Query         psy13210
Match_columns 155
No_of_seqs    136 out of 1738
Neff          9.8 
Searched_HMMs 46136
Date          Fri Aug 16 22:58:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13210.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13210hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 4.5E-24 9.8E-29  151.0   4.5  112   26-147   142-264 (279)
  2 KOG2462|consensus               99.8 1.4E-21 3.1E-26  138.4   4.4  105   42-155   127-243 (279)
  3 KOG1074|consensus               99.8 1.7E-19 3.8E-24  143.2   2.3   58   44-109   352-409 (958)
  4 KOG3576|consensus               99.6 5.4E-17 1.2E-21  110.6   1.1  102   42-151   114-237 (267)
  5 KOG3623|consensus               99.6 2.8E-16 6.1E-21  123.8   3.0   82   41-147   890-971 (1007)
  6 KOG1074|consensus               99.6 1.2E-15 2.6E-20  121.7   3.2   60   43-110   603-662 (958)
  7 KOG3623|consensus               99.4 1.6E-13 3.4E-18  108.6   3.4   97   45-147   210-330 (1007)
  8 KOG3608|consensus               99.4 1.4E-12   3E-17   95.9   6.7  111   44-155   236-381 (467)
  9 KOG3608|consensus               99.4 1.7E-12 3.7E-17   95.4   6.5  105   40-151   202-316 (467)
 10 PHA00733 hypothetical protein   99.3 1.2E-11 2.6E-16   80.6   6.2   88   42-151    37-124 (128)
 11 KOG3576|consensus               99.3 2.3E-12 5.1E-17   88.2   2.5   72   44-123   144-237 (267)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.1 5.3E-11 1.2E-15   56.0   2.6   26  113-138     1-26  (26)
 13 PHA02768 hypothetical protein;  99.0 1.2E-10 2.5E-15   63.8   1.9   44   81-143     5-48  (55)
 14 PHA02768 hypothetical protein;  98.9 3.5E-10 7.6E-15   62.0   0.9   45   44-98      4-48  (55)
 15 KOG3993|consensus               98.8   1E-09 2.2E-14   82.6   1.2  103   43-153   265-383 (500)
 16 PLN03086 PRLI-interacting fact  98.8 1.3E-08 2.8E-13   80.6   6.0   91   46-151   454-565 (567)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.6 1.2E-08 2.7E-13   47.8   1.0   26   60-93      1-26  (26)
 18 PHA00733 hypothetical protein   98.6 5.5E-08 1.2E-12   63.5   4.1   54   42-105    70-123 (128)
 19 PHA00732 hypothetical protein   98.6 4.1E-08 8.9E-13   58.5   2.7   44   81-147     1-45  (79)
 20 KOG3993|consensus               98.6   1E-08 2.2E-13   77.3   0.0   85   13-105   263-380 (500)
 21 PHA00616 hypothetical protein   98.6 3.2E-08   7E-13   51.7   1.6   29  126-155     1-29  (44)
 22 PHA00616 hypothetical protein   98.5 5.7E-08 1.2E-12   50.8   1.8   29   81-109     1-29  (44)
 23 PLN03086 PRLI-interacting fact  98.3   1E-06 2.2E-11   70.1   5.9  100   44-147   406-535 (567)
 24 PF00096 zf-C2H2:  Zinc finger,  98.3 6.6E-07 1.4E-11   40.6   2.0   23   82-104     1-23  (23)
 25 PF05605 zf-Di19:  Drought indu  98.3 2.1E-06 4.5E-11   47.5   4.3   52   81-151     2-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2 1.1E-06 2.3E-11   39.9   2.0   22  127-148     1-22  (23)
 27 COG5189 SFP1 Putative transcri  98.2 1.8E-07   4E-12   68.4  -1.1   70   78-147   346-419 (423)
 28 PHA00732 hypothetical protein   98.2 9.9E-07 2.1E-11   52.6   1.6   47   45-105     1-48  (79)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.4E-06 5.2E-11   38.8   2.2   24  127-150     1-24  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.0 3.3E-06 7.1E-11   39.8   1.9   25  126-150     1-25  (27)
