BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13205
         (267 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SY3|A Chain A, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis
 pdb|3SY3|B Chain B, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis
 pdb|3SY3|C Chain C, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis
 pdb|3SY3|D Chain D, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis
 pdb|3TJ7|A Chain A, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis In Complex With Amp
 pdb|3TJ7|B Chain B, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis In Complex With Amp
 pdb|3TJ7|C Chain C, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis In Complex With Amp
 pdb|3TJ7|D Chain D, Gbaa_1210 Protein, A Putative Adenylate Cyclase, From
           Bacillus Anthracis In Complex With Amp
          Length = 195

 Score = 28.1 bits (61), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 172 TLSLHMASIFALCLIYVMINKNSLS---DTEAIISLVIMSLIAILFIPIFGLTGFHMVLV 228
           TL+L   +   L   + ++ +N      +T  IIS  + + +  L IP+  LT       
Sbjct: 65  TLTLKQPAEVGLLETHQVVTENEAKXXXETNVIISGAVXNQLCKLQIPVSALT------- 117

Query: 229 ARGRTTNEQVTGKFKGGYNPFSHGCWHN 256
             G  T E+    F+GG   F H  ++N
Sbjct: 118 YXGSLTTERAETLFEGGTLVFDHSFYYN 145


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.335    0.146    0.528 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,256,669
Number of Sequences: 62578
Number of extensions: 305378
Number of successful extensions: 821
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 819
Number of HSP's gapped (non-prelim): 5
length of query: 267
length of database: 14,973,337
effective HSP length: 97
effective length of query: 170
effective length of database: 8,903,271
effective search space: 1513556070
effective search space used: 1513556070
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 50 (23.9 bits)