)
 19 PHA00616 hypothetical protein   98.6 1.5E-08 3.3E-13   54.0   1.8   32  161-192     1-32  (44)
 20 KOG3993|consensus               98.6 6.8E-09 1.5E-13   80.6  -0.2   79  108-186   268-381 (500)
 21 PHA00732 hypothetical protein   98.4 2.1E-07 4.5E-12   57.0   2.2   48  107-159     1-49  (79)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.4 3.4E-07 7.4E-12   43.8   2.3   24  122-145     1-25  (26)
 23 PHA00616 hypothetical protein   98.3   4E-07 8.6E-12   48.6   1.5   38  134-171     1-39  (44)
 24 PHA00732 hypothetical protein   98.3   6E-07 1.3E-11   55.0   2.3   47  134-185     1-48  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.2 1.5E-06 3.2E-11   40.3   1.9   23  162-184     1-23  (23)
 26 PF05605 zf-Di19:  Drought indu  98.1 6.1E-06 1.3E-10   46.9   4.0   48  135-185     3-53  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  97.9 6.8E-06 1.5E-10   38.0   2.0   22  135-156     1-22  (23)
 28 PF12756 zf-C2H2_2:  C2H2 type   97.9 6.8E-06 1.5E-10   52.7   2.6   73  109-184     1-73  (100)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.7E-05 3.6E-10   36.8   2.1   23  162-184     1-23  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.3E-05 2.7E-10   38.6   1.7   25  161-185     1-25  (27)
 31 PF05605 zf-Di19:  Drought indu  97.7   7E-05 1.5E-09   42.5   4.1   48  108-158     3-53  (54)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.6 7.1E-05 1.5E-09   34.6   2.3   23  135-157     1-23  (24)
 33 PF09237 GAGA:  GAGA factor;  I  97.5 6.4E-05 1.4E-09   41.1   1.9   29  161-189    24-52  (54)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.5  0.0001 2.2E-09   47.2   2.6   24   59-82      1-24  (100)
 35 smart00355 ZnF_C2H2 zinc finge  97.4 0.00014 3.1E-09   34.1   2.3   24  162-185     1-24  (26)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.4 0.00012 2.6E-09   35.1   1.9   23  108-130     2-24  (27)
 37 smart00355 ZnF_C2H2 zinc finge  97.0 0.00072 1.6E-08   31.6   2.1   24  135-158     1-24  (26)
 38 COG5189 SFP1 Putative transcri  96.9 0.00024 5.3E-09   53.9   0.4   22  160-181   397-418 (423)
 39 COG5189 SFP1 Putative transcri  96.8 0.00053 1.1E-08   52.2   0.9   51  104-154   346-418 (423)
 40 PF12874 zf-met:  Zinc-finger o  96.7 0.00089 1.9E-08   31.3   1.4   22  162-183     1-22  (25)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.7  0.0011 2.4E-08   30.7   1.5   22  162-184     1-22  (24)
 42 PF09237 GAGA:  GAGA factor;  I  96.6  0.0018 3.8E-08   35.5   2.0   26  134-159    24-49  (54)
 43 PRK04860 hypothetical protein;  96.5  0.0019 4.2E-08   45.1   2.3   37  134-174   119-156 (160)
 44 PF12874 zf-met:  Zinc-finger o  96.5  0.0019   4E-08   30.2   1.5   22  135-156     1-22  (25)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0041 8.8E-08   28.7   1.7   21  135-156     1-21  (24)
 46 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0083 1.8E-07   28.1   1.9   20  163-183     4-23  (25)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  95.8  0.0023 5.1E-08   30.5   0.0   22  162-183     2-23  (27)
 48 PRK04860 hypothetical protein;  95.6   0.009 1.9E-07   41.8   2.1   37  107-147   119-156 (160)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  95.0  0.0054 1.2E-07   29.2  -0.2   22  135-156     2-23  (27)
 50 smart00451 ZnF_U1 U1-like zinc  94.1   0.037 8.1E-07   27.9   1.6   23  161-183     3-25  (35)
 51 KOG1146|consensus               92.9   0.023 4.9E-07   51.3  -0.6  129   53-184   461-641 (1406)
 52 smart00451 ZnF_U1 U1-like zinc  92.9   0.082 1.8E-06   26.6   1.7   23  134-156     3-25  (35)
 53 PF12013 DUF3505:  Protein of u  92.0    0.35 7.7E-06   31.5   4.3   25  162-186    81-109 (109)
 54 KOG2186|consensus               90.9    0.19 4.2E-06   37.4   2.3   46  108-155     4-49  (276)
 55 cd00350 rubredoxin_like Rubred  90.2     0.2 4.2E-06   25.1   1.3   10  108-117     2-11  (33)
 56 COG5048 FOG: Zn-finger [Genera  90.0   0.051 1.1E-06   43.7  -1.4   54  107-160   289-349 (467)
 57 COG5048 FOG: Zn-finger [Genera  89.8   0.063 1.4E-06   43.2  -1.1   59  134-192   289-354 (467)
 58 PF06524 NOA36:  NOA36 protein;  88.5   0.073 1.6E-06   39.7  -1.3   24  134-157   209-232 (314)
 59 KOG1146|consensus               88.5    0.14 3.1E-06   46.5   0.2  116   57-183  1228-1350(1406)
 60 KOG2231|consensus               87.9     0.8 1.7E-05   39.2   4.1  116   58-182   100-264 (669)
 61 KOG2893|consensus               87.1    0.18 3.8E-06   37.3  -0.1   41  110-153    13-53  (341)
 62 PF09538 FYDLN_acid:  Protein o  86.2    0.44 9.6E-06   31.0   1.4   12  161-172    26-37  (108)
 63 KOG2231|consensus               85.2     1.5 3.3E-05   37.6   4.4   47  135-184   183-235 (669)
 64 KOG2186|consensus               84.8     0.7 1.5E-05   34.5   2.0   50  134-185     3-52  (276)
 65 COG5236 Uncharacterized conser  83.5    0.82 1.8E-05   35.8   2.0   75  108-183   152-242 (493)
 66 TIGR00622 ssl1 transcription f  83.4     1.2 2.5E-05   29.2   2.4   76  107-185    15-105 (112)
 67 KOG4173|consensus               83.1    0.53 1.2E-05   34.0   0.8   73  108-182    80-167 (253)
 68 KOG2482|consensus               82.9       4 8.6E-05   32.1   5.4   56  134-189   144-225 (423)
 69 COG5236 Uncharacterized conser  82.7     1.8 3.9E-05   34.0   3.5  121   57-183   151-303 (493)
 70 KOG2785|consensus               82.7     3.9 8.5E-05   32.6   5.4   74  107-183   166-242 (390)
 71 COG4049 Uncharacterized protei  82.5    0.74 1.6E-05   25.8   1.0   25  105-129    15-39  (65)
 72 PF12013 DUF3505:  Protein of u  82.2     3.8 8.2E-05   26.6   4.5   26  134-159    80-109 (109)
 73 PRK14890 putative Zn-ribbon RN  81.0     1.9 4.2E-05   24.6   2.4    9  134-142    48-56  (59)
 74 PHA00626 hypothetical protein   79.8     1.4 2.9E-05   24.8   1.5   11  108-118    24-34  (59)
 75 smart00659 RPOLCX RNA polymera  79.5     1.6 3.4E-05   23.4   1.7    9  108-116     3-11  (44)
 76 KOG2785|consensus               79.2       2 4.3E-05   34.2   2.7   73   54-129   163-242 (390)
 77 KOG2482|consensus               79.1     3.9 8.4E-05   32.2   4.2   22  162-183   280-301 (423)
 78 smart00614 ZnF_BED BED zinc fi  78.0       2 4.3E-05   23.6   1.8   10  135-144    19-28  (50)
 79 PF05443 ROS_MUCR:  ROS/MUCR tr  77.6     1.7 3.6E-05   29.4   1.7   22  162-186    73-94  (132)
 80 PF09986 DUF2225:  Uncharacteri  77.0    0.42 9.1E-06   35.2  -1.4   41  107-147     5-61  (214)
 81 PF09723 Zn-ribbon_8:  Zinc rib  76.5    0.94   2E-05   24.0   0.3    9  108-116     6-14  (42)
 82 PF12907 zf-met2:  Zinc-binding  75.5     1.6 3.5E-05   22.9   0.9   32  162-193     2-37  (40)
 83 PF02892 zf-BED:  BED zinc fing  75.5     2.1 4.6E-05   22.7   1.5   20  162-181    17-40  (45)
 84 cd00729 rubredoxin_SM Rubredox  75.4     1.9 4.1E-05   21.6   1.2    9  108-116     3-11  (34)
 85 COG2888 Predicted Zn-ribbon RN  75.3     2.7   6E-05   24.0   1.9   11  132-142    48-58  (61)
 86 smart00834 CxxC_CXXC_SSSS Puta  73.9     1.3 2.9E-05   22.9   0.4   10  108-117     6-15  (41)
 87 TIGR02098 MJ0042_CXXC MJ0042 f  73.7     2.8   6E-05   21.4   1.6   10  135-144    26-35  (38)
 88 COG1592 Rubrerythrin [Energy p  73.2     2.1 4.6E-05   30.1   1.4   22  107-141   134-156 (166)
 89 PF13719 zinc_ribbon_5:  zinc-r  72.7     3.3 7.1E-05   21.2   1.7   11  107-117    25-35  (37)
 90 COG1997 RPL43A Ribosomal prote  72.2     2.3   5E-05   26.3   1.2   11  135-145    54-64  (89)
 91 KOG2893|consensus               71.2     1.8 3.9E-05   32.2   0.7   43   34-76     11-53  (341)
 92 PF14353 CpXC:  CpXC protein     70.3     3.7 8.1E-05   27.4   2.1   49  108-156     2-60  (128)
 93 smart00734 ZnF_Rad18 Rad18-lik  69.0     4.7  0.0001   18.8   1.6   19  163-182     3-21  (26)
 94 TIGR02605 CxxC_CxxC_SSSS putat  67.8     2.1 4.5E-05   23.6   0.3   10  108-117     6-15  (52)
 95 COG1198 PriA Primosomal protei  67.3     3.4 7.3E-05   36.2   1.6    9  161-169   475-483 (730)
 96 smart00531 TFIIE Transcription  66.9     4.8  0.0001   27.7   2.1   12  135-146   100-111 (147)
 97 TIGR00373 conserved hypothetic  66.7     6.5 0.00014   27.5   2.7   29  135-171   110-138 (158)
 98 PF05443 ROS_MUCR:  ROS/MUCR tr  66.5     4.5 9.8E-05   27.4   1.8   24  134-160    72-95  (132)
 99 TIGR02300 FYDLN_acid conserved  66.4     4.1 8.8E-05   27.2   1.5   12  134-145    26-37  (129)
100 TIGR00373 conserved hypothetic  66.0     3.9 8.4E-05   28.6   1.5   32  105-144   107-138 (158)
101 PRK06266 transcription initiat  65.9     3.2 6.8E-05   29.7   1.0   29  135-171   118-146 (178)
102 PF06524 NOA36:  NOA36 protein;  65.5       2 4.4E-05   32.3   0.0   81  103-185   138-233 (314)
103 KOG4167|consensus               64.8     2.3 4.9E-05   36.8   0.1   25  134-158   792-816 (907)
104 PF15269 zf-C2H2_7:  Zinc-finge  64.7     6.2 0.00013   21.1   1.7   21  162-182    21-41  (54)
105 PRK00398 rpoP DNA-directed RNA  64.3     3.6 7.8E-05   22.1   0.9    8  108-115    22-29  (46)
106 PF13717 zinc_ribbon_4:  zinc-r  64.3     5.5 0.00012   20.2   1.5    9  135-143    26-34  (36)
107 COG1996 RPC10 DNA-directed RNA  63.7     4.5 9.7E-05   22.2   1.1   10  108-117     7-16  (49)
108 PRK00464 nrdR transcriptional   63.3     2.9 6.4E-05   29.1   0.5   15  108-122    29-43  (154)
109 KOG4167|consensus               59.8     2.5 5.4E-05   36.6  -0.4   24  162-185   793-816 (907)
110 KOG3408|consensus               59.0     6.2 0.00013   26.1   1.4   23  161-183    57-79  (129)
111 PF09963 DUF2197:  Uncharacteri  58.9     1.8   4E-05   24.4  -0.9   36   59-94      4-39  (56)
112 PRK04023 DNA polymerase II lar  58.8      10 0.00023   34.4   3.0   11  161-171   663-673 (1121)
113 PF03604 DNA_RNApol_7kD:  DNA d  56.8     5.4 0.00012   19.8   0.6    8  108-115    18-25  (32)
114 TIGR00595 priA primosomal prot  56.1     6.2 0.00013   33.2   1.3    8  134-141   253-260 (505)
115 KOG4173|consensus               55.3     7.9 0.00017   28.2   1.5   46  135-182    80-127 (253)
116 PF13878 zf-C2H2_3:  zinc-finge  54.4      14  0.0003   19.4   2.0   24  162-185    14-39  (41)
117 COG4957 Predicted transcriptio  52.2     7.5 0.00016   26.2   0.9   22  135-159    77-98  (148)
118 KOG3507|consensus               52.1     5.7 0.00012   22.6   0.3   28   87-118    21-48  (62)
119 PRK14873 primosome assembly pr  50.4       9 0.00019   33.4   1.4    8   88-95    385-392 (665)
120 PF08274 PhnA_Zn_Ribbon:  PhnA   48.9     9.2  0.0002   18.6   0.7    8  134-141    19-26  (30)
121 PF01927 Mut7-C:  Mut7-C RNAse   47.6      12 0.00026   25.7   1.5   18  134-151   124-141 (147)
122 PF04959 ARS2:  Arsenite-resist  47.4      16 0.00034   27.0   2.1   23  134-156    77-99  (214)
123 KOG0696|consensus               46.4     8.3 0.00018   31.6   0.6   57  105-169    71-129 (683)
124 PF04959 ARS2:  Arsenite-resist  46.0     9.8 0.00021   28.1   0.8   25  161-185    77-101 (214)
125 PF10571 UPF0547:  Uncharacteri  44.3      11 0.00024   17.6   0.6    9  163-171    16-24  (26)
126 PF07754 DUF1610:  Domain of un  41.6      12 0.00026   17.2   0.5    7  108-114    17-23  (24)
127 PF01363 FYVE:  FYVE zinc finge  40.4      15 0.00033   21.4   0.9    9  109-117    11-19  (69)
128 PF13453 zf-TFIIB:  Transcripti  40.1      21 0.00045   18.5   1.3   16  108-123    20-35  (41)
129 COG3364 Zn-ribbon containing p  40.1      18 0.00038   23.2   1.2   12  135-146     3-14  (112)
130 KOG2593|consensus               39.5      22 0.00048   29.0   2.0   35  105-142   126-161 (436)
131 PRK05580 primosome assembly pr  38.0      17 0.00037   31.8   1.3    9  134-142   421-429 (679)
132 TIGR01206 lysW lysine biosynth  38.0      24 0.00051   19.8   1.4    7  109-115    24-30  (54)
133 COG4896 Uncharacterized protei  37.2     7.2 0.00016   22.4  -0.8   11   83-93     28-38  (68)
134 KOG3408|consensus               36.9      23 0.00049   23.5   1.3   23  134-156    57-79  (129)
135 COG1656 Uncharacterized conser  36.2      36 0.00079   24.0   2.4   18  134-151   130-147 (165)
136 KOG2593|consensus               36.2      34 0.00074   28.0   2.5   35  134-171   128-163 (436)
137 PF10537 WAC_Acf1_DNA_bd:  ATP-  36.0      56  0.0012   21.0   3.1   37  107-143     3-39  (102)
138 COG5151 SSL1 RNA polymerase II  35.2      20 0.00043   28.0   1.0   48  136-184   364-411 (421)
139 PF01780 Ribosomal_L37ae:  Ribo  34.6      11 0.00024   23.6  -0.3   11  135-145    54-64  (90)
140 PF02176 zf-TRAF:  TRAF-type zi  34.1      31 0.00067   19.3   1.6    8  148-155    24-31  (60)
141 PF13451 zf-trcl:  Probable zin  33.9      33 0.00071   18.9   1.5   11  108-118     5-15  (49)
142 KOG2907|consensus               33.5      21 0.00046   23.3   0.8   10   60-69     10-19  (116)
143 KOG2807|consensus               33.4      61  0.0013   25.6   3.4   24  161-184   345-368 (378)
144 smart00154 ZnF_AN1 AN1-like Zi  33.3      19 0.00042   18.6   0.5   13  161-173    12-24  (39)
145 TIGR00100 hypA hydrogenase nic  32.2      23  0.0005   23.3   0.9   10  108-117    71-80  (115)
146 COG4530 Uncharacterized protei  30.9      27 0.00059   22.7   1.0   11  134-144    26-36  (129)
147 PRK12380 hydrogenase nickel in  30.8      26 0.00056   23.0   0.9   10  108-117    71-80  (113)
148 cd00924 Cyt_c_Oxidase_Vb Cytoc  30.8      21 0.00045   22.8   0.5   20  154-173    72-91  (97)
149 PLN02294 cytochrome c oxidase   30.7      15 0.00032   26.0  -0.3   23  151-173   131-153 (174)
150 PF08271 TF_Zn_Ribbon:  TFIIB z  30.4      30 0.00066   18.1   1.0    8  108-115    20-27  (43)
151 KOG2071|consensus               30.1      31 0.00067   29.4   1.4   25  161-185   418-442 (579)
152 PF03811 Zn_Tnp_IS1:  InsA N-te  29.5      33 0.00071   17.4   1.0    8  106-113    28-35  (36)
153 COG5112 UFD2 U1-like Zn-finger  29.4      26 0.00057   22.6   0.7   22  161-182    55-76  (126)
154 PF01428 zf-AN1:  AN1-like Zinc  28.4      19 0.00042   18.9   0.0   13  161-173    13-25  (43)
155 COG3091 SprT Zn-dependent meta  28.3      27 0.00058   24.3   0.7   33  134-170   117-149 (156)
156 cd00065 FYVE FYVE domain; Zinc  28.2      37 0.00081   18.7   1.2    8  110-117     5-12  (57)
157 PF04810 zf-Sec23_Sec24:  Sec23  28.0      35 0.00076   17.6   1.0   10  106-115    23-32  (40)
158 smart00661 RPOL9 RNA polymeras  27.6      46 0.00099   17.9   1.5    9  108-116    21-29  (52)
159 PF04423 Rad50_zn_hook:  Rad50   27.0      24 0.00052   19.5   0.2   12  163-174    22-33  (54)
160 PF12760 Zn_Tnp_IS1595:  Transp  26.9      46 0.00099   17.7   1.3    7  108-114    38-44  (46)
161 COG1998 RPS31 Ribosomal protei  26.9      39 0.00084   18.6   1.0    9  161-169    37-45  (51)
162 PF07282 OrfB_Zn_ribbon:  Putat  26.5      95  0.0021   17.9   2.8    9  108-116    47-55  (69)
163 smart00731 SprT SprT homologue  26.3      36 0.00078   23.3   1.1   31  107-144   112-143 (146)
164 PF04780 DUF629:  Protein of un  26.3      50  0.0011   27.5   2.0   26  134-159    57-83  (466)
165 PF07975 C1_4:  TFIIH C1-like d  26.1      12 0.00026   20.8  -1.1   25  106-130    20-44  (51)
166 PF08790 zf-LYAR:  LYAR-type C2  26.0      17 0.00038   17.4  -0.4    9  163-171     2-10  (28)
167 PRK00564 hypA hydrogenase nick  25.9      33 0.00071   22.7   0.8   10  108-117    72-81  (117)
168 PRK04351 hypothetical protein;  25.0      38 0.00083   23.4   1.0   31  108-145   113-143 (149)
169 PF03833 PolC_DP2:  DNA polymer  24.8      24 0.00053   31.5   0.0   11  134-144   680-690 (900)
170 KOG2272|consensus               24.3      82  0.0018   24.0   2.6   20   54-73     96-115 (332)
171 PRK00432 30S ribosomal protein  24.2      61  0.0013   17.8   1.5    9  108-116    38-46  (50)
172 PF02150 RNA_POL_M_15KD:  RNA p  23.3      25 0.00053   17.7  -0.2    8  109-116    22-29  (35)
173 PF06397 Desulfoferrod_N:  Desu  23.0      40 0.00086   17.2   0.6   11  107-117     6-16  (36)
174 COG2331 Uncharacterized protei  22.9      31 0.00067   20.9   0.2    9  108-116    13-21  (82)
175 PF06220 zf-U1:  U1 zinc finger  22.8      76  0.0017   16.2   1.6   11  161-171     3-13  (38)
176 PF14311 DUF4379:  Domain of un  22.4      64  0.0014   17.8   1.4    8  135-142    29-36  (55)
177 smart00064 FYVE Protein presen  22.3      47   0.001   19.1   0.9   10  109-118    12-21  (68)
178 COG1773 Rubredoxin [Energy pro  22.3      44 0.00094   18.9   0.7   13  107-119     3-15  (55)
179 PRK03824 hypA hydrogenase nick  22.3      41  0.0009   22.8   0.7   12  108-119    71-82  (135)
180 PF10013 DUF2256:  Uncharacteri  21.7      56  0.0012   17.3   1.0   12  163-174    10-21  (42)
181 PF14205 Cys_rich_KTR:  Cystein  21.2      25 0.00054   19.7  -0.4    8  134-141    28-35  (55)
182 PF04438 zf-HIT:  HIT zinc fing  21.1      65  0.0014   15.5   1.1   11  108-118    14-24  (30)
183 KOG0717|consensus               20.9      57  0.0012   27.1   1.3   22  162-183   293-314 (508)
184 COG3677 Transposase and inacti  20.9      41  0.0009   22.6   0.5   13  161-173    53-65  (129)
185 TIGR00280 L37a ribosomal prote  20.8      40 0.00087   21.2   0.4   13  134-146    53-65  (91)
186 PF14803 Nudix_N_2:  Nudix N-te  20.4      56  0.0012   16.3   0.8    8  108-115    23-30  (34)
187 PTZ00448 hypothetical protein;  20.4      71  0.0015   25.7   1.7   23  161-183   314-336 (373)
188 KOG1842|consensus               20.1      66  0.0014   26.6   1.5   26  107-132    15-41  (505)