 31 PF12756 zf-C2H2_2:  C2H2 type   98.0 4.1E-06   9E-11   51.9   2.5   66   83-149     1-73  (100)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.9 9.9E-06 2.1E-10   36.7   2.2   23   82-104     1-23  (24)
 33 PF05605 zf-Di19:  Drought indu  97.9 1.4E-05   3E-10   44.2   3.1   51   45-105     2-53  (54)
 34 PF09237 GAGA:  GAGA factor;  I  97.8 2.5E-05 5.4E-10   41.8   2.9   33   77-109    20-52  (54)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.7 1.8E-05   4E-10   37.1   1.6   25   81-105     1-25  (27)
 36 smart00355 ZnF_C2H2 zinc finge  97.5 9.8E-05 2.1E-09   33.8   2.0   25  127-152     1-25  (26)
 37 smart00355 ZnF_C2H2 zinc finge  97.4 0.00014 3.1E-09   33.2   2.3   24   82-105     1-24  (26)
 38 PF09237 GAGA:  GAGA factor;  I  97.3 0.00036 7.9E-09   37.4   2.8   30  123-152    21-50  (54)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00034 7.5E-09   31.7   2.2   24  127-151     1-24  (24)
 40 PF12756 zf-C2H2_2:  C2H2 type   97.2 0.00032 6.9E-09   43.3   2.4   58   47-104     1-73  (100)
 41 PF12874 zf-met:  Zinc-finger o  97.1 0.00036 7.8E-09   31.9   1.8   21  127-147     1-21  (25)
 42 PF12874 zf-met:  Zinc-finger o  97.0 0.00043 9.4E-09   31.7   1.7   23   82-104     1-23  (25)
 43 COG5189 SFP1 Putative transcri  97.0 0.00017 3.7E-09   53.2  -0.2   60   43-102   347-419 (423)
 44 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00093   2E-08   30.3   2.1   23   82-105     1-23  (24)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.8  0.0006 1.3E-08   31.9   0.9   21  127-147     2-22  (27)
 46 PRK04860 hypothetical protein;  96.8 0.00083 1.8E-08   45.5   1.9   27  114-140   131-157 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0013 2.9E-08   30.7   0.9   22   82-103     2-23  (27)
 48 KOG1146|consensus               96.4 0.00099 2.2E-08   57.4   0.7   96   45-147   436-539 (1406)
 49 PF13913 zf-C2HC_2:  zinc-finge  96.2  0.0045 9.7E-08   28.4   2.0   21   82-103     3-23  (25)
 50 PF13913 zf-C2HC_2:  zinc-finge  96.0  0.0054 1.2E-07   28.1   1.6   20  127-147     3-22  (25)
 51 smart00451 ZnF_U1 U1-like zinc  95.7  0.0076 1.6E-07   29.7   1.7   22  126-147     3-24  (35)
 52 PRK04860 hypothetical protein;  95.7   0.004 8.6E-08   42.2   0.7   39   45-95    119-157 (160)
 53 COG5048 FOG: Zn-finger [Genera  95.3  0.0023 5.1E-08   49.2  -1.8   98   45-151   289-442 (467)
 54 COG4049 Uncharacterized protei  94.9   0.015 3.3E-07   31.8   1.3   30  122-151    13-42  (65)
 55 smart00451 ZnF_U1 U1-like zinc  94.7   0.028   6E-07   27.6   1.9   23   81-103     3-25  (35)
 56 PF09538 FYDLN_acid:  Protein o  93.9   0.037 8.1E-07   35.0   1.7   31   81-139     9-39  (108)
 57 PF12013 DUF3505:  Protein of u  93.2    0.47   1E-05   29.9   5.9   71   80-151    10-109 (109)
 58 KOG2893|consensus               92.6   0.025 5.4E-07   40.5  -0.7   45   48-104    13-58  (341)
 59 PF13717 zinc_ribbon_4:  zinc-r  92.1   0.076 1.6E-06   26.6   0.9   34   46-92      3-36  (36)
 60 KOG2893|consensus               92.1   0.048   1E-06   39.1   0.2   51   79-151     9-59  (341)
 61 KOG2231|consensus               91.7     0.2 4.4E-06   41.2   3.4   95    8-105    90-206 (669)
 62 COG5048 FOG: Zn-finger [Genera  91.6   0.047   1E-06   42.0  -0.3   57   80-154   288-350 (467)
 63 KOG1146|consensus               91.6    0.03 6.6E-07   48.8  -1.4   98   42-154  1257-1356(1406)
 64 PF02892 zf-BED:  BED zinc fing  91.4    0.22 4.7E-06   26.0   2.3   28  123-150    13-44  (45)
 65 cd00350 rubredoxin_like Rubred  91.3    0.11 2.3E-06   25.4   0.9   11  125-135    16-26  (33)
 66 COG4049 Uncharacterized protei  91.0    0.14   3E-06   28.1   1.3   29   75-103    11-39  (65)
 67 TIGR02300 FYDLN_acid conserved  90.1    0.21 4.6E-06   32.3   1.7   34   81-142     9-42  (129)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  90.0    0.13 2.9E-06   25.8   0.6   34   46-92      3-36  (38)
 69 PF13719 zinc_ribbon_5:  zinc-r  90.0    0.15 3.3E-06   25.6   0.8   34   46-92      3-36  (37)
 70 COG1592 Rubrerythrin [Energy p  89.8    0.19 4.1E-06   34.3   1.4   26   79-134   132-157 (166)
 71 smart00614 ZnF_BED BED zinc fi  89.4    0.35 7.6E-06   25.9   2.1   26  126-151    18-48  (50)
 72 KOG4173|consensus               89.4    0.39 8.4E-06   33.8   2.7   90   44-151    78-171 (253)
 73 PF05443 ROS_MUCR:  ROS/MUCR tr  88.6    0.32   7E-06   31.9   1.8   23  126-151    72-94  (132)
 74 PRK00398 rpoP DNA-directed RNA  87.3    0.26 5.5E-06   26.0   0.6   30   45-92      3-32  (46)
 75 KOG2482|consensus               86.6    0.53 1.1E-05   35.7   2.1   70   82-151   196-304 (423)
 76 COG5236 Uncharacterized conser  85.3    0.57 1.2E-05   35.6   1.8   40  112-151   202-245 (493)
 77 PF04959 ARS2:  Arsenite-resist  84.7    0.44 9.6E-06   33.9   0.9   30  123-152    74-103 (214)
 78 smart00531 TFIIE Transcription  83.7    0.84 1.8E-05   30.5   1.9   23   74-96     92-114 (147)
 79 smart00734 ZnF_Rad18 Rad18-lik  83.2     1.1 2.3E-05   20.6   1.6   20  127-147     2-21  (26)
 80 PHA00626 hypothetical protein   82.8    0.56 1.2E-05   25.8   0.6   17   79-95     21-37  (59)
 81 KOG2186|consensus               82.1    0.86 1.9E-05   33.1   1.5   48   45-103     3-50  (276)
 82 PF09723 Zn-ribbon_8:  Zinc rib  82.1    0.19   4E-06   26.0  -1.4   30   45-89      5-34  (42)
 83 KOG2482|consensus               81.9     3.6 7.8E-05   31.4   4.7   65   81-147   144-216 (423)
 84 COG2888 Predicted Zn-ribbon RN  81.7     0.5 1.1E-05   26.3   0.2   34   44-90     26-59  (61)
 85 TIGR00373 conserved hypothetic  81.5     1.2 2.6E-05   30.2   2.0   38   74-137   102-139 (158)
 86 KOG2071|consensus               81.0    0.87 1.9E-05   37.0   1.4   28   78-105   415-442 (579)
 87 TIGR02605 CxxC_CxxC_SSSS putat  79.8    0.67 1.4E-05   24.9   0.3   30   45-89      5-34  (52)
 88 COG4530 Uncharacterized protei  79.3     1.1 2.4E-05   28.2   1.1   16  123-138    23-38  (129)
 89 KOG2231|consensus               79.2     2.4 5.2E-05   35.2   3.3   15  136-150   222-236 (669)
 90 KOG4167|consensus               79.0    0.51 1.1E-05   39.3  -0.5   26   80-105   791-816 (907)
 91 KOG2785|consensus               78.9     3.9 8.4E-05   31.6   4.1   65   82-147   167-241 (390)
 92 COG5236 Uncharacterized conser  78.1     1.9 4.2E-05   32.8   2.3   65   83-151   222-306 (493)
 93 PRK14890 putative Zn-ribbon RN  77.9       1 2.2E-05   25.1   0.6   34   44-90     24-57  (59)
 94 COG5188 PRP9 Splicing factor 3  77.6       2 4.3E-05   32.9   2.2   24   43-66    236-259 (470)
 95 KOG2593|consensus               77.3     2.5 5.5E-05   33.1   2.8   34   65-98    112-145 (436)
 96 PRK06266 transcription initiat  77.3     1.9   4E-05   29.9   1.9   23   75-97    111-133 (178)