No 1  
>KOG2462|consensus
Probab=99.93  E-value=1.2e-26  Score=168.75  Aligned_cols=129  Identities=19%  Similarity=0.431  Sum_probs=115.0

Q ss_pred             cCCCCcccchhHhhccCchhhccccccccc--CCCCccCCCCccc-------chhhhhhcCCCceecccccccccChhHH
Q psy13164         53 NNGNDAVTRDCLEFFKSHDSTLKNESDHER--RSINYNCQQSYKV-------GKLNKILHRGIRYKCDLCSKEYFHKGSL  123 (193)
Q Consensus        53 ~~~~~~~c~~c~~~f~~~~~~~~h~~~~~~--~~~~~~C~~c~~~-------~~~~~~~~~~~~~~C~~C~~~f~~~~~l  123 (193)
                      .....+.|..|++.+.+...|.+|.+.|..  ..+.+.|..|+++       ..|.++|.  .++.|.+||+.|.+..-|
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLL  203 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLL  203 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHh
Confidence            355678899999999999999999998876  3456999999985       45667775  569999999999999999


Q ss_pred             HHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHH
Q psy13164        124 TEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       124 ~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      +-|+++|+|+ ||.|++|+++|...++|+.||++|.+. +|+|..|+++|...+.|.+|...
T Consensus       204 QGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  204 QGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999998 999999999999999999999999996 99999999999999999999754


No 2  
>KOG2462|consensus
Probab=99.91  E-value=3.2e-25  Score=161.42  Aligned_cols=108  Identities=22%  Similarity=0.476  Sum_probs=98.2

Q ss_pred             CCCccCCCCccc-------chhhhhhc---CCCceecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHH
Q psy13164         84 SINYNCQQSYKV-------GKLNKILH---RGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDH  153 (193)
Q Consensus        84 ~~~~~C~~c~~~-------~~~~~~~~---~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H  153 (193)
                      ...|+|++|++.       .+|+.+|-   ..+.+.|+.|++.|.....|..|+++|.- ++.|.+|||.|.+.+.|+.|
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l-~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL-PCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCC-CcccccccccccchHHhhcc
Confidence            344999999984       46666663   35669999999999999999999999996 89999999999999999999


Q ss_pred             HHHhCCc-ccccccCcccccChHHHHHHHHHcCCCCCCCC
Q psy13164        154 KKIHQGI-RYKCNLCSKEFLRKDILIEHKKIHQGIRFKCD  192 (193)
Q Consensus       154 ~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~h~~~~~~~c  192 (193)
                      +|+|+|+ ||.|..|+++|..+++|+.|+.+|.+.|.|.|
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC  246 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQC  246 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccC
Confidence            9999998 99999999999999999999999999999887


No 3  
>KOG1074|consensus
Probab=99.60  E-value=2.2e-16  Score=129.96  Aligned_cols=38  Identities=16%  Similarity=0.223  Sum_probs=32.7

Q ss_pred             CCcccchhHhhccCchhhcccccccccCCCCccCCCCcc
Q psy13164         56 NDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYK   94 (193)
Q Consensus        56 ~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~   94 (193)
                      .+.+|.+|.++|.+.+.|..|.+.|.. ++||+|.+|+.
T Consensus       352 ~khkCr~CakvfgS~SaLqiHlRSHTG-ERPfqCnvCG~  389 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHLRSHTG-ERPFQCNVCGN  389 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhhhccCC-CCCeeeccccc
Confidence            455799999999999999999988874 88999999974


No 4  
>KOG3608|consensus
Probab=99.57  E-value=3e-15  Score=112.80  Aligned_cols=130  Identities=20%  Similarity=0.368  Sum_probs=93.8

Q ss_pred             CCcccchhHhhccCchhhcccccccccCCCCccCCCCcc-------cchhhhh-hcCCCceecccccccccChhHHHHHH
Q psy13164         56 NDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYK-------VGKLNKI-LHRGIRYKCDLCSKEYFHKGSLTEHK  127 (193)
Q Consensus        56 ~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~-------~~~~~~~-~~~~~~~~C~~C~~~f~~~~~l~~h~  127 (193)
                      .+|.|..|.+-|.++..|..|+..|-   ..|+|+.|+.       +..|++. |...+||+|+.|+..|.+...|.+|.
T Consensus       236 n~fqC~~C~KrFaTeklL~~Hv~rHv---n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~  312 (467)
T KOG3608|consen  236 NSFQCAQCFKRFATEKLLKSHVVRHV---NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHV  312 (467)
T ss_pred             CchHHHHHHHHHhHHHHHHHHHHHhh---hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHH
Confidence            35666666666666666666665553   2366776654       3455544 34467888888888888888888888


Q ss_pred             HhhCCcceeccc--cchhccChhHHHHHHHHhC-Cc---ccccccCcccccChHHHHHHHHHcCCCC
Q psy13164        128 KRHQGIRYKCDL--CSKEYFHKGYLTDHKKIHQ-GI---RYKCNLCSKEFLRKDILIEHKKIHQGIR  188 (193)
Q Consensus       128 ~~h~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~~---~~~C~~C~~~F~~~~~L~~H~~~h~~~~  188 (193)
                      ..|...-|.|..  |...|.+...+.+|++-+. |.   +|.|-.|++.|++..+|.+|++.-+|-+
T Consensus       313 ~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  313 QVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             HhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhccc
Confidence            888865688877  8888888888888887654 43   6888889999988888888887655544


No 5  
>KOG3576|consensus
Probab=99.57  E-value=7.6e-16  Score=107.78  Aligned_cols=111  Identities=26%  Similarity=0.480  Sum_probs=86.7

Q ss_pred             CCCcccchhHhhccCchhhcccccccccCCCCccCCCCcccchhhhhhcCCCceecccccccccChhHHHHHHHhhCCc-
Q psy13164         55 GNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGI-  133 (193)
Q Consensus        55 ~~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~-  133 (193)
                      ...+.|..|++.|.-...|.+|++-|..                      -+.+.|..||+.|.....|++|+++|+|. 
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~----------------------vkr~lct~cgkgfndtfdlkrh~rthtgvr  172 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSD----------------------VKRHLCTFCGKGFNDTFDLKRHTRTHTGVR  172 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccH----------------------HHHHHHhhccCcccchhhhhhhhccccCcc
Confidence            3455566666666555555555554442                      34478999999999999999999999998 


Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc------------ccccccCcccccChHHHHHHHHHcCCC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI------------RYKCNLCSKEFLRKDILIEHKKIHQGI  187 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~------------~~~C~~C~~~F~~~~~L~~H~~~h~~~  187 (193)
                      ||.|..|+++|++.-.|..|++.-+|.            -|.|..||..-.....+..|+..|+.-
T Consensus       173 pykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  173 PYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             ccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCC
Confidence            899999999999999999999865553            288999999988888899999887653


No 6  
>KOG3576|consensus
Probab=99.53  E-value=1.6e-15  Score=106.12  Aligned_cols=82  Identities=32%  Similarity=0.630  Sum_probs=75.9

Q ss_pred             CCceecccccccccChhHHHHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHH
Q psy13164        105 GIRYKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKK  182 (193)
Q Consensus       105 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~  182 (193)
                      ...|.|..|++.|.....|.+|++.|... .+.|..||+.|.....|++|+++|+|. ||+|..|+++|+++..|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            34599999999999999999999999987 799999999999999999999999998 9999999999999999999987


Q ss_pred             HcCC
Q psy13164        183 IHQG  186 (193)
Q Consensus       183 ~h~~  186 (193)
                      .-+|
T Consensus       195 kvhg  198 (267)
T KOG3576|consen  195 KVHG  198 (267)
T ss_pred             HHcC
Confidence            5333


No 7  
>KOG1074|consensus
Probab=99.52  E-value=3.3e-15  Score=123.22  Aligned_cols=54  Identities=24%  Similarity=0.535  Sum_probs=50.3

Q ss_pred             eccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHHcCCCCC
Q psy13164        136 KCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKIHQGIRF  189 (193)
Q Consensus       136 ~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~h~~~~~  189 (193)
                      .|..||+.|.+++.|..|+++|+|. ||.|.+|++.|..+.+|+.||.+|.+..|
T Consensus       881 ~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCC
Confidence            8999999999999999999999997 99999999999999999999999988664


No 8  
>KOG3623|consensus
Probab=99.50  E-value=4.5e-15  Score=120.83  Aligned_cols=106  Identities=24%  Similarity=0.446  Sum_probs=85.1

Q ss_pred             cccchhHhhccCchhhcccccccccCCCCccCCCCcccchhhhhhcCCCceecccccccccChhHHHHHHHhhCC-----
Q psy13164         58 AVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQG-----  132 (193)
Q Consensus        58 ~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~-----  132 (193)
                      ..|.+|+..+....++..|..-.+.+.                    +..|.|..|..+|.+...|.+||.+|..     
T Consensus       211 ltcpycdrgykrltslkeHikyrhekn--------------------e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa  270 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKN--------------------EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQA  270 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhC--------------------CCCCcchhhhhhhhhHHHHHHHHHhhcCCCccc
Confidence            356666666666556655544433211                    2238899999999999999999998853     


Q ss_pred             ---------cceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHH
Q psy13164        133 ---------IRYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       133 ---------~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                               +.|+|.+|||+|..+..|+-|+|+|.|+ ||.|+.|.++|..+..+..|+..
T Consensus       271 ~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  271 ISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence                     2599999999999999999999999998 99999999999999998888753


No 9  
>KOG3608|consensus
Probab=99.47  E-value=3.7e-14  Score=106.96  Aligned_cols=139  Identities=22%  Similarity=0.372  Sum_probs=88.4

Q ss_pred             CCCCcccchhHhhccCchhhccccccccc-CCCCccCCCCcccch---hhhhhcCC--CceecccccccccChhHHHHHH
Q psy13164         54 NGNDAVTRDCLEFFKSHDSTLKNESDHER-RSINYNCQQSYKVGK---LNKILHRG--IRYKCDLCSKEYFHKGSLTEHK  127 (193)
Q Consensus        54 ~~~~~~c~~c~~~f~~~~~~~~h~~~~~~-~~~~~~C~~c~~~~~---~~~~~~~~--~~~~C~~C~~~f~~~~~l~~h~  127 (193)
                      ++....|..||..|++...+..|.+.... ...+|.|..|.+.+.   ..+.|...  ..|+|+.|+.+....+.|..|+
T Consensus       204 ~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~  283 (467)
T KOG3608|consen  204 NEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHI  283 (467)
T ss_pred             CCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHH
Confidence            33444577777777766666666554432 234577777766432   22222221  2377777777777777777777