 97 PF10571 UPF0547:  Uncharacteri  74.1     1.7 3.6E-05   20.0   0.7   10   83-92     16-25  (26)
 98 KOG2186|consensus               73.5     2.3   5E-05   30.9   1.6   47   81-147     3-49  (276)
 99 PF07754 DUF1610:  Domain of un  73.1     1.6 3.4E-05   19.7   0.5   11   79-89     14-24  (24)
100 PF12013 DUF3505:  Protein of u  71.6     3.7 8.1E-05   25.7   2.2   24   82-105    81-108 (109)
101 PF04959 ARS2:  Arsenite-resist  71.0     2.8   6E-05   29.9   1.6   29   77-105    73-102 (214)
102 COG4957 Predicted transcriptio  70.9     2.5 5.3E-05   27.7   1.2   22  127-151    77-98  (148)
103 COG5151 SSL1 RNA polymerase II  70.5    0.96 2.1E-05   33.9  -0.8   49   15-65    360-408 (421)
104 COG1198 PriA Primosomal protei  69.9    0.52 1.1E-05   39.6  -2.6   45   83-135   437-484 (730)
105 COG3364 Zn-ribbon containing p  67.6     2.3   5E-05   26.4   0.5   16   46-61      3-18  (112)
106 PF04810 zf-Sec23_Sec24:  Sec23  65.1     2.5 5.4E-05   21.5   0.3   32   46-91      3-34  (40)
107 PF06220 zf-U1:  U1 zinc finger  64.5     5.3 0.00011   20.1   1.4   23  125-147     2-26  (38)
108 PF01927 Mut7-C:  Mut7-C RNAse   64.5       4 8.6E-05   27.2   1.3   53   45-100    91-143 (147)
109 KOG2785|consensus               64.1     4.6 9.9E-05   31.2   1.6   60   44-103     2-90  (390)
110 PF05191 ADK_lid:  Adenylate ki  63.8     3.1 6.8E-05   20.7   0.5   30   47-92      3-32  (36)
111 PF15269 zf-C2H2_7:  Zinc-finge  63.6       5 0.00011   21.0   1.2   22  127-148    21-42  (54)
112 KOG4167|consensus               63.4       2 4.4E-05   35.9  -0.3   25  126-151   792-816 (907)
113 smart00834 CxxC_CXXC_SSSS Puta  62.8     3.8 8.2E-05   20.5   0.7   13  127-139     6-18  (41)
114 KOG3408|consensus               62.0     5.4 0.00012   25.7   1.4   25  123-147    54-78  (129)
115 COG1996 RPC10 DNA-directed RNA  61.3     3.9 8.4E-05   21.9   0.6   12   44-55      5-16  (49)
116 PRK09678 DNA-binding transcrip  60.7       2 4.4E-05   25.0  -0.6   41   46-96      2-44  (72)
117 KOG2593|consensus               60.6     5.1 0.00011   31.5   1.4   43   37-90    120-162 (436)
118 smart00154 ZnF_AN1 AN1-like Zi  58.7     5.7 0.00012   20.1   0.9   14  126-139    12-25  (39)
119 smart00440 ZnF_C2C2 C2C2 Zinc   58.1     1.6 3.4E-05   22.3  -1.2   12   81-92     28-39  (40)
120 PF13878 zf-C2H2_3:  zinc-finge  57.9      11 0.00024   19.2   1.9   23   82-104    14-38  (41)
121 KOG2907|consensus               57.8     4.3 9.4E-05   25.7   0.5   41   45-93     74-114 (116)
122 COG1997 RPL43A Ribosomal prote  57.7     4.5 9.7E-05   24.5   0.5   34   43-94     33-66  (89)
123 PF09986 DUF2225:  Uncharacteri  57.2     4.4 9.6E-05   28.9   0.5   53   79-139     3-61  (214)
124 PF10276 zf-CHCC:  Zinc-finger   56.8     5.3 0.00012   20.4   0.6   12   80-91     28-39  (40)
125 PRK03824 hypA hydrogenase nick  56.8     3.3 7.1E-05   27.3  -0.2   15   44-58     69-83  (135)
126 PF08790 zf-LYAR:  LYAR-type C2  56.2     3.6 7.7E-05   19.3  -0.1   20  127-147     1-20  (28)
127 COG2331 Uncharacterized protei  54.9     4.1   9E-05   23.9   0.1   34   43-91     10-43  (82)
128 PF04780 DUF629:  Protein of un  54.8     9.4  0.0002   30.6   2.0   27  127-153    58-84  (466)
129 PF13451 zf-trcl:  Probable zin  54.6     6.2 0.00013   21.2   0.7   18  124-141     2-19  (49)
130 COG0068 HypF Hydrogenase matur  54.5     6.5 0.00014   33.0   1.1   44   32-89    137-181 (750)
131 PF01428 zf-AN1:  AN1-like Zinc  54.2       5 0.00011   20.6   0.3   15  125-139    12-26  (43)
132 KOG2636|consensus               51.2      11 0.00025   29.8   1.9   29   75-103   395-424 (497)
133 PF07503 zf-HYPF:  HypF finger;  51.0     8.8 0.00019   19.0   0.9   31   48-92      2-32  (35)
134 PF09845 DUF2072:  Zn-ribbon co  50.9     6.8 0.00015   25.6   0.6   15   81-95      1-15  (131)
135 COG1773 Rubredoxin [Energy pro  49.5     7.5 0.00016   21.4   0.5   15   81-95      3-17  (55)
136 cd00729 rubredoxin_SM Rubredox  49.4     8.1 0.00018   18.8   0.6   11   81-91      2-12  (34)
137 KOG2636|consensus               49.1      12 0.00027   29.6   1.8   27  119-145   394-421 (497)
138 COG1594 RPB9 DNA-directed RNA   49.0       4 8.7E-05   26.0  -0.7   40   45-92     72-111 (113)
139 PF12907 zf-met2:  Zinc-binding  48.7     5.4 0.00012   20.4  -0.1   27  127-153     2-31  (40)
140 PF04423 Rad50_zn_hook:  Rad50   48.6     7.6 0.00016   21.0   0.5   12  128-139    22-33  (54)
141 PF10013 DUF2256:  Uncharacteri  48.4      10 0.00022   19.6   0.9   17  127-143     9-25  (42)
142 PF04780 DUF629:  Protein of un  48.3      14  0.0003   29.6   2.0   26   81-106    57-83  (466)
143 PF01096 TFIIS_C:  Transcriptio  48.2     1.2 2.5E-05   22.6  -2.7   10   82-91     29-38  (39)
144 PHA02998 RNA polymerase subuni  47.6     3.6 7.9E-05   28.3  -1.1   39   45-95    143-185 (195)
145 COG4888 Uncharacterized Zn rib  47.6     2.3   5E-05   26.4  -1.8   13   79-91     20-32  (104)
146 PTZ00255 60S ribosomal protein  46.8     4.4 9.6E-05   24.7  -0.7   37   40-94     31-67  (90)
147 KOG1842|consensus               45.1      12 0.00027   29.6   1.3   26   81-106    15-41  (505)
148 KOG4173|consensus               43.8      13 0.00027   26.4   1.1   62   44-105   105-171 (253)
149 KOG0717|consensus               43.8      13 0.00028   29.7   1.2   21  127-147   293-313 (508)
150 TIGR00595 priA primosomal prot  43.4      12 0.00026   30.3   1.0    9  126-134   253-261 (505)
151 COG1656 Uncharacterized conser  43.0      24 0.00051   24.1   2.2   50   45-102    97-151 (165)
152 cd00924 Cyt_c_Oxidase_Vb Cytoc  42.7      13 0.00027   23.1   0.8   17  121-138    75-91  (97)
153 PRK14873 primosome assembly pr  42.5      14  0.0003   31.1   1.3   10   47-56    385-394 (665)
154 PRK05978 hypothetical protein;  41.8     7.6 0.00016   26.1  -0.3   34   44-94     32-65  (148)
155 smart00661 RPOL9 RNA polymeras  41.6      15 0.00033   19.3   1.0   14   81-94     20-33  (52)
156 COG3357 Predicted transcriptio  41.4      13 0.00027   22.7   0.7   15   79-93     56-70  (97)
157 KOG4124|consensus               40.4     1.6 3.4E-05   33.3  -4.0   69   79-147   347-419 (442)
158 KOG2071|consensus               40.0      19 0.00041   29.6   1.6   29  123-152   415-443 (579)
159 PRK00464 nrdR transcriptional   39.8      12 0.00026   25.3   0.4   17  126-142    28-44  (154)
160 PF09332 Mcm10:  Mcm10 replicat  39.7     4.7  0.0001   30.9  -1.7   69   21-93    223-297 (344)
161 cd00730 rubredoxin Rubredoxin;  39.4      14 0.00029   19.9   0.5   13   82-94      2-14  (50)
162 PRK05452 anaerobic nitric oxid  39.1      32 0.00069   27.7   2.8   42   40-90    420-467 (479)
163 KOG0717|consensus               39.1      18 0.00039   28.9   1.4   22  127-148   461-482 (508)
164 PLN02294 cytochrome c oxidase   38.4      16 0.00035   25.1   0.9   16   79-94    139-154 (174)
165 PF05741 zf-nanos:  Nanos RNA b  37.3      25 0.00054   19.3   1.4   12   80-91     32-43  (55)
166 COG4391 Uncharacterized protei  37.2      22 0.00047   20.0   1.1   16  123-138    45-60  (62)
167 COG3677 Transposase and inacti  36.5      17 0.00037   23.7   0.8   17  123-139    50-66  (129)
168 PF00301 Rubredoxin:  Rubredoxi  35.6      15 0.00033   19.4   0.4   14   82-95      2-15  (47)
169 KOG3408|consensus               34.6      27 0.00057   22.6   1.4   26   78-103    54-79  (129)
170 PF02748 PyrI_C:  Aspartate car  34.4      18 0.00039   19.6   0.5   17  123-139    32-48  (52)
171 PF01155 HypA:  Hydrogenase exp  33.9      15 0.00033   23.2   0.2   14   44-57     69-82  (113)
172 PF02176 zf-TRAF:  TRAF-type zi  33.7      16 0.00034   19.9   0.2   42   44-94      8-55  (60)
173 PF01363 FYVE:  FYVE zinc finge  33.1      18  0.0004   20.3   0.5   30   45-94      9-38  (69)
174 COG4338 Uncharacterized protei  33.0      16 0.00035   19.4   0.2   16  128-143    14-29  (54)
175 COG1571 Predicted DNA-binding   32.9      20 0.00042   28.4   0.7   15  126-140   367-381 (421)
176 CHL00174 accD acetyl-CoA carbo  32.8      16 0.00034   27.5   0.2   35   44-95     37-71  (296)
177 COG5188 PRP9 Splicing factor 3  32.1      30 0.00066   26.7   1.6   29   75-103   368-397 (470)
178 PF01780 Ribosomal_L37ae:  Ribo  31.8      22 0.00048   21.7   0.7   10  126-135    35-44  (90)
179 PF07975 C1_4:  TFIIH C1-like d  31.7      15 0.00033   19.8  -0.0   25  125-150    20-44  (51)
180 PF14353 CpXC:  CpXC protein     31.6     8.9 0.00019   24.7  -1.2   55   82-145     2-57  (128)
181 PF01286 XPA_N:  XPA protein N-  30.7      24 0.00051   17.4   0.5   13  127-139     4-16  (34)
182 PRK12380 hydrogenase nickel in  30.7      17 0.00037   23.1   0.0   14   44-57     69-82  (113)
183 TIGR01206 lysW lysine biosynth  30.3      23  0.0005   19.4   0.5   12   82-93      3-14  (54)
184 COG5112 UFD2 U1-like Zn-finger  30.1      28 0.00062   21.9   0.9   25  123-147    52-76  (126)
185 KOG1088|consensus               29.8      23 0.00051   22.7   0.6   22   74-95     91-112 (124)
186 PRK01343 zinc-binding protein;  29.7      35 0.00075   18.9   1.2   14  125-138     8-21  (57)
187 PF09416 UPF1_Zn_bind:  RNA hel  29.0      41 0.00089   22.7   1.6   46   44-89     13-68  (152)
188 PRK12722 transcriptional activ  28.9      30 0.00065   24.2   1.0   30   44-89    133-162 (187)
189 PF08792 A2L_zn_ribbon:  A2L zi  28.8      31 0.00067   16.7   0.8   12  126-137    21-32  (33)
190 TIGR01385 TFSII transcription   28.7      16 0.00036   27.5  -0.3   44   41-92    254-297 (299)
191 PF06397 Desulfoferrod_N:  Desu  28.6      28 0.00061   17.3   0.6   11  126-136     6-16  (36)
192 PRK04351 hypothetical protein;  28.5      22 0.00047   23.9   0.3   35   44-94    111-145 (149)
193 PF07295 DUF1451:  Protein of u  28.3      19 0.00041   24.1  -0.1   36   38-91    105-140 (146)
194 PF09082 DUF1922:  Domain of un  27.9     7.4 0.00016   22.4  -1.7   14   80-94     19-32  (68)
195 PRK03681 hypA hydrogenase nick  27.6      19 0.00041   22.9  -0.1    9   82-90     71-79  (114)
196 PRK05654 acetyl-CoA carboxylas  27.6      21 0.00045   26.8   0.1   35   44-95     26-60  (292)
197 TIGR00515 accD acetyl-CoA