Q ss_pred             Hh-hCCc-ceeccccchhccChhHHHHHHHHhCCccccccc--CcccccChHHHHHHHHHcC-CCC--CCCC
Q psy13164        128 KR-HQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNL--CSKEFLRKDILIEHKKIHQ-GIR--FKCD  192 (193)
Q Consensus       128 ~~-h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~--C~~~F~~~~~L~~H~~~h~-~~~--~~~c  192 (193)
                      +. |... ||+|..|.+.|.+.+.|.+|..+|...-|+|..  |..+|++...|++|++-++ |..  +|.|
T Consensus       284 r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~C  355 (467)
T KOG3608|consen  284 RYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYAC  355 (467)
T ss_pred             HhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceee
Confidence            65 4443 777877777777777777777777754677776  7777777777777776544 533  4554


No 10 
>KOG3623|consensus
Probab=99.46  E-value=1.4e-14  Score=118.03  Aligned_cols=75  Identities=37%  Similarity=0.799  Sum_probs=72.2

Q ss_pred             ceecccccccccChhHHHHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHH
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHK  181 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~  181 (193)
                      .|.|+.|+++|...+.|.+|.--|+|. ||+|.+|.|+|..+..|.-|+|.|.|+ ||+|..|+++|..+..+..||
T Consensus       894 myaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            499999999999999999999999998 999999999999999999999999998 999999999999999988886


No 11 
>PHA00733 hypothetical protein
Probab=99.09  E-value=8.2e-11  Score=79.05  Aligned_cols=80  Identities=20%  Similarity=0.304  Sum_probs=64.3

Q ss_pred             CceecccccccccChhHHHHH------HHhhCCcceeccccchhccChhHHHHHHHHhCCcccccccCcccccChHHHHH
Q psy13164        106 IRYKCDLCSKEYFHKGSLTEH------KKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIE  179 (193)
Q Consensus       106 ~~~~C~~C~~~f~~~~~l~~h------~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~  179 (193)
                      +++.|.+|...|.+...|..+      +..+...||.|..|++.|.+...|..|++.| ..+|.|..|+++|.....|..
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h-~~~~~C~~CgK~F~~~~sL~~  117 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT-EHSKVCPVCGKEFRNTDSTLD  117 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC-CcCccCCCCCCccCCHHHHHH
Confidence            457788888777776655554      3334444899999999999999999999976 347999999999999999999


Q ss_pred             HHHHcCC
Q psy13164        180 HKKIHQG  186 (193)
Q Consensus       180 H~~~h~~  186 (193)
                      |+...++
T Consensus       118 H~~~~h~  124 (128)
T PHA00733        118 HVCKKHN  124 (128)
T ss_pred             HHHHhcC
Confidence            9987665


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=4.5e-11  Score=66.89  Aligned_cols=42  Identities=24%  Similarity=0.555  Sum_probs=29.2

Q ss_pred             eeccccchhccChhHHHHHHHHhCCcccccccCcccccChHHH
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDIL  177 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L  177 (193)
                      |.|+.||+.|....+|..|+++|+ .+|+|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceeccccee
Confidence            667777777777777777777776 467777777777665544


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.06  E-value=2.9e-10  Score=92.83  Aligned_cols=126  Identities=19%  Similarity=0.344  Sum_probs=82.0

Q ss_pred             CCcccchhHhhccCchhhcccccccccCCCCccCCC--CcccchhhhhhcCCCceecccccccccChhHHHHHHHhhCCc
Q psy13164         56 NDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQ--SYKVGKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRHQGI  133 (193)
Q Consensus        56 ~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~--c~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~  133 (193)
                      ....|.-|..... ...+..|.....+  ..-.|+.  |+.+..   .......+.|+.|+..|. ...|..|+..|+ .
T Consensus       406 ~~V~C~NC~~~i~-l~~l~lHe~~C~r--~~V~Cp~~~Cg~v~~---r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H-k  477 (567)
T PLN03086        406 DTVECRNCKHYIP-SRSIALHEAYCSR--HNVVCPHDGCGIVLR---VEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH-E  477 (567)
T ss_pred             CeEECCCCCCccc-hhHHHHHHhhCCC--cceeCCcccccceee---ccccccCccCCCCCCccc-hHHHHHHHHhcC-C
Confidence            3446888876653 3445566544432  2245653  666542   111223367888888875 566888888875 4


Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccC----------hHHHHHHHHHcCCCCCCCC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLR----------KDILIEHKKIHQGIRFKCD  192 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~----------~~~L~~H~~~h~~~~~~~c  192 (193)
                      ++.|+ ||+.+ ....|..|+.+|.+. ++.|..|++.|..          .+.|..|..++ |.+++.|
T Consensus       478 pv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C  544 (567)
T PLN03086        478 PLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPC  544 (567)
T ss_pred             CccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEc
Confidence            78888 88654 557888888888776 8888888888742          35788887775 7777666


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=6.8e-10  Score=62.15  Aligned_cols=43  Identities=23%  Similarity=0.609  Sum_probs=39.4

Q ss_pred             ceecccccccccChhHHHHHHHhhCCcceeccccchhccChhHH
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYL  150 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l  150 (193)
                      .|.|+.||+.|.+..+|..|+++|+ .++.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-CcccCCcccceeccccee
Confidence            3899999999999999999999999 589999999999877765


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.86  E-value=5.2e-09  Score=85.63  Aligned_cols=109  Identities=17%  Similarity=0.357  Sum_probs=82.3

Q ss_pred             ccc--hhHhhccCchhhcccccccccCCCCccCCCCccc------chhhhhhcCCCceecccccccccChhHHHHHHHhh
Q psy13164         59 VTR--DCLEFFKSHDSTLKNESDHERRSINYNCQQSYKV------GKLNKILHRGIRYKCDLCSKEYFHKGSLTEHKKRH  130 (193)
Q Consensus        59 ~c~--~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~~------~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h  130 (193)
                      .|.  .|+..|. ...+..|          +.|+.|++.      ..|.++++  .++.|+ |+..+ ....|..|+..|
T Consensus       435 ~Cp~~~Cg~v~~-r~el~~H----------~~C~~Cgk~f~~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~th  499 (567)
T PLN03086        435 VCPHDGCGIVLR-VEEAKNH----------VHCEKCGQAFQQGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQAST  499 (567)
T ss_pred             eCCcccccceee-ccccccC----------ccCCCCCCccchHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhcc
Confidence            465  3888773 3334444          578888763      45666664  779999 99755 668899999988


Q ss_pred             CCc-ceeccccchhccC----------hhHHHHHHHHhCCcccccccCcccccChHHHHHHHHH
Q psy13164        131 QGI-RYKCDLCSKEYFH----------KGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       131 ~~~-~~~C~~C~~~f~~----------~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      ... ++.|..|++.|..          ...|..|.......++.|..||+.|..+ .|..|+..
T Consensus       500 Cp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~CG~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        500 CPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESICGSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             CCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhcCCcceEccccCCeeeeh-hHHHHHHH
Confidence            877 8999999999852          3589999998755599999999999876 56778754


No 16 
>PHA00733 hypothetical protein
Probab=98.81  E-value=4.7e-09  Score=70.57  Aligned_cols=56  Identities=23%  Similarity=0.392  Sum_probs=49.4

Q ss_pred             cCCCceecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHHHHhCC
Q psy13164        103 HRGIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQG  159 (193)
Q Consensus       103 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  159 (193)
                      ++..+|.|..|++.|.+...|..|++.|. .+|.|..|+++|.....|..|+...++
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~-~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYTE-HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcCC-cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            34678999999999999999999999873 379999999999999999999987554


No 17 
>KOG3993|consensus
Probab=98.67  E-value=1.4e-08  Score=78.86  Aligned_cols=22  Identities=23%  Similarity=0.561  Sum_probs=18.3

Q ss_pred             cccccCcccccChHHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      |.|.+|.-.|.++..|.+|...
T Consensus       459 f~~ky~~atfyss~~ltrhin~  480 (500)
T KOG3993|consen  459 FTCKYCPATFYSSPGLTRHINK  480 (500)
T ss_pred             cccccchHhhhcCcchHhHhhh
Confidence            7888888888888888888654


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.65  E-value=2.2e-08  Score=47.97  Aligned_cols=24  Identities=42%  Similarity=0.827  Sum_probs=18.0

Q ss_pred             HHHHHHHHhCCc-ccccccCccccc
Q psy13164        149 YLTDHKKIHQGI-RYKCNLCSKEFL  172 (193)
Q Consensus       149 ~l~~H~~~h~~~-~~~C~~C~~~F~  172 (193)
                      +|.+|+++|+|+ ||.|+.|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            467777777776 778888877775


No 19 
>PHA00616 hypothetical protein
Probab=98.64  E-value=1.5e-08  Score=54.02  Aligned_cols=32  Identities=25%  Similarity=0.278  Sum_probs=18.8

Q ss_pred             ccccccCcccccChHHHHHHHHHcCCCCCCCC
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIHQGIRFKCD  192 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h~~~~~~~c  192 (193)
                      ||+|..||+.|...+.|..|++.|+|++++.|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            35566666666666666666666666555443


No 20 
>KOG3993|consensus
Probab=98.61  E-value=6.8e-09  Score=80.59  Aligned_cols=79  Identities=29%  Similarity=0.617  Sum_probs=61.6

Q ss_pred             eecccccccccChhHHHHHHHhhCCc-ceeccccchhccChhHHHHHHHHhCCc--------------------------
Q psy13164        108 YKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCSKEYFHKGYLTDHKKIHQGI--------------------------  160 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~~~f~~~~~l~~H~~~h~~~--------------------------  160 (193)
                      |.|..|...|.....|.+|.-.-.-. -|+|++|+|.|+-..+|..|.|.|.-+                          
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            77888888888888777776443333 478888888888888888887777421                          


Q ss_pred             --------ccccccCcccccChHHHHHHHHHcCC
Q psy13164        161 --------RYKCNLCSKEFLRKDILIEHKKIHQG  186 (193)
Q Consensus       161 --------~~~C~~C~~~F~~~~~L~~H~~~h~~  186 (193)
                              -|.|..|++.|.....|+.|+.+|+.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                    18999999999999999999988763


No 21 
>PHA00732 hypothetical protein
Probab=98.38  E-value=2.1e-07  Score=57.00  Aligned_cols=48  Identities=29%  Similarity=0.551  Sum_probs=31.4

Q ss_pred             ceecccccccccChhHHHHHHHh-hCCcceeccccchhccChhHHHHHHHHhCC
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKR-HQGIRYKCDLCSKEYFHKGYLTDHKKIHQG  159 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  159 (193)
                      ||.|..|++.|.+...|..|++. |.  ++.|..|++.|.   .+..|.+++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---ChhhhhcccCC
Confidence            36677777777777777777764 43  346777777776   36666655433


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.36  E-value=3.4e-07  Score=43.77  Aligned_cols=24  Identities=38%  Similarity=0.841  Sum_probs=19.2

Q ss_pred             HHHHHHHhhCCc-ceeccccchhcc
Q psy13164        122 SLTEHKKRHQGI-RYKCDLCSKEYF  145 (193)
Q Consensus       122 ~l~~h~~~h~~~-~~~C~~C~~~f~  145 (193)
                      +|..|+++|+++ ||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            477888888887 788888888875


No 23 
>PHA00616 hypothetical protein
Probab=98.27  E-value=4e-07  Score=48.61  Aligned_cols=38  Identities=16%  Similarity=0.218  Sum_probs=26.4

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccc
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEF  171 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F  171 (193)
                      ||+|+.||+.|...+.|..|++.|+|. ++.|..--..|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEEEEEE
Confidence            567778888888788888888777776 66665433333


No 24 
>PHA00732 hypothetical protein
Probab=98.26  E-value=6e-07  Score=54.97  Aligned_cols=47  Identities=28%  Similarity=0.498  Sum_probs=39.2

Q ss_pred             ceeccccchhccChhHHHHHHHH-hCCcccccccCcccccChHHHHHHHHHcC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKI-HQGIRYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      ||.|..|++.|.+...|..|++. |.  ++.|+.|++.|.+   |..|.++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~~---l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYRR---LNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeCC---hhhhhcccC
Confidence            58899999999999999999984 65  3689999999984   777876543


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.16  E-value=1.5e-06  Score=40.29  Aligned_cols=23  Identities=43%  Similarity=0.847  Sum_probs=15.2

Q ss_pred             cccccCcccccChHHHHHHHHHc
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      |.|+.|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45666777777777777666653


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.09  E-value=6.1e-06  Score=46.88  Aligned_cols=48  Identities=29%  Similarity=0.595  Sum_probs=27.9

Q ss_pred             eeccccchhccChhHHHHHHHH-hCCc--ccccccCcccccChHHHHHHHHHcC
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKI-HQGI--RYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~-h~~~--~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      |.|++|++ ..+...|..|... |...  .+.|++|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            56667776 3445566666553 4432  566777766543  36666766644


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.95  E-value=6.8e-06  Score=37.96  Aligned_cols=22  Identities=36%  Similarity=0.801  Sum_probs=12.5

Q ss_pred             eeccccchhccChhHHHHHHHH
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4555555555555555555554


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.93  E-value=6.8e-06  Score=52.73  Aligned_cols=73  Identities=21%  Similarity=0.436  Sum_probs=21.1

Q ss_pred             ecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHHHHhCCcccccccCcccccChHHHHHHHHHc
Q psy13164        109 KCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       109 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      +|..|+..|.+...|..|+...++....   ....+.....+..+++.-....+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~---~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP---DQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc---cccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4889999999999999999765553211   111222333444444433333689999999999999999999874


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.81  E-value=1.7e-05  Score=36.81  Aligned_cols=23  Identities=35%  Similarity=0.824  Sum_probs=13.4

Q ss_pred             cccccCcccccChHHHHHHHHHc
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      |.|+.|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666654


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.80  E-value=1.3e-05  Score=38.62  Aligned_cols=25  Identities=36%  Similarity=0.700  Sum_probs=18.4

Q ss_pred             ccccccCcccccChHHHHHHHHHcC
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777777664


No 31 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.71  E-value=7e-05  Score=42.47  Aligned_cols=48  Identities=29%  Similarity=0.582  Sum_probs=38.3

Q ss_pred             eecccccccccChhHHHHHHHh-hCCc--ceeccccchhccChhHHHHHHHHhC
Q psy13164        108 YKCDLCSKEYFHKGSLTEHKKR-HQGI--RYKCDLCSKEYFHKGYLTDHKKIHQ  158 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l~~h~~~-h~~~--~~~C~~C~~~f~~~~~l~~H~~~h~  158 (193)
                      |.|+.|++ ..+...|..|... |...  .+.|++|...+.  .+|..|+..++
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            89999999 5567789999765 5554  599999998654  48999998754


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.57  E-value=7.1e-05  Score=34.57  Aligned_cols=23  Identities=30%  Similarity=0.804  Sum_probs=11.8

Q ss_pred             eeccccchhccChhHHHHHHHHh
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIH  157 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h  157 (193)
                      |.|+.|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45555555555555555555544


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.52  E-value=6.4e-05  Score=41.07  Aligned_cols=29  Identities=17%  Similarity=0.252  Sum_probs=18.5

Q ss_pred             ccccccCcccccChHHHHHHHHHcCCCCC
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIHQGIRF  189 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h~~~~~  189 (193)
                      |..|++|+..+.+..+|++|+.++++.+|
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            77788888888777788888777776664


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.46  E-value=0.0001  Score=47.22  Aligned_cols=24  Identities=25%  Similarity=0.225  Sum_probs=0.0

Q ss_pred             ccchhHhhccCchhhccccccccc
Q psy13164         59 VTRDCLEFFKSHDSTLKNESDHER   82 (193)
Q Consensus        59 ~c~~c~~~f~~~~~~~~h~~~~~~   82 (193)
                      +|..|+..|.+...+..|+...+.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~   24 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHG   24 (100)
T ss_dssp             ------------------------
T ss_pred             Cccccccccccccccccccccccc
Confidence            488999999999999999877664


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.42  E-value=0.00014  Score=34.09  Aligned_cols=24  Identities=42%  Similarity=0.796  Sum_probs=17.3

Q ss_pred             cccccCcccccChHHHHHHHHHcC
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      |.|..|++.|...+.|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467777777777777777777654


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.40  E-value=0.00012  Score=35.09  Aligned_cols=23  Identities=39%  Similarity=0.888  Sum_probs=11.7

Q ss_pred             eecccccccccChhHHHHHHHhh
Q psy13164        108 YKCDLCSKEYFHKGSLTEHKKRH  130 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l~~h~~~h  130 (193)
                      |.|..|++.|.+...|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            44555555555555555555444


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.96  E-value=0.00072  Score=31.56  Aligned_cols=24  Identities=33%  Similarity=0.753  Sum_probs=15.1

Q ss_pred             eeccccchhccChhHHHHHHHHhC
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQ  158 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~  158 (193)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356666666666666666666553


No 38 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.94  E-value=0.00024  Score=53.92  Aligned_cols=22  Identities=27%  Similarity=0.668  Sum_probs=18.5

Q ss_pred             cccccccCcccccChHHHHHHH
Q psy13164        160 IRYKCNLCSKEFLRKDILIEHK  181 (193)
Q Consensus       160 ~~~~C~~C~~~F~~~~~L~~H~  181 (193)
                      +||.|.+|++++.+...|+-|.
T Consensus       397 KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         397 KPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceeccccchhhccCccceecc
Confidence            3799999999999988887764


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.76  E-value=0.00053  Score=52.16  Aligned_cols=51  Identities=35%  Similarity=0.748  Sum_probs=43.1

Q ss_pred             CCCceeccc--ccccccChhHHHHHHHh-hCC-------------------cceeccccchhccChhHHHHHH
Q psy13164        104 RGIRYKCDL--CSKEYFHKGSLTEHKKR-HQG-------------------IRYKCDLCSKEYFHKGYLTDHK  154 (193)
Q Consensus       104 ~~~~~~C~~--C~~~f~~~~~l~~h~~~-h~~-------------------~~~~C~~C~~~f~~~~~l~~H~  154 (193)
                      +++||+|++  |.+++.+...|+-|+.- |..                   +||+|.+|+|.+.+...|+-|+
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            358999987  99999999999999764 310                   3899999999999999999884


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.74  E-value=0.00089  Score=31.30  Aligned_cols=22  Identities=27%  Similarity=0.753  Sum_probs=14.7

Q ss_pred             cccccCcccccChHHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      |.|..|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566777777777777766654


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.71  E-value=0.0011  Score=30.72  Aligned_cols=22  Identities=45%  Similarity=0.623  Sum_probs=11.6

Q ss_pred             cccccCcccccChHHHHHHHHHc
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      |+|+.|+.... ...|..|++.|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            45666665555 55666666554


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.59  E-value=0.0018  Score=35.54  Aligned_cols=26  Identities=19%  Similarity=0.314  Sum_probs=16.2

Q ss_pred             ceeccccchhccChhHHHHHHHHhCC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQG  159 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~  159 (193)
                      |..|++|+..+.+..+|.+|+.++++
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            67777787777777777777765544


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=96.49  E-value=0.0019  Score=45.09  Aligned_cols=37  Identities=27%  Similarity=0.792  Sum_probs=29.7

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccCh
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRK  174 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~  174 (193)
                      +|.|. |++   ....+.+|.++|++. +|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            68887 887   567788888888887 79999998887643


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.47  E-value=0.0019  Score=30.17  Aligned_cols=22  Identities=27%  Similarity=0.744  Sum_probs=14.5

Q ss_pred             eeccccchhccChhHHHHHHHH
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      |.|..|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566677777777777666654


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.15  E-value=0.0041  Score=28.71  Aligned_cols=21  Identities=43%  Similarity=0.599  Sum_probs=9.3

Q ss_pred             eeccccchhccChhHHHHHHHH
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      |.|+.|+.... ...|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            34555554444 4455555544


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.83  E-value=0.0083  Score=28.08  Aligned_cols=20  Identities=40%  Similarity=0.908  Sum_probs=14.1

Q ss_pred             ccccCcccccChHHHHHHHHH
Q psy13164        163 KCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       163 ~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      .|+.||+.| ....|..|+.+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHHh
Confidence            577788888 55677777654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.83  E-value=0.0023  Score=30.53  Aligned_cols=22  Identities=32%  Similarity=0.664  Sum_probs=15.7

Q ss_pred             cccccCcccccChHHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777653


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=95.56  E-value=0.009  Score=41.78  Aligned_cols=37  Identities=27%  Similarity=0.772  Sum_probs=31.9

Q ss_pred             ceecccccccccChhHHHHHHHhhCCc-ceeccccchhccCh
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCSKEYFHK  147 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~~~f~~~  147 (193)
                      +|.|. |+.   ...++.+|.++|.+. +|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            59998 987   677899999999997 89999999988654


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.02  E-value=0.0054  Score=29.22  Aligned_cols=22  Identities=32%  Similarity=0.659  Sum_probs=14.9

Q ss_pred             eeccccchhccChhHHHHHHHH
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777766653


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.08  E-value=0.037  Score=27.88  Aligned_cols=23  Identities=26%  Similarity=0.459  Sum_probs=17.2

Q ss_pred             ccccccCcccccChHHHHHHHHH
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            56788888888877777777653


No 51 
>KOG1146|consensus
Probab=92.93  E-value=0.023  Score=51.27  Aligned_cols=129  Identities=14%  Similarity=0.131  Sum_probs=84.1

Q ss_pred             cCCCCcccchhHhhccCchhhcccccccccCCCCccCCCCcccchhhhh------hcCCCceecccccccccChhHHHHH
Q psy13164         53 NNGNDAVTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYKVGKLNKI------LHRGIRYKCDLCSKEYFHKGSLTEH  126 (193)
Q Consensus        53 ~~~~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~~~~~~~~------~~~~~~~~C~~C~~~f~~~~~l~~h  126 (193)
                      .....++|..|+..++....|..|++..+.....   ..|.....|.+.      -.+.++|.|..|...+..+.+|.+|
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsih  537 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIH  537 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccch---hHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHH
Confidence            3346778888888888888888888774432222   233222222111      1235679999999999999999999


Q ss_pred             HHh--hCC-----------------------------------------c-ceeccccchhccChhHHHHHHHH-hCCc-
Q psy13164        127 KKR--HQG-----------------------------------------I-RYKCDLCSKEYFHKGYLTDHKKI-HQGI-  160 (193)
Q Consensus       127 ~~~--h~~-----------------------------------------~-~~~C~~C~~~f~~~~~l~~H~~~-h~~~-  160 (193)
                      +..  |..                                         + +|.|..|+.......+|+.||.. ++-. 
T Consensus       538 lqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmtss~~s~~  617 (1406)
T KOG1146|consen  538 LQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTASPSSSP  617 (1406)
T ss_pred             HHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhccccccccCCCCCC
Confidence            864  311                                         2 37888888887777788777753 3333 


Q ss_pred             ccccccCcccccChHHHHHHHHHc
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      |.-+-.++..+.....+..+.+.+
T Consensus       618 p~~~Lq~~it~~l~~~~~~~~~lp  641 (1406)
T KOG1146|consen  618 PSLVLQQNITSSLASLLGGQGRLP  641 (1406)
T ss_pred             hHHHhhhcchhhccccccCcCCCC
Confidence            466666777776666666665555


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.92  E-value=0.082  Score=26.57  Aligned_cols=23  Identities=22%  Similarity=0.446  Sum_probs=18.1

Q ss_pred             ceeccccchhccChhHHHHHHHH
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      +|.|..|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57788888888888888888763


No 53 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.01  E-value=0.35  Score=31.47  Aligned_cols=25  Identities=24%  Similarity=0.503  Sum_probs=23.1

Q ss_pred             ccc----ccCcccccChHHHHHHHHHcCC
Q psy13164        162 YKC----NLCSKEFLRKDILIEHKKIHQG  186 (193)
Q Consensus       162 ~~C----~~C~~~F~~~~~L~~H~~~h~~  186 (193)
                      |.|    ..|+....+...|+.|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            999    9999999999999999998765


No 54 
>KOG2186|consensus
Probab=90.86  E-value=0.19  Score=37.38  Aligned_cols=46  Identities=22%  Similarity=0.535  Sum_probs=32.0

Q ss_pred             eecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHHH
Q psy13164        108 YKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKK  155 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~~  155 (193)
                      |.|..||.... +..+..|+.+-++..|.|..|++.|.. ..+..|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccCCeeEEeeccccccc-chhhhhhh
Confidence            67777877543 344666777777767888888888876 56666754


No 55 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.19  E-value=0.2  Score=25.07  Aligned_cols=10  Identities=40%  Similarity=1.119  Sum_probs=5.1

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      |.|..||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4555555543


No 56 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.05  E-value=0.051  Score=43.72  Aligned_cols=54  Identities=28%  Similarity=0.560  Sum_probs=30.2

Q ss_pred             ceecccccccccChhHHHHHHH--hhCCc---ceecc--ccchhccChhHHHHHHHHhCCc
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKK--RHQGI---RYKCD--LCSKEYFHKGYLTDHKKIHQGI  160 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~--~h~~~---~~~C~--~C~~~f~~~~~l~~H~~~h~~~  160 (193)
                      ++.|..|...|.....+..|..  .|.+.   ++.|+  .|++.|.....+..|..+|++.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  349 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI  349 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCC
Confidence            3555556666666655655555  45443   45555  4666666555555555555543


No 57 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.77  E-value=0.063  Score=43.19  Aligned_cols=59  Identities=31%  Similarity=0.508  Sum_probs=52.9

Q ss_pred             ceeccccchhccChhHHHHHHH--HhCCc---ccccc--cCcccccChHHHHHHHHHcCCCCCCCC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKK--IHQGI---RYKCN--LCSKEFLRKDILIEHKKIHQGIRFKCD  192 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~--~h~~~---~~~C~--~C~~~F~~~~~L~~H~~~h~~~~~~~c  192 (193)
                      ++.|..|...|.....+..|.+  .|.+.   ++.|+  .|++.|.....+..|..+|++.++..+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcccc
Confidence            5889999999999999999999  78876   89999  799999999999999999998876543


No 58 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=88.54  E-value=0.073  Score=39.68  Aligned_cols=24  Identities=21%  Similarity=0.297  Sum_probs=12.2

Q ss_pred             ceeccccchhccChhHHHHHHHHh
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIH  157 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h  157 (193)
                      ++.|+.||........|..-.|+|
T Consensus       209 ~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  209 PIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCcccccccceeeeecc
Confidence            566666665554444444333333


No 59 
>KOG1146|consensus
Probab=88.53  E-value=0.14  Score=46.46  Aligned_cols=116  Identities=14%  Similarity=0.126  Sum_probs=60.7

Q ss_pred             CcccchhHhhccCchhhccccccccc---CCCCccCCCCcccchhh---hhhcCCCceecccccccccChhHHHHHHHhh
Q psy13164         57 DAVTRDCLEFFKSHDSTLKNESDHER---RSINYNCQQSYKVGKLN---KILHRGIRYKCDLCSKEYFHKGSLTEHKKRH  130 (193)
Q Consensus        57 ~~~c~~c~~~f~~~~~~~~h~~~~~~---~~~~~~C~~c~~~~~~~---~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h  130 (193)
                      ...|..|...|........+-+....   ....+.|..+..+..-.   .+.....+|.|..|...|.....|..|++. 
T Consensus      1228 gl~~~~~e~~f~~~~~~~~~a~~~~~~~~~sGe~~c~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~k- 1306 (1406)
T KOG1146|consen 1228 GLLPNALEQPFPQEPEPTATAPPKPPELPASGEGECGAVDELLTPSFGISTLDVTHRYLCRQCKMAFDGEAPLTAHQRK- 1306 (1406)
T ss_pred             cccHHhhhcCccCcccccccCCCCCCcCcCCCcchhhhccccccCccceeecccchhHHHHHHHhhhcchhHHHHHHHH-
Confidence            34566677777766666555433211   12225566665542211   122233458888888888888888877621 


Q ss_pred             CCcceeccccchhccChhHHHHHHHHhCCc-ccccccCcccccChHHHHHHHHH
Q psy13164        131 QGIRYKCDLCSKEYFHKGYLTDHKKIHQGI-RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       131 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                               |.+.+.......-|+..+... .| |..|...|.....|..|+++
T Consensus      1307 ---------~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1307 ---------FCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             ---------HHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHH
Confidence                     112222222222233333332 34 66666666666666666665


No 60 
>KOG2231|consensus
Probab=87.89  E-value=0.8  Score=39.24  Aligned_cols=116  Identities=16%  Similarity=0.325  Sum_probs=67.8

Q ss_pred             cccchhHhhcc---------------CchhhcccccccccCCCCccCCCCcc----------------cchhhhhh-cCC
Q psy13164         58 AVTRDCLEFFK---------------SHDSTLKNESDHERRSINYNCQQSYK----------------VGKLNKIL-HRG  105 (193)
Q Consensus        58 ~~c~~c~~~f~---------------~~~~~~~h~~~~~~~~~~~~C~~c~~----------------~~~~~~~~-~~~  105 (193)
                      ..|.+|+..|.               +-..|..|+...|..   +.|..|..                +..|++.- .+.
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~---~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~  176 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKL---HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDD  176 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhh---hccccccccceeeeeeeehehHHHHHHHHhcCCCcc
Confidence            45777777763               455677788766643   55666542                12222111 101


Q ss_pred             C----ceecccccccccChhHHHHHHHhhCCcceecccc------chhccChhHHHHHHHHhCCcccccc--cCc-----
Q psy13164        106 I----RYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLC------SKEYFHKGYLTDHKKIHQGIRYKCN--LCS-----  168 (193)
Q Consensus       106 ~----~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~C~--~C~-----  168 (193)
                      .    .-.|..|...|.....|..|++.++.   .|..|      +..|.....|..|-+.++   |.|.  .|.     
T Consensus       177 ~s~rGhp~C~~C~~~fld~~el~rH~~~~h~---~chfC~~~~~~neyy~~~~dLe~HfR~~H---flCE~~~C~~~~f~  250 (669)
T KOG2231|consen  177 ESCRGHPLCKFCHERFLDDDELYRHLRFDHE---FCHFCDYKTGQNEYYNDYDDLEEHFRKGH---FLCEEEFCRTKKFY  250 (669)
T ss_pred             ccccCCccchhhhhhhccHHHHHHhhcccee---heeecCcccccchhcccchHHHHHhhhcC---ccccccccccceee
Confidence            0    14688899999998989988876655   44444      345666788888888654   4554  343     


Q ss_pred             ccccChHHHHHHHH
Q psy13164        169 KEFLRKDILIEHKK  182 (193)
Q Consensus       169 ~~F~~~~~L~~H~~  182 (193)
                      ..|.....|.+|-+
T Consensus       251 ~~~~~ei~lk~~~~  264 (669)
T KOG2231|consen  251 VAFELEIELKAHNR  264 (669)
T ss_pred             ehhHHHHHHHhhcc
Confidence            23344445555544


No 61 
>KOG2893|consensus
Probab=87.14  E-value=0.18  Score=37.26  Aligned_cols=41  Identities=32%  Similarity=0.709  Sum_probs=22.0

Q ss_pred             cccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHH
Q psy13164        110 CDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDH  153 (193)
Q Consensus       110 C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H  153 (193)
                      |=.|++.|....-|..|++..   .|+|.+|-|...+...|..|
T Consensus        13 cwycnrefddekiliqhqkak---hfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAK---HFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhhc---cceeeeehhhhccCCCceee
Confidence            445666666665555554432   35566666555555555444


No 62 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.24  E-value=0.44  Score=31.02  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=5.9

Q ss_pred             ccccccCccccc
Q psy13164        161 RYKCNLCSKEFL  172 (193)
Q Consensus       161 ~~~C~~C~~~F~  172 (193)
                      |..|+.||..|.
T Consensus        26 PivCP~CG~~~~   37 (108)
T PF09538_consen   26 PIVCPKCGTEFP   37 (108)
T ss_pred             CccCCCCCCccC
Confidence            444555555543


No 63 
>KOG2231|consensus
Probab=85.17  E-value=1.5  Score=37.64  Aligned_cols=47  Identities=21%  Similarity=0.463  Sum_probs=22.9

Q ss_pred             eeccccchhccChhHHHHHHHHhCCcccccccC------cccccChHHHHHHHHHc
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLC------SKEFLRKDILIEHKKIH  184 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C------~~~F~~~~~L~~H~~~h  184 (193)
                      -.|..|...|.....|.+|++.++   |.|..|      +.-|..-..|..|.+.+
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h---~~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH---EFCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce---eheeecCcccccchhcccchHHHHHhhhc
Confidence            355555555555555555555432   223333      33444445555555543


No 64 
>KOG2186|consensus
Probab=84.82  E-value=0.7  Score=34.50  Aligned_cols=50  Identities=22%  Similarity=0.419  Sum_probs=39.8

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCcccccccCcccccChHHHHHHHHHcC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      -|.|..||-... ...+.+|+..-++.-|.|..|++.|.. .....|...-+
T Consensus         3 ~FtCnvCgEsvK-Kp~vekH~srCrn~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    3 FFTCNVCGESVK-KPQVEKHMSRCRNAYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             EEehhhhhhhcc-ccchHHHHHhccCCeeEEeeccccccc-chhhhhhhhcc
Confidence            478999998765 456778998888888999999999987 66777876433


No 65 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=83.54  E-value=0.82  Score=35.80  Aligned_cols=75  Identities=28%  Similarity=0.484  Sum_probs=43.2

Q ss_pred             eeccc--ccccccChhHHHHHHHhhCCcceeccccc---hh------ccChhHHHHHHHHhC-C---c-ccccccCcccc
Q psy13164        108 YKCDL--CSKEYFHKGSLTEHKKRHQGIRYKCDLCS---KE------YFHKGYLTDHKKIHQ-G---I-RYKCNLCSKEF  171 (193)
Q Consensus       108 ~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~C~~C~---~~------f~~~~~l~~H~~~h~-~---~-~~~C~~C~~~F  171 (193)
                      |.|+.  |..+......|..|.+..++ .+.|.+|-   +.      ..++..|..|.-... +   + --.|..|...|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~-~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~F  230 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG-FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIYF  230 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC-cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhcccee
Confidence            66754  55555556677777776555 34555443   22      234455565654321 1   1 23577777777


Q ss_pred             cChHHHHHHHHH
Q psy13164        172 LRKDILIEHKKI  183 (193)
Q Consensus       172 ~~~~~L~~H~~~  183 (193)
                      ..-..|..|+|.
T Consensus       231 YdDDEL~~HcR~  242 (493)
T COG5236         231 YDDDELRRHCRL  242 (493)
T ss_pred             cChHHHHHHHHh
Confidence            777777777765


No 66 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.43  E-value=1.2  Score=29.19  Aligned_cols=76  Identities=18%  Similarity=0.346  Sum_probs=43.4

Q ss_pred             ceecccccccccChhHHHHHHHhhCC--------cc-------eeccccchhccChhHHHHHHHHhCCcccccccCcccc
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQG--------IR-------YKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEF  171 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~--------~~-------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F  171 (193)
                      |..|+.|+-+......|.+..  |+-        .+       -.|--|...|........-. .-...+|+|+.|...|
T Consensus        15 P~~CpiCgLtLVss~HLARSy--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~~-~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARSY--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFDE-LKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCcCCcCCCEEeccchHHHhh--hccCCCcccccccccccCCCCcccCcCCCCCCcccccccc-cccccceeCCCCCCcc
Confidence            456777777766666665431  111        01       13777888776543211000 1111278888888888


Q ss_pred             cChHHHHHHHHHcC
Q psy13164        172 LRKDILIEHKKIHQ  185 (193)
Q Consensus       172 ~~~~~L~~H~~~h~  185 (193)
                      =..-....|..+|.
T Consensus        92 C~dCD~fiHe~Lh~  105 (112)
T TIGR00622        92 CVDCDVFVHESLHC  105 (112)
T ss_pred             ccccchhhhhhccC
Confidence            77777777777764


No 67 
>KOG4173|consensus
Probab=83.06  E-value=0.53  Score=34.00  Aligned_cols=73  Identities=18%  Similarity=0.461  Sum_probs=45.6

Q ss_pred             eeccc--ccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHHHHhCC----------c-cccccc--Cccccc
Q psy13164        108 YKCDL--CSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQG----------I-RYKCNL--CSKEFL  172 (193)
Q Consensus       108 ~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~----------~-~~~C~~--C~~~F~  172 (193)
                      +.|+.  |...|.....+..|..+-++  -.|..|.+.|.+...|..|+.-.+.          . -|+|-.  |+..|.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~--~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFk  157 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG--NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFK  157 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc--chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhh
Confidence            55655  66667666666666544222  2677777777777777777654322          1 267743  777777


Q ss_pred             ChHHHHHHHH
Q psy13164        173 RKDILIEHKK  182 (193)
Q Consensus       173 ~~~~L~~H~~  182 (193)
                      +...-..|+-
T Consensus       158 T~r~RkdH~I  167 (253)
T KOG4173|consen  158 TSRDRKDHMI  167 (253)
T ss_pred             hhhhhhhHHH
Confidence            7766666654


No 68 
>KOG2482|consensus
Probab=82.94  E-value=4  Score=32.10  Aligned_cols=56  Identities=29%  Similarity=0.547  Sum_probs=38.5

Q ss_pred             ceeccccchhc-cChhHHHHHHH-HhC---Ccc-------------------cccccCcccccChHHHHHHHHH--cCCC
Q psy13164        134 RYKCDLCSKEY-FHKGYLTDHKK-IHQ---GIR-------------------YKCNLCSKEFLRKDILIEHKKI--HQGI  187 (193)
Q Consensus       134 ~~~C~~C~~~f-~~~~~l~~H~~-~h~---~~~-------------------~~C~~C~~~F~~~~~L~~H~~~--h~~~  187 (193)
                      ..+|..|...+ .+.+.+..|+- .|.   |.|                   +.|-.|.+.|+.+..|+.||+.  |...
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            47888887554 34455666664 332   223                   8899999999999999999986  5443


Q ss_pred             CC
Q psy13164        188 RF  189 (193)
Q Consensus       188 ~~  189 (193)
                      .|
T Consensus       224 nP  225 (423)
T KOG2482|consen  224 NP  225 (423)
T ss_pred             CC
Confidence            34


No 69 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=82.71  E-value=1.8  Score=33.98  Aligned_cols=121  Identities=16%  Similarity=0.183  Sum_probs=73.2

Q ss_pred             Ccccc--hhHhhccCchhhcccccccccCCCCccCCCCcc---cch---------hhhhhc----CCCc----eeccccc
Q psy13164         57 DAVTR--DCLEFFKSHDSTLKNESDHERRSINYNCQQSYK---VGK---------LNKILH----RGIR----YKCDLCS  114 (193)
Q Consensus        57 ~~~c~--~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~---~~~---------~~~~~~----~~~~----~~C~~C~  114 (193)
                      .|.|.  .|..+......+..|.+..+..   +.|.+|..   .+.         -.+.|.    .+..    -.|..|.
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~---~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~  227 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGF---VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCK  227 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCc---EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhcc
Confidence            44443  4555555566777787765543   67777753   111         112221    1111    3588999


Q ss_pred             ccccChhHHHHHHHhhCCcceeccccc----hhccChhHHHHHHHHhCCccccccc--Cc----ccccChHHHHHHHHH
Q psy13164        115 KEYFHKGSLTEHKKRHQGIRYKCDLCS----KEYFHKGYLTDHKKIHQGIRYKCNL--CS----KEFLRKDILIEHKKI  183 (193)
Q Consensus       115 ~~f~~~~~l~~h~~~h~~~~~~C~~C~----~~f~~~~~l~~H~~~h~~~~~~C~~--C~----~~F~~~~~L~~H~~~  183 (193)
                      ..|-.-..|..|++..+..-+.|..-+    .-|.+-..|.+|.+.-   .|.|..  |.    ..|.....|..|+..
T Consensus       228 ~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~---hy~ct~qtc~~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         228 IYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNA---HYCCTFQTCRVGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             ceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcC---ceEEEEEEEecCcEEEeccHHHHHHHHHH
Confidence            999999999999998777434443322    3466677777777632   255543  32    468888888888765


No 70 
>KOG2785|consensus
Probab=82.68  E-value=3.9  Score=32.56  Aligned_cols=74  Identities=18%  Similarity=0.272  Sum_probs=42.6

Q ss_pred             ceecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHHHHhCCcccccccCc---ccccChHHHHHHHHH
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCS---KEFLRKDILIEHKKI  183 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~---~~F~~~~~L~~H~~~  183 (193)
                      |-.|-.|+..+.+...-..||..+++. |.-..  .-......|...+..-.+.-|.|-.|+   +.|.+..+.+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~Hgf-fIPdr--eYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGF-FIPDR--EYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCC-cCCch--HhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            355666777766666666677666652 11000  011222333344443333347888888   888888888888865


No 71 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=82.49  E-value=0.74  Score=25.80  Aligned_cols=25  Identities=12%  Similarity=0.340  Sum_probs=15.5

Q ss_pred             CCceecccccccccChhHHHHHHHh
Q psy13164        105 GIRYKCDLCSKEYFHKGSLTEHKKR  129 (193)
Q Consensus       105 ~~~~~C~~C~~~f~~~~~l~~h~~~  129 (193)
                      +.-++|+.|+..|.....+.+|...
T Consensus        15 E~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          15 EEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ceeeeCCchhHHHHHhHHHHHHhhH
Confidence            3446666666666666666666543


No 72 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=82.16  E-value=3.8  Score=26.58  Aligned_cols=26  Identities=23%  Similarity=0.447  Sum_probs=22.8

Q ss_pred             ceec----cccchhccChhHHHHHHHHhCC
Q psy13164        134 RYKC----DLCSKEYFHKGYLTDHKKIHQG  159 (193)
Q Consensus       134 ~~~C----~~C~~~f~~~~~l~~H~~~h~~  159 (193)
                      .|.|    ..|+..+.+...+..|++.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    9999999999999999987654


No 73 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=81.02  E-value=1.9  Score=24.57  Aligned_cols=9  Identities=33%  Similarity=0.899  Sum_probs=5.2

Q ss_pred             ceeccccch
Q psy13164        134 RYKCDLCSK  142 (193)
Q Consensus       134 ~~~C~~C~~  142 (193)
                      +|.|+.||.
T Consensus        48 ~Y~CP~CGF   56 (59)
T PRK14890         48 PYTCPKCGF   56 (59)
T ss_pred             ceECCCCCC
Confidence            566666653


No 74 
>PHA00626 hypothetical protein
Probab=79.84  E-value=1.4  Score=24.83  Aligned_cols=11  Identities=27%  Similarity=0.470  Sum_probs=6.1

Q ss_pred             eeccccccccc
Q psy13164        108 YKCDLCSKEYF  118 (193)
Q Consensus       108 ~~C~~C~~~f~  118 (193)
                      |.|+.||..|+
T Consensus        24 YkCkdCGY~ft   34 (59)
T PHA00626         24 YVCCDCGYNDS   34 (59)
T ss_pred             eEcCCCCCeec
Confidence            55555555543


No 75 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=79.50  E-value=1.6  Score=23.42  Aligned_cols=9  Identities=44%  Similarity=1.209  Sum_probs=3.9

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      |.|..||..
T Consensus         3 Y~C~~Cg~~   11 (44)
T smart00659        3 YICGECGRE   11 (44)
T ss_pred             EECCCCCCE
Confidence            444444443


No 76 
>KOG2785|consensus
Probab=79.20  E-value=2  Score=34.16  Aligned_cols=73  Identities=19%  Similarity=0.231  Sum_probs=44.6

Q ss_pred             CCCCcccchhHhhccCchhhcccccccccCCCC---ccCCCCcccchh-hhhhcCCCceeccccc---ccccChhHHHHH
Q psy13164         54 NGNDAVTRDCLEFFKSHDSTLKNESDHERRSIN---YNCQQSYKVGKL-NKILHRGIRYKCDLCS---KEYFHKGSLTEH  126 (193)
Q Consensus        54 ~~~~~~c~~c~~~f~~~~~~~~h~~~~~~~~~~---~~C~~c~~~~~~-~~~~~~~~~~~C~~C~---~~f~~~~~l~~h  126 (193)
                      ...+-.|..|+..+.+......||..+|.-..|   |.-+.-|-+.-. .++   ...+.|-.|+   +.|.+....+.|
T Consensus       163 e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV---~~~~~CL~CN~~~~~f~sleavr~H  239 (390)
T KOG2785|consen  163 ELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKV---GIGFICLFCNELGRPFSSLEAVRAH  239 (390)
T ss_pred             ccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHh---ccCceEEEeccccCcccccHHHHHH
Confidence            334577999999999999999999988763222   222222222111 111   2235565565   777777777888


Q ss_pred             HHh
Q psy13164        127 KKR  129 (193)
Q Consensus       127 ~~~  129 (193)
                      |..
T Consensus       240 M~~  242 (390)
T KOG2785|consen  240 MRD  242 (390)
T ss_pred             Hhh
Confidence            764


No 77 
>KOG2482|consensus
Probab=79.14  E-value=3.9  Score=32.16  Aligned_cols=22  Identities=32%  Similarity=0.578  Sum_probs=17.0

Q ss_pred             cccccCcccccChHHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      -.|-.|....-+...|..||.+
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~  301 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKI  301 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHH
Confidence            3677888888778888888875


No 78 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=78.01  E-value=2  Score=23.60  Aligned_cols=10  Identities=40%  Similarity=0.976  Sum_probs=5.1

Q ss_pred             eeccccchhc
Q psy13164        135 YKCDLCSKEY  144 (193)
Q Consensus       135 ~~C~~C~~~f  144 (193)
                      -.|..|++.+
T Consensus        19 a~C~~C~~~l   28 (50)
T smart00614       19 AKCKYCGKKL   28 (50)
T ss_pred             EEecCCCCEe
Confidence            4455555544


No 79 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=77.65  E-value=1.7  Score=29.44  Aligned_cols=22  Identities=36%  Similarity=0.697  Sum_probs=8.1

Q ss_pred             cccccCcccccChHHHHHHHHHcCC
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIHQG  186 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h~~  186 (193)
                      ..|-+||+.|..   |.+|++.|+|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eEEccCCcccch---HHHHHHHccC
Confidence            334445554443   2445544443


No 80 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=77.02  E-value=0.42  Score=35.23  Aligned_cols=41  Identities=22%  Similarity=0.578  Sum_probs=22.6

Q ss_pred             ceecccccccccChhHHHHHHHh-h---------CCc------ceeccccchhccCh
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKR-H---------QGI------RYKCDLCSKEYFHK  147 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~-h---------~~~------~~~C~~C~~~f~~~  147 (193)
                      ...|+.|+..|....-.....+. .         .+.      .+.|+.||.++...
T Consensus         5 ~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            35677777776655433322221 1         111      26899999876644


No 81 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.53  E-value=0.94  Score=23.95  Aligned_cols=9  Identities=44%  Similarity=1.405  Sum_probs=3.5

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      |+|..||..
T Consensus         6 y~C~~Cg~~   14 (42)
T PF09723_consen    6 YRCEECGHE   14 (42)
T ss_pred             EEeCCCCCE
Confidence            333344433


No 82 
>PF12907 zf-met2:  Zinc-binding
Probab=75.53  E-value=1.6  Score=22.87  Aligned_cols=32  Identities=25%  Similarity=0.510  Sum_probs=16.4

Q ss_pred             cccccCccccc---ChHHHHHHHHH-cCCCCCCCCC
Q psy13164        162 YKCNLCSKEFL---RKDILIEHKKI-HQGIRFKCDL  193 (193)
Q Consensus       162 ~~C~~C~~~F~---~~~~L~~H~~~-h~~~~~~~c~  193 (193)
                      +.|.+|...|.   ....|..|... |.+..+..||
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CF   37 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECF   37 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcC
Confidence            35666665553   33456666553 4444454443


No 83 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=75.51  E-value=2.1  Score=22.71  Aligned_cols=20  Identities=30%  Similarity=0.461  Sum_probs=9.0

Q ss_pred             cccccCcccccC----hHHHHHHH
Q psy13164        162 YKCNLCSKEFLR----KDILIEHK  181 (193)
Q Consensus       162 ~~C~~C~~~F~~----~~~L~~H~  181 (193)
                      ..|..|++.+..    .++|..|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            445555555433    24555555


No 84 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=75.41  E-value=1.9  Score=21.64  Aligned_cols=9  Identities=22%  Similarity=0.818  Sum_probs=4.4

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      |.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            445555543


No 85 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=75.31  E-value=2.7  Score=23.96  Aligned_cols=11  Identities=36%  Similarity=0.930  Sum_probs=6.3

Q ss_pred             Ccceeccccch
Q psy13164        132 GIRYKCDLCSK  142 (193)
Q Consensus       132 ~~~~~C~~C~~  142 (193)
                      +.+|.|+.||.
T Consensus        48 g~~Y~Cp~CGF   58 (61)
T COG2888          48 GNPYRCPKCGF   58 (61)
T ss_pred             CCceECCCcCc
Confidence            34666666653


No 86 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=73.89  E-value=1.3  Score=22.92  Aligned_cols=10  Identities=30%  Similarity=1.271  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      |+|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4444455444


No 87 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=73.71  E-value=2.8  Score=21.40  Aligned_cols=10  Identities=20%  Similarity=0.860  Sum_probs=4.6

Q ss_pred             eeccccchhc
Q psy13164        135 YKCDLCSKEY  144 (193)
Q Consensus       135 ~~C~~C~~~f  144 (193)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4455444443


No 88 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=73.17  E-value=2.1  Score=30.14  Aligned_cols=22  Identities=27%  Similarity=0.826  Sum_probs=12.9

Q ss_pred             ceecccccccccChhHHHHHHHhhCCc-ceeccccc
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGI-RYKCDLCS  141 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~-~~~C~~C~  141 (193)
                      .|.|+.||.+             +.+. |..||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            4667777653             2333 56677666


No 89 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=72.70  E-value=3.3  Score=21.18  Aligned_cols=11  Identities=18%  Similarity=0.869  Sum_probs=5.3

Q ss_pred             ceecccccccc
Q psy13164        107 RYKCDLCSKEY  117 (193)
Q Consensus       107 ~~~C~~C~~~f  117 (193)
                      ..+|+.|+..|
T Consensus        25 ~vrC~~C~~~f   35 (37)
T PF13719_consen   25 KVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCcEe
Confidence            34555555444


No 90 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=72.19  E-value=2.3  Score=26.34  Aligned_cols=11  Identities=27%  Similarity=0.966  Sum_probs=5.8

Q ss_pred             eeccccchhcc
Q psy13164        135 YKCDLCSKEYF  145 (193)
Q Consensus       135 ~~C~~C~~~f~  145 (193)
                      |.|..||..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            55555555543


No 91 
>KOG2893|consensus
Probab=71.23  E-value=1.8  Score=32.15  Aligned_cols=43  Identities=7%  Similarity=0.014  Sum_probs=32.8

Q ss_pred             eeEEEecccccCCCccccccCCCCcccchhHhhccCchhhccc
Q psy13164         34 YEVTVKEESYEGDSINVEENNGNDAVTRDCLEFFKSHDSTLKN   76 (193)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~~~~~~~c~~c~~~f~~~~~~~~h   76 (193)
                      -+||-|..+|....++.......-|+|.+|.+.+.+--.|..|
T Consensus        11 pwcwycnrefddekiliqhqkakhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceee
Confidence            4688888888888888888888888888887776666666555


No 92 
>PF14353 CpXC:  CpXC protein
Probab=70.34  E-value=3.7  Score=27.44  Aligned_cols=49  Identities=18%  Similarity=0.314  Sum_probs=27.5

Q ss_pred             eecccccccccChhH--------HHHHHHhhCCc--ceeccccchhccChhHHHHHHHH
Q psy13164        108 YKCDLCSKEYFHKGS--------LTEHKKRHQGI--RYKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~--------l~~h~~~h~~~--~~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      ..|+.|+..|.....        -..-.++-.|.  .+.|+.||..|.-...+.-|...
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCCCEEEEcCC
Confidence            368888877643311        11112233444  58888888887766665555443


No 93 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=69.04  E-value=4.7  Score=18.84  Aligned_cols=19  Identities=21%  Similarity=0.683  Sum_probs=11.7

Q ss_pred             ccccCcccccChHHHHHHHH
Q psy13164        163 KCNLCSKEFLRKDILIEHKK  182 (193)
Q Consensus       163 ~C~~C~~~F~~~~~L~~H~~  182 (193)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            477777776 4455666654


No 94 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=67.78  E-value=2.1  Score=23.61  Aligned_cols=10  Identities=30%  Similarity=1.291  Sum_probs=3.9

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      |+|..|+..|
T Consensus         6 y~C~~Cg~~f   15 (52)
T TIGR02605         6 YRCTACGHRF   15 (52)
T ss_pred             EEeCCCCCEe
Confidence            3344444333


No 95 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=67.26  E-value=3.4  Score=36.24  Aligned_cols=9  Identities=22%  Similarity=0.641  Sum_probs=4.8

Q ss_pred             ccccccCcc
Q psy13164        161 RYKCNLCSK  169 (193)
Q Consensus       161 ~~~C~~C~~  169 (193)
                      |..|+.||.
T Consensus       475 p~~Cp~Cgs  483 (730)
T COG1198         475 PQSCPECGS  483 (730)
T ss_pred             CCCCCCCCC
Confidence            455555554


No 96 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=66.92  E-value=4.8  Score=27.72  Aligned_cols=12  Identities=42%  Similarity=1.035  Sum_probs=7.0

Q ss_pred             eeccccchhccC
Q psy13164        135 YKCDLCSKEYFH  146 (193)
Q Consensus       135 ~~C~~C~~~f~~  146 (193)
                      |.|+.|+..|..
T Consensus       100 Y~Cp~C~~~y~~  111 (147)
T smart00531      100 YKCPNCQSKYTF  111 (147)
T ss_pred             EECcCCCCEeeH
Confidence            566666655553


No 97 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=66.69  E-value=6.5  Score=27.49  Aligned_cols=29  Identities=10%  Similarity=0.463  Sum_probs=17.1

Q ss_pred             eeccccchhccChhHHHHHHHHhCCcccccccCcccc
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEF  171 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F  171 (193)
                      |.|+.|+..|+....+.        .-|.|+.||...
T Consensus       110 Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       110 FICPNMCVRFTFNEAME--------LNFTCPRCGAML  138 (158)
T ss_pred             EECCCCCcEeeHHHHHH--------cCCcCCCCCCEe
Confidence            66666666666555543        136676666543


No 98 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=66.51  E-value=4.5  Score=27.38  Aligned_cols=24  Identities=29%  Similarity=0.616  Sum_probs=15.1

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCc
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGI  160 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  160 (193)
                      ...|.+||+.|..   |.+|++.|+|-
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eeEEccCCcccch---HHHHHHHccCC
Confidence            4789999998864   58899988764


No 99 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=66.43  E-value=4.1  Score=27.24  Aligned_cols=12  Identities=0%  Similarity=-0.033  Sum_probs=5.9

Q ss_pred             ceeccccchhcc
Q psy13164        134 RYKCDLCSKEYF  145 (193)
Q Consensus       134 ~~~C~~C~~~f~  145 (193)
                      |..|+.||..|.
T Consensus        26 p~vcP~cg~~~~   37 (129)
T TIGR02300        26 PAVSPYTGEQFP   37 (129)
T ss_pred             CccCCCcCCccC
Confidence            445555554443


No 100
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=66.04  E-value=3.9  Score=28.62  Aligned_cols=32  Identities=9%  Similarity=0.432  Sum_probs=24.0

Q ss_pred             CCceecccccccccChhHHHHHHHhhCCcceeccccchhc
Q psy13164        105 GIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEY  144 (193)
Q Consensus       105 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f  144 (193)
                      ..-|.|+.|+..|+....+.        ..|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME--------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEe
Confidence            45589999998887776664        268999999653


No 101
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=65.85  E-value=3.2  Score=29.71  Aligned_cols=29  Identities=14%  Similarity=0.580  Sum_probs=15.8

Q ss_pred             eeccccchhccChhHHHHHHHHhCCcccccccCcccc
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEF  171 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F  171 (193)
                      |.|+.|+..|+.-..+.        ..|.|+.||...
T Consensus       118 Y~Cp~C~~rytf~eA~~--------~~F~Cp~Cg~~L  146 (178)
T PRK06266        118 FFCPNCHIRFTFDEAME--------YGFRCPQCGEML  146 (178)
T ss_pred             EECCCCCcEEeHHHHhh--------cCCcCCCCCCCC
Confidence            66666666655544432        136666666543


No 102
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=65.55  E-value=2  Score=32.30  Aligned_cols=81  Identities=23%  Similarity=0.458  Sum_probs=47.2

Q ss_pred             cCCCceecccccccccChhHHHHHHHhh---CCcceeccccchhccChhHH-------HHHHHHh-----CCcccccccC
Q psy13164        103 HRGIRYKCDLCSKEYFHKGSLTEHKKRH---QGIRYKCDLCSKEYFHKGYL-------TDHKKIH-----QGIRYKCNLC  167 (193)
Q Consensus       103 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h---~~~~~~C~~C~~~f~~~~~l-------~~H~~~h-----~~~~~~C~~C  167 (193)
                      ++++.|+|..|..... ...--.|+..-   ..+.|.|..|.+.- +.+-|       ..|.+.-     .++++.|+.|
T Consensus       138 hGGrif~CsfC~~flC-EDDQFEHQAsCQvLe~E~~KC~SCNrlG-q~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKC  215 (314)
T PF06524_consen  138 HGGRIFKCSFCDNFLC-EDDQFEHQASCQVLESETFKCQSCNRLG-QYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKC  215 (314)
T ss_pred             CCCeEEEeecCCCeee-ccchhhhhhhhhhhhccccccccccccc-chhhhheeeeehhhhhhhcccccccCCCCCCCCC
Confidence            5667799999997443 33344465542   22357777666432 11222       3455432     2348999999


Q ss_pred             cccccChHHHHHHHHHcC
Q psy13164        168 SKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       168 ~~~F~~~~~L~~H~~~h~  185 (193)
                      +........|..-.|+|.
T Consensus       216 g~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  216 GYETQETKDLSMSTRSHK  233 (314)
T ss_pred             CCcccccccceeeeecch
Confidence            988776666655555554


No 103
>KOG4167|consensus
Probab=64.82  E-value=2.3  Score=36.81  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=22.3

Q ss_pred             ceeccccchhccChhHHHHHHHHhC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQ  158 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~  158 (193)
                      -|.|.+|+|.|.....++.||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3899999999999999999999885


No 104
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=64.70  E-value=6.2  Score=21.09  Aligned_cols=21  Identities=38%  Similarity=0.605  Sum_probs=12.8

Q ss_pred             cccccCcccccChHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKK  182 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~  182 (193)
                      |+|-+|.....-++.|..||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            556666666666666666654


No 105
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=64.34  E-value=3.6  Score=22.09  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=3.5

Q ss_pred             eecccccc
Q psy13164        108 YKCDLCSK  115 (193)
Q Consensus       108 ~~C~~C~~  115 (193)
                      ..|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            34444443


No 106
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=64.34  E-value=5.5  Score=20.22  Aligned_cols=9  Identities=22%  Similarity=0.818  Sum_probs=4.0

Q ss_pred             eeccccchh
Q psy13164        135 YKCDLCSKE  143 (193)
Q Consensus       135 ~~C~~C~~~  143 (193)
                      .+|..|+..
T Consensus        26 v~C~~C~~~   34 (36)
T PF13717_consen   26 VRCSKCGHV   34 (36)
T ss_pred             EECCCCCCE
Confidence            444444443


No 107
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=63.69  E-value=4.5  Score=22.23  Aligned_cols=10  Identities=50%  Similarity=1.235  Sum_probs=5.2

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      |.|..|+..|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555544


No 108
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=63.29  E-value=2.9  Score=29.10  Aligned_cols=15  Identities=20%  Similarity=0.434  Sum_probs=7.8

Q ss_pred             eecccccccccChhH
Q psy13164        108 YKCDLCSKEYFHKGS  122 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~  122 (193)
                      ++|+.||.+|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            555555555554433


No 109
>KOG4167|consensus
Probab=59.85  E-value=2.5  Score=36.55  Aligned_cols=24  Identities=29%  Similarity=0.621  Sum_probs=22.4

Q ss_pred             cccccCcccccChHHHHHHHHHcC
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      |.|..|++.|..-..+..||++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            999999999998889999999986


No 110
>KOG3408|consensus
Probab=59.02  E-value=6.2  Score=26.09  Aligned_cols=23  Identities=26%  Similarity=0.564  Sum_probs=16.8

Q ss_pred             ccccccCcccccChHHHHHHHHH
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      .|.|..|.+-|.....|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            47777777777777777777654


No 111
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=58.92  E-value=1.8  Score=24.43  Aligned_cols=36  Identities=14%  Similarity=0.138  Sum_probs=19.3

Q ss_pred             ccchhHhhccCchhhcccccccccCCCCccCCCCcc
Q psy13164         59 VTRDCLEFFKSHDSTLKNESDHERRSINYNCQQSYK   94 (193)
Q Consensus        59 ~c~~c~~~f~~~~~~~~h~~~~~~~~~~~~C~~c~~   94 (193)
                      .|.+|++.+.-......-.+-.+++...|.|+.|..
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHH
Confidence            577777776543332222223334455577777754


No 112
>PRK04023 DNA polymerase II large subunit; Validated
Probab=58.75  E-value=10  Score=34.36  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=7.1

Q ss_pred             ccccccCcccc
Q psy13164        161 RYKCNLCSKEF  171 (193)
Q Consensus       161 ~~~C~~C~~~F  171 (193)
                      ++.|+.|+..-
T Consensus       663 ~y~CPKCG~El  673 (1121)
T PRK04023        663 EDECEKCGREP  673 (1121)
T ss_pred             CCcCCCCCCCC
Confidence            46677777644


No 113
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=56.84  E-value=5.4  Score=19.76  Aligned_cols=8  Identities=25%  Similarity=0.937  Sum_probs=3.3

Q ss_pred             eecccccc
Q psy13164        108 YKCDLCSK  115 (193)
Q Consensus       108 ~~C~~C~~  115 (193)
                      .+|+.||.
T Consensus        18 irC~~CG~   25 (32)
T PF03604_consen   18 IRCPECGH   25 (32)
T ss_dssp             SSBSSSS-
T ss_pred             EECCcCCC
Confidence            34555543


No 114
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=56.15  E-value=6.2  Score=33.16  Aligned_cols=8  Identities=25%  Similarity=0.758  Sum_probs=3.9

Q ss_pred             ceeccccc
Q psy13164        134 RYKCDLCS  141 (193)
Q Consensus       134 ~~~C~~C~  141 (193)
                      |..|+.|+
T Consensus       253 ~~~Cp~C~  260 (505)
T TIGR00595       253 PKTCPQCG  260 (505)
T ss_pred             CCCCCCCC
Confidence            34455554


No 115
>KOG4173|consensus
Probab=55.28  E-value=7.9  Score=28.20  Aligned_cols=46  Identities=20%  Similarity=0.517  Sum_probs=36.6

Q ss_pred             eeccc--cchhccChhHHHHHHHHhCCcccccccCcccccChHHHHHHHH
Q psy13164        135 YKCDL--CSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKK  182 (193)
Q Consensus       135 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~H~~  182 (193)
                      |.|+.  |...|.+...+..|-.+-+|  -.|..|.+.|.+...|..|+.
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~--~sCs~C~r~~Pt~hLLd~HI~  127 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG--NSCSFCKRAFPTGHLLDAHIL  127 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc--chhHHHHHhCCchhhhhHHHH
Confidence            88887  77888888877777654333  479999999999999998875


No 116
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=54.44  E-value=14  Score=19.37  Aligned_cols=24  Identities=25%  Similarity=0.369  Sum_probs=13.9

Q ss_pred             cccccCcccccC--hHHHHHHHHHcC
Q psy13164        162 YKCNLCSKEFLR--KDILIEHKKIHQ  185 (193)
Q Consensus       162 ~~C~~C~~~F~~--~~~L~~H~~~h~  185 (193)
                      -.|+.||..|..  ...-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            467777766643  345555666553


No 117
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=52.18  E-value=7.5  Score=26.25  Aligned_cols=22  Identities=27%  Similarity=0.327  Sum_probs=13.0

Q ss_pred             eeccccchhccChhHHHHHHHHhCC
Q psy13164        135 YKCDLCSKEYFHKGYLTDHKKIHQG  159 (193)
Q Consensus       135 ~~C~~C~~~f~~~~~l~~H~~~h~~  159 (193)
                      ..|.++|+.|.   .|++|+.+|.|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccC
Confidence            55666666654   35666666554


No 118
>KOG3507|consensus
Probab=52.15  E-value=5.7  Score=22.59  Aligned_cols=28  Identities=18%  Similarity=0.379  Sum_probs=14.7

Q ss_pred             ccCCCCcccchhhhhhcCCCceeccccccccc
Q psy13164         87 YNCQQSYKVGKLNKILHRGIRYKCDLCSKEYF  118 (193)
Q Consensus        87 ~~C~~c~~~~~~~~~~~~~~~~~C~~C~~~f~  118 (193)
                      |.|..|+.-....+.    -.++|..||....
T Consensus        21 YiCgdC~~en~lk~~----D~irCReCG~RIl   48 (62)
T KOG3507|consen   21 YICGDCGQENTLKRG----DVIRCRECGYRIL   48 (62)
T ss_pred             EEeccccccccccCC----CcEehhhcchHHH
Confidence            666666654332222    2366777775443


No 119
>PRK14873 primosome assembly protein PriA; Provisional
Probab=50.44  E-value=9  Score=33.43  Aligned_cols=8  Identities=13%  Similarity=0.380  Sum_probs=5.2

Q ss_pred             cCCCCccc
Q psy13164         88 NCQQSYKV   95 (193)
Q Consensus        88 ~C~~c~~~   95 (193)
                      .|..|+..
T Consensus       385 ~C~~Cg~~  392 (665)
T PRK14873        385 ACARCRTP  392 (665)
T ss_pred             EhhhCcCe
Confidence            56666665


No 120
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=48.88  E-value=9.2  Score=18.62  Aligned_cols=8  Identities=25%  Similarity=0.667  Sum_probs=3.5

Q ss_pred             ceeccccc
Q psy13164        134 RYKCDLCS  141 (193)
Q Consensus       134 ~~~C~~C~  141 (193)
                      -+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 121
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=47.60  E-value=12  Score=25.72  Aligned_cols=18  Identities=22%  Similarity=0.564  Sum_probs=11.3

Q ss_pred             ceeccccchhccChhHHH
Q psy13164        134 RYKCDLCSKEYFHKGYLT  151 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~  151 (193)
                      -+.|+.||+.|...+.+.
T Consensus       124 f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             EEECCCCCCEecccccHH
Confidence            367777777776655544


No 122
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=47.41  E-value=16  Score=27.02  Aligned_cols=23  Identities=22%  Similarity=0.589  Sum_probs=17.8

Q ss_pred             ceeccccchhccChhHHHHHHHH
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      .|.|..|+|.|.....+..|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            58888888888888888888875


No 123
>KOG0696|consensus
Probab=46.41  E-value=8.3  Score=31.64  Aligned_cols=57  Identities=25%  Similarity=0.451  Sum_probs=34.5

Q ss_pred             CCceecccccccccChhHHHHHHHhhCCcceeccccchhccChhHHHHHH-HHhCCc-ccccccCcc
Q psy13164        105 GIRYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYFHKGYLTDHK-KIHQGI-RYKCNLCSK  169 (193)
Q Consensus       105 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~~-~~~C~~C~~  169 (193)
                      ...|+|..|..        ..|.+.|.-..|.|+-=++.+.+...-..|. ..|+-. |-=|..||.
T Consensus        71 KQGfQCqvC~f--------vvHkrChefVtF~CPGadkg~dtDdpr~kHkf~~~tYssPTFCDhCGs  129 (683)
T KOG0696|consen   71 KQGFQCQVCCF--------VVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYSSPTFCDHCGS  129 (683)
T ss_pred             cCceeeeEEee--------hhhhhhcceEEEECCCCCCCCCCCCcccccceeeeecCCCchhhhHHH
Confidence            34478888764        4577777666777777666666655555553 234433 555666654


No 124
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.03  E-value=9.8  Score=28.08  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=20.0

Q ss_pred             ccccccCcccccChHHHHHHHHHcC
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      .|.|+.|+|.|.-..-.+.|+..-+
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             EECCCCCCcccCChHHHHHHHhhcC
Confidence            6999999999999999999988643


No 125
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=44.27  E-value=11  Score=17.63  Aligned_cols=9  Identities=33%  Similarity=0.921  Sum_probs=4.4

Q ss_pred             ccccCcccc
Q psy13164        163 KCNLCSKEF  171 (193)
Q Consensus       163 ~C~~C~~~F  171 (193)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            345555544


No 126
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=41.64  E-value=12  Score=17.18  Aligned_cols=7  Identities=29%  Similarity=1.151  Sum_probs=3.4

Q ss_pred             eeccccc
Q psy13164        108 YKCDLCS  114 (193)
Q Consensus       108 ~~C~~C~  114 (193)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            4444444


No 127
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=40.37  E-value=15  Score=21.38  Aligned_cols=9  Identities=33%  Similarity=1.239  Sum_probs=2.9

Q ss_pred             ecccccccc
Q psy13164        109 KCDLCSKEY  117 (193)
Q Consensus       109 ~C~~C~~~f  117 (193)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            455666655


No 128
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=40.12  E-value=21  Score=18.53  Aligned_cols=16  Identities=31%  Similarity=0.713  Sum_probs=6.9

Q ss_pred             eecccccccccChhHH
Q psy13164        108 YKCDLCSKEYFHKGSL  123 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l  123 (193)
                      ..|+.|+..+-....|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3444444444444333


No 129
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=40.11  E-value=18  Score=23.22  Aligned_cols=12  Identities=17%  Similarity=0.578  Sum_probs=5.7

Q ss_pred             eeccccchhccC
Q psy13164        135 YKCDLCSKEYFH  146 (193)
Q Consensus       135 ~~C~~C~~~f~~  146 (193)
                      ++|..||..|..
T Consensus         3 H~CtrCG~vf~~   14 (112)
T COG3364           3 HQCTRCGEVFDD   14 (112)
T ss_pred             ceeccccccccc
Confidence            344445544444


No 130
>KOG2593|consensus
Probab=39.54  E-value=22  Score=29.02  Aligned_cols=35  Identities=23%  Similarity=0.494  Sum_probs=19.3

Q ss_pred             CCceecccccccccChhHHHHHHHhhC-Ccceeccccch
Q psy13164        105 GIRYKCDLCSKEYFHKGSLTEHKKRHQ-GIRYKCDLCSK  142 (193)
Q Consensus       105 ~~~~~C~~C~~~f~~~~~l~~h~~~h~-~~~~~C~~C~~  142 (193)
                      ...|.|+.|.+.|.....++   ..-- ...|.|..|+.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            34577777777766544333   1111 11577777763


No 131
>PRK05580 primosome assembly protein PriA; Validated
Probab=37.96  E-value=17  Score=31.81  Aligned_cols=9  Identities=22%  Similarity=0.615  Sum_probs=4.6

Q ss_pred             ceeccccch
Q psy13164        134 RYKCDLCSK  142 (193)
Q Consensus       134 ~~~C~~C~~  142 (193)
                      |..|+.||.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            445555543


No 132
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=37.96  E-value=24  Score=19.84  Aligned_cols=7  Identities=43%  Similarity=1.084  Sum_probs=3.0

Q ss_pred             ecccccc
Q psy13164        109 KCDLCSK  115 (193)
Q Consensus       109 ~C~~C~~  115 (193)
                      .|+.||.
T Consensus        24 ~Cp~CGa   30 (54)
T TIGR01206        24 ICDECGA   30 (54)
T ss_pred             eCCCCCC
Confidence            4444443


No 133
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.17  E-value=7.2  Score=22.37  Aligned_cols=11  Identities=18%  Similarity=0.347  Sum_probs=6.2

Q ss_pred             CCCCccCCCCc
Q psy13164         83 RSINYNCQQSY   93 (193)
Q Consensus        83 ~~~~~~C~~c~   93 (193)
                      +...|.|++|.
T Consensus        28 PIrtymC~eC~   38 (68)
T COG4896          28 PIRTYMCPECE   38 (68)
T ss_pred             CceeEechhhH
Confidence            34456666664


No 134
>KOG3408|consensus
Probab=36.88  E-value=23  Score=23.55  Aligned_cols=23  Identities=22%  Similarity=0.496  Sum_probs=20.6

Q ss_pred             ceeccccchhccChhHHHHHHHH
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKI  156 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~  156 (193)
                      .|-|..|.+-|.....|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            59999999999999999999875


No 135
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=36.22  E-value=36  Score=23.96  Aligned_cols=18  Identities=28%  Similarity=0.678  Sum_probs=12.3

Q ss_pred             ceeccccchhccChhHHH
Q psy13164        134 RYKCDLCSKEYFHKGYLT  151 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~  151 (193)
                      -+.|+.||+.|.-.+++.
T Consensus       130 f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         130 FYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             eeECCCCcccccCchHHH
Confidence            467888887777666554


No 136
>KOG2593|consensus
Probab=36.18  E-value=34  Score=27.98  Aligned_cols=35  Identities=26%  Similarity=0.588  Sum_probs=24.1

Q ss_pred             ceeccccchhccChhHHHHHHHHhCC-cccccccCcccc
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQG-IRYKCNLCSKEF  171 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~-~~~~C~~C~~~F  171 (193)
                      .|.|+.|.+.|+..-.++   ..-.. ..|.|..|+-..
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGGEL  163 (436)
T ss_pred             cccCCccccchhhhHHHH---hhcccCceEEEecCCCch
Confidence            599999999997654432   33222 269999998643


No 137
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=36.02  E-value=56  Score=21.03  Aligned_cols=37  Identities=5%  Similarity=0.107  Sum_probs=29.7

Q ss_pred             ceecccccccccChhHHHHHHHhhCCcceeccccchh
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKE  143 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~  143 (193)
                      .|.|+.-+..|.+...+...+......-|.|...|+.
T Consensus         3 Vf~i~~T~EiF~dYe~Y~~R~~~y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    3 VFYIPFTGEIFRDYEEYLKRMILYNQRVWTCEITGKS   39 (102)
T ss_pred             eEEeCCCCcccCCHHHHHHHHHHHhCCeeEEecCCCC
Confidence            4778888889999888888877776667899888864


No 138
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=35.18  E-value=20  Score=28.00  Aligned_cols=48  Identities=21%  Similarity=0.447  Sum_probs=29.3

Q ss_pred             eccccchhccChhHHHHHHHHhCCcccccccCcccccChHHHHHHHHHc
Q psy13164        136 KCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       136 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      .|-.|...|.....-..-. .-+..+|+|..|...|-.--....|...|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~~-~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFDE-STSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCcccc-cccccceechhhhhhhhhhhHHHHHHHHh
Confidence            3666776666543321111 11122799999999998777777777666


No 139
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=34.58  E-value=11  Score=23.61  Aligned_cols=11  Identities=36%  Similarity=1.099  Sum_probs=6.5

Q ss_pred             eeccccchhcc
Q psy13164        135 YKCDLCSKEYF  145 (193)
Q Consensus       135 ~~C~~C~~~f~  145 (193)
                      |.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (90)
T PF01780_consen   54 WKCKKCGKKFA   64 (90)
T ss_dssp             EEETTTTEEEE
T ss_pred             eecCCCCCEEe
Confidence            66666665553


No 140
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=34.15  E-value=31  Score=19.25  Aligned_cols=8  Identities=38%  Similarity=0.418  Sum_probs=3.7

Q ss_pred             hHHHHHHH
Q psy13164        148 GYLTDHKK  155 (193)
Q Consensus       148 ~~l~~H~~  155 (193)
                      ..|..|+.
T Consensus        24 ~~l~~H~~   31 (60)
T PF02176_consen   24 KELDDHLE   31 (60)
T ss_dssp             CCHHHHHH
T ss_pred             HHHHHHHH
Confidence            34444544


No 141
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=33.86  E-value=33  Score=18.87  Aligned_cols=11  Identities=27%  Similarity=0.860  Sum_probs=6.2

Q ss_pred             eeccccccccc
Q psy13164        108 YKCDLCSKEYF  118 (193)
Q Consensus       108 ~~C~~C~~~f~  118 (193)
                      +.|..||..|.
T Consensus         5 l~C~dCg~~Fv   15 (49)
T PF13451_consen    5 LTCKDCGAEFV   15 (49)
T ss_pred             EEcccCCCeEE
Confidence            55666665554


No 142
>KOG2907|consensus
Probab=33.48  E-value=21  Score=23.32  Aligned_cols=10  Identities=20%  Similarity=0.557  Sum_probs=5.3

Q ss_pred             cchhHhhccC
Q psy13164         60 TRDCLEFFKS   69 (193)
Q Consensus        60 c~~c~~~f~~   69 (193)
                      |..||..+..
T Consensus        10 C~~CG~ll~~   19 (116)
T KOG2907|consen   10 CSDCGSLLEE   19 (116)
T ss_pred             hhhhhhhccc
Confidence            5566655433


No 143
>KOG2807|consensus
Probab=33.39  E-value=61  Score=25.62  Aligned_cols=24  Identities=29%  Similarity=0.681  Sum_probs=18.8

Q ss_pred             ccccccCcccccChHHHHHHHHHc
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIH  184 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h  184 (193)
                      .|.|..|...|=.--....|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            689999999887776666777666


No 144
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=33.28  E-value=19  Score=18.57  Aligned_cols=13  Identities=31%  Similarity=0.810  Sum_probs=10.4

Q ss_pred             ccccccCcccccC
Q psy13164        161 RYKCNLCSKEFLR  173 (193)
Q Consensus       161 ~~~C~~C~~~F~~  173 (193)
                      ||.|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7888888888854


No 145
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=32.17  E-value=23  Score=23.26  Aligned_cols=10  Identities=40%  Similarity=0.943  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            4455555443


No 146
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.91  E-value=27  Score=22.71  Aligned_cols=11  Identities=18%  Similarity=0.220  Sum_probs=6.8

Q ss_pred             ceeccccchhc
Q psy13164        134 RYKCDLCSKEY  144 (193)
Q Consensus       134 ~~~C~~C~~~f  144 (193)
                      |..|++||+.|
T Consensus        26 PiVsPytG~s~   36 (129)
T COG4530          26 PIVSPYTGKSY   36 (129)
T ss_pred             ccccCcccccc
Confidence            56666666665


No 147
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=30.83  E-value=26  Score=22.98  Aligned_cols=10  Identities=30%  Similarity=0.295  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555433


No 148
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=30.80  E-value=21  Score=22.79  Aligned_cols=20  Identities=20%  Similarity=0.419  Sum_probs=12.4

Q ss_pred             HHHhCCcccccccCcccccC
Q psy13164        154 KKIHQGIRYKCNLCSKEFLR  173 (193)
Q Consensus       154 ~~~h~~~~~~C~~C~~~F~~  173 (193)
                      +..+.|.+++|..||..|..
T Consensus        72 ~~l~~g~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLEKGKPKRCPECGHVFKL   91 (97)
T ss_pred             EEEeCCCceeCCCCCcEEEE
Confidence            34455557777777777643


No 149
>PLN02294 cytochrome c oxidase subunit Vb
Probab=30.68  E-value=15  Score=26.02  Aligned_cols=23  Identities=17%  Similarity=0.450  Sum_probs=16.9

Q ss_pred             HHHHHHhCCcccccccCcccccC
Q psy13164        151 TDHKKIHQGIRYKCNLCSKEFLR  173 (193)
Q Consensus       151 ~~H~~~h~~~~~~C~~C~~~F~~  173 (193)
                      ..++..+.|+|..|+.||..|..
T Consensus       131 v~Wf~L~kGkp~RCpeCG~~fkL  153 (174)
T PLN02294        131 VVWFWLEKGKSFECPVCTQYFEL  153 (174)
T ss_pred             eEEEEecCCCceeCCCCCCEEEE
Confidence            34456677778889999988854


No 150
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=30.38  E-value=30  Score=18.07  Aligned_cols=8  Identities=25%  Similarity=0.663  Sum_probs=3.0

Q ss_pred             eecccccc
Q psy13164        108 YKCDLCSK  115 (193)
Q Consensus       108 ~~C~~C~~  115 (193)
                      +.|..||.
T Consensus        20 ~vC~~CG~   27 (43)
T PF08271_consen   20 LVCPNCGL   27 (43)
T ss_dssp             EEETTT-B
T ss_pred             EECCCCCC
Confidence            34444443


No 151
>KOG2071|consensus
Probab=30.06  E-value=31  Score=29.42  Aligned_cols=25  Identities=24%  Similarity=0.476  Sum_probs=18.3

Q ss_pred             ccccccCcccccChHHHHHHHHHcC
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKIHQ  185 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~h~  185 (193)
                      |-+|..||.+|........||-+|-
T Consensus       418 pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  418 PNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cchhcccccccccchhhhhHhhhhh
Confidence            5778888888887777666666554


No 152
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=29.45  E-value=33  Score=17.43  Aligned_cols=8  Identities=50%  Similarity=1.364  Sum_probs=3.8

Q ss_pred             Cceecccc
Q psy13164        106 IRYKCDLC  113 (193)
Q Consensus       106 ~~~~C~~C  113 (193)
                      ..|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            33555544


No 153
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.40  E-value=26  Score=22.58  Aligned_cols=22  Identities=36%  Similarity=0.738  Sum_probs=16.1

Q ss_pred             ccccccCcccccChHHHHHHHH
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKK  182 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~  182 (193)
                      .+-|..|.+-|.+...|..|.+
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            4667777777777777777764


No 154
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=28.36  E-value=19  Score=18.92  Aligned_cols=13  Identities=38%  Similarity=0.933  Sum_probs=7.9

Q ss_pred             ccccccCcccccC
Q psy13164        161 RYKCNLCSKEFLR  173 (193)
Q Consensus       161 ~~~C~~C~~~F~~  173 (193)
                      |+.|..|+..|=.
T Consensus        13 ~~~C~~C~~~FC~   25 (43)
T PF01428_consen   13 PFKCKHCGKSFCL   25 (43)
T ss_dssp             HEE-TTTS-EE-T
T ss_pred             CeECCCCCcccCc
Confidence            6888888888843


No 155
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=28.32  E-value=27  Score=24.25  Aligned_cols=33  Identities=27%  Similarity=0.905  Sum_probs=18.2

Q ss_pred             ceeccccchhccChhHHHHHHHHhCCcccccccCccc
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKKIHQGIRYKCNLCSKE  170 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~C~~C~~~  170 (193)
                      +|.|. |+..|.+.   .+|-..-.|+.|.|..|+-.
T Consensus       117 ~Y~C~-C~q~~l~~---RRhn~~~~g~~YrC~~C~gk  149 (156)
T COG3091         117 PYRCQ-CQQHYLRI---RRHNTVRRGEVYRCGKCGGK  149 (156)
T ss_pred             eEEee-cCCccchh---hhcccccccceEEeccCCce
Confidence            57777 77664432   23333333445777777643


No 156
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=28.22  E-value=37  Score=18.69  Aligned_cols=8  Identities=38%  Similarity=0.991  Sum_probs=3.5

Q ss_pred             cccccccc
Q psy13164        110 CDLCSKEY  117 (193)
Q Consensus       110 C~~C~~~f  117 (193)
                      |..|++.|
T Consensus         5 C~~C~~~F   12 (57)
T cd00065           5 CMGCGKPF   12 (57)
T ss_pred             CcccCccc
Confidence            44444444


No 157
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=27.98  E-value=35  Score=17.61  Aligned_cols=10  Identities=20%  Similarity=0.913  Sum_probs=4.3

Q ss_pred             Cceecccccc
Q psy13164        106 IRYKCDLCSK  115 (193)
Q Consensus       106 ~~~~C~~C~~  115 (193)
                      +.+.|..|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            4455555554


No 158
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.58  E-value=46  Score=17.94  Aligned_cols=9  Identities=33%  Similarity=0.958  Sum_probs=4.6

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      +.|+.|+..
T Consensus        21 ~vC~~Cg~~   29 (52)
T smart00661       21 FVCRKCGYE   29 (52)
T ss_pred             EECCcCCCe
Confidence            455555543


No 159
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=27.03  E-value=24  Score=19.53  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=6.3

Q ss_pred             ccccCcccccCh
Q psy13164        163 KCNLCSKEFLRK  174 (193)
Q Consensus       163 ~C~~C~~~F~~~  174 (193)
                      .|+.|++.|..-
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999998643


No 160
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=26.92  E-value=46  Score=17.70  Aligned_cols=7  Identities=43%  Similarity=1.549  Sum_probs=3.6

Q ss_pred             eeccccc
Q psy13164        108 YKCDLCS  114 (193)
Q Consensus       108 ~~C~~C~  114 (193)
                      |+|..|.
T Consensus        38 ~~C~~C~   44 (46)
T PF12760_consen   38 YRCKACR   44 (46)
T ss_pred             EECCCCC
Confidence            5555554


No 161
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=26.85  E-value=39  Score=18.58  Aligned_cols=9  Identities=33%  Similarity=1.036  Sum_probs=4.6

Q ss_pred             ccccccCcc
Q psy13164        161 RYKCNLCSK  169 (193)
Q Consensus       161 ~~~C~~C~~  169 (193)
                      ++.|..|+.
T Consensus        37 R~~CGkCgy   45 (51)
T COG1998          37 RWACGKCGY   45 (51)
T ss_pred             eeEeccccc
Confidence            455555553


No 162
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.45  E-value=95  Score=17.88  Aligned_cols=9  Identities=33%  Similarity=0.933  Sum_probs=4.5

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      |.|+.||..
T Consensus        47 ~~C~~Cg~~   55 (69)
T PF07282_consen   47 FTCPNCGFE   55 (69)
T ss_pred             EEcCCCCCE
Confidence            455555544


No 163
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=26.34  E-value=36  Score=23.28  Aligned_cols=31  Identities=29%  Similarity=0.882  Sum_probs=16.8

Q ss_pred             ceecccccccccChhHHHHHHHhhCC-cceeccccchhc
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKRHQG-IRYKCDLCSKEY  144 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~h~~-~~~~C~~C~~~f  144 (193)
                      .|.|..|+..+..      +. .+.. ..|.|..|+..+
T Consensus       112 ~y~C~~C~~~~~~------~r-r~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYLR------VR-RSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCce------Ec-cccCcceEEcCCCCCEE
Confidence            4777777765431      11 1122 357777777554


No 164
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=26.28  E-value=50  Score=27.52  Aligned_cols=26  Identities=23%  Similarity=0.414  Sum_probs=18.0

Q ss_pred             ceeccccchhccChhHHHHHHH-HhCC
Q psy13164        134 RYKCDLCSKEYFHKGYLTDHKK-IHQG  159 (193)
Q Consensus       134 ~~~C~~C~~~f~~~~~l~~H~~-~h~~  159 (193)
                      -|.|+.|.+.|.....+..|+. .|.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            3677777777777777777776 3544


No 165
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=26.14  E-value=12  Score=20.77  Aligned_cols=25  Identities=24%  Similarity=0.587  Sum_probs=12.6

Q ss_pred             CceecccccccccChhHHHHHHHhh
Q psy13164        106 IRYKCDLCSKEYFHKGSLTEHKKRH  130 (193)
Q Consensus       106 ~~~~C~~C~~~f~~~~~l~~h~~~h  130 (193)
                      ..|.|+.|...|-..-.+..|...|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CeEECCCCCCccccCcChhhhcccc
Confidence            3488888888887766666555544


No 166
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=25.97  E-value=17  Score=17.36  Aligned_cols=9  Identities=56%  Similarity=1.161  Sum_probs=4.6

Q ss_pred             ccccCcccc
Q psy13164        163 KCNLCSKEF  171 (193)
Q Consensus       163 ~C~~C~~~F  171 (193)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 167
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=25.90  E-value=33  Score=22.66  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=4.7

Q ss_pred             eecccccccc
Q psy13164        108 YKCDLCSKEY  117 (193)
Q Consensus       108 ~~C~~C~~~f  117 (193)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4455555433


No 168
>PRK04351 hypothetical protein; Provisional
Probab=25.05  E-value=38  Score=23.45  Aligned_cols=31  Identities=32%  Similarity=0.897  Sum_probs=18.3

Q ss_pred             eecccccccccChhHHHHHHHhhCCcceeccccchhcc
Q psy13164        108 YKCDLCSKEYFHKGSLTEHKKRHQGIRYKCDLCSKEYF  145 (193)
Q Consensus       108 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~C~~C~~~f~  145 (193)
                      |.|..|+..+.+.       +.+-...|.|..|+..+.
T Consensus       113 Y~C~~Cg~~~~r~-------Rr~n~~~yrCg~C~g~L~  143 (149)
T PRK04351        113 YECQSCGQQYLRK-------RRINTKRYRCGKCRGKLK  143 (149)
T ss_pred             EECCCCCCEeeee-------eecCCCcEEeCCCCcEee
Confidence            7887788655321       122223688888876554


No 169
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=24.85  E-value=24  Score=31.51  Aligned_cols=11  Identities=36%  Similarity=0.703  Sum_probs=0.0

Q ss_pred             ceeccccchhc
Q psy13164        134 RYKCDLCSKEY  144 (193)
Q Consensus       134 ~~~C~~C~~~f  144 (193)
                      -|.|+.|+...
T Consensus       680 ~~~Cp~C~~~~  690 (900)
T PF03833_consen  680 VYVCPDCGIEV  690 (900)
T ss_dssp             -----------
T ss_pred             ceecccccccc
Confidence            36677666543


No 170
>KOG2272|consensus
Probab=24.28  E-value=82  Score=23.95  Aligned_cols=20  Identities=5%  Similarity=-0.076  Sum_probs=12.6

Q ss_pred             CCCCcccchhHhhccCchhh
Q psy13164         54 NGNDAVTRDCLEFFKSHDST   73 (193)
Q Consensus        54 ~~~~~~c~~c~~~f~~~~~~   73 (193)
                      -..-+.|++|.+.+.+...+
T Consensus        96 Hp~CF~Cd~Cn~~Lad~gf~  115 (332)
T KOG2272|consen   96 HPACFRCDLCNKHLADQGFY  115 (332)
T ss_pred             CcccchhHHHHHHHhhhhhH
Confidence            34456788888776654443


No 171
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=24.19  E-value=61  Score=17.79  Aligned_cols=9  Identities=22%  Similarity=0.885  Sum_probs=4.7

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      +.|..|+.+
T Consensus        38 ~~C~~Cgyt   46 (50)
T PRK00432         38 WHCGKCGYT   46 (50)
T ss_pred             EECCCcCCE
Confidence            555555543


No 172
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=23.33  E-value=25  Score=17.69  Aligned_cols=8  Identities=38%  Similarity=0.953  Sum_probs=3.8

Q ss_pred             eccccccc
Q psy13164        109 KCDLCSKE  116 (193)
Q Consensus       109 ~C~~C~~~  116 (193)
                      .|..|+..
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            45555544


No 173
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=23.03  E-value=40  Score=17.20  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=5.6

Q ss_pred             ceecccccccc
Q psy13164        107 RYKCDLCSKEY  117 (193)
Q Consensus       107 ~~~C~~C~~~f  117 (193)
                      .|+|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            38888888754


No 174
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.88  E-value=31  Score=20.85  Aligned_cols=9  Identities=33%  Similarity=1.139  Sum_probs=5.3

Q ss_pred             eeccccccc
Q psy13164        108 YKCDLCSKE  116 (193)
Q Consensus       108 ~~C~~C~~~  116 (193)
                      |.|..|+..
T Consensus        13 Y~c~~cg~~   21 (82)
T COG2331          13 YECTECGNR   21 (82)
T ss_pred             EeecccchH
Confidence            566666654


No 175
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.78  E-value=76  Score=16.23  Aligned_cols=11  Identities=45%  Similarity=1.156  Sum_probs=3.8

Q ss_pred             ccccccCcccc
Q psy13164        161 RYKCNLCSKEF  171 (193)
Q Consensus       161 ~~~C~~C~~~F  171 (193)
                      +|-|..|+..|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            35577777776


No 176
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=22.36  E-value=64  Score=17.82  Aligned_cols=8  Identities=38%  Similarity=1.186  Sum_probs=3.2

Q ss_pred             eeccccch
Q psy13164        135 YKCDLCSK  142 (193)
Q Consensus       135 ~~C~~C~~  142 (193)
                      +.|..||.
T Consensus        29 W~C~~Cgh   36 (55)
T PF14311_consen   29 WKCPKCGH   36 (55)
T ss_pred             EECCCCCC
Confidence            34444433


No 177
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1773 Rubredoxin [Energy production and conversion]
Probab=22.29  E-value=44  Score=18.88  Aligned_cols=13  Identities=31%  Similarity=0.907  Sum_probs=8.9

Q ss_pred             ceecccccccccC
Q psy13164        107 RYKCDLCSKEYFH  119 (193)
Q Consensus       107 ~~~C~~C~~~f~~  119 (193)
                      .|+|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            3778888877643


No 179
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.28  E-value=41  Score=22.80  Aligned_cols=12  Identities=33%  Similarity=0.753  Sum_probs=6.4

Q ss_pred             eecccccccccC
Q psy13164        108 YKCDLCSKEYFH  119 (193)
Q Consensus       108 ~~C~~C~~~f~~  119 (193)
                      +.|..||..|..
T Consensus        71 ~~C~~CG~~~~~   82 (135)
T PRK03824         71 LKCRNCGNEWSL   82 (135)
T ss_pred             EECCCCCCEEec
Confidence            555555555443


No 180
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.74  E-value=56  Score=17.28  Aligned_cols=12  Identities=25%  Similarity=0.866  Sum_probs=7.8

Q ss_pred             ccccCcccccCh
Q psy13164        163 KCNLCSKEFLRK  174 (193)
Q Consensus       163 ~C~~C~~~F~~~  174 (193)
                      .|..|++.|+..
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            467777777654


No 181
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=21.22  E-value=25  Score=19.73  Aligned_cols=8  Identities=25%  Similarity=0.721  Sum_probs=3.9

Q ss_pred             ceeccccc
Q psy13164        134 RYKCDLCS  141 (193)
Q Consensus       134 ~~~C~~C~  141 (193)
                      |+.|+.|.
T Consensus        28 PlyCpKCK   35 (55)
T PF14205_consen   28 PLYCPKCK   35 (55)
T ss_pred             cccCCCCC
Confidence            44555544


No 182
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=21.13  E-value=65  Score=15.53  Aligned_cols=11  Identities=36%  Similarity=1.150  Sum_probs=4.4

Q ss_pred             eeccccccccc
Q psy13164        108 YKCDLCSKEYF  118 (193)
Q Consensus       108 ~~C~~C~~~f~  118 (193)
                      |.|+.|+..+-
T Consensus        14 Y~Cp~C~~~~C   24 (30)
T PF04438_consen   14 YRCPRCGARYC   24 (30)
T ss_dssp             EE-TTT--EES
T ss_pred             EECCCcCCcee
Confidence            56666655443


No 183
>KOG0717|consensus
Probab=20.92  E-value=57  Score=27.12  Aligned_cols=22  Identities=27%  Similarity=0.581  Sum_probs=18.7

Q ss_pred             cccccCcccccChHHHHHHHHH
Q psy13164        162 YKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       162 ~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      +-|..|+++|.+-..|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999888888653


No 184
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.90  E-value=41  Score=22.64  Aligned_cols=13  Identities=46%  Similarity=1.063  Sum_probs=11.4

Q ss_pred             ccccccCcccccC
Q psy13164        161 RYKCNLCSKEFLR  173 (193)
Q Consensus       161 ~~~C~~C~~~F~~  173 (193)
                      +|.|..|++.|..
T Consensus        53 RyrC~~C~~tf~~   65 (129)
T COG3677          53 RYKCKSCGSTFTV   65 (129)
T ss_pred             ccccCCcCcceee
Confidence            7999999999964


No 185
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=20.78  E-value=40  Score=21.22  Aligned_cols=13  Identities=15%  Similarity=0.641  Sum_probs=8.3

Q ss_pred             ceeccccchhccC
Q psy13164        134 RYKCDLCSKEYFH  146 (193)
Q Consensus       134 ~~~C~~C~~~f~~  146 (193)
                      .|.|..|++.|..
T Consensus        53 IW~C~~C~~~~AG   65 (91)
T TIGR00280        53 IWTCRKCGAKFAG   65 (91)
T ss_pred             EEEcCCCCCEEeC
Confidence            4677777766643


No 186
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=20.44  E-value=56  Score=16.35  Aligned_cols=8  Identities=25%  Similarity=0.688  Sum_probs=4.4

Q ss_pred             eecccccc
Q psy13164        108 YKCDLCSK  115 (193)
Q Consensus       108 ~~C~~C~~  115 (193)
                      +.|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            55555554


No 187
>PTZ00448 hypothetical protein; Provisional
Probab=20.39  E-value=71  Score=25.73  Aligned_cols=23  Identities=13%  Similarity=0.447  Sum_probs=18.2

Q ss_pred             ccccccCcccccChHHHHHHHHH
Q psy13164        161 RYKCNLCSKEFLRKDILIEHKKI  183 (193)
Q Consensus       161 ~~~C~~C~~~F~~~~~L~~H~~~  183 (193)
                      .|.|..|+..|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57788888888877777778765


No 188
>KOG1842|consensus
Probab=20.07  E-value=66  Score=26.58  Aligned_cols=26  Identities=19%  Similarity=0.445  Sum_probs=21.4

Q ss_pred             ceecccccccccChhHHHHHHHh-hCC
Q psy13164        107 RYKCDLCSKEYFHKGSLTEHKKR-HQG  132 (193)
Q Consensus       107 ~~~C~~C~~~f~~~~~l~~h~~~-h~~  132 (193)
                      .|.|++|...|.+...|..|... |.+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccc
Confidence            48899999999999999999865 554


Done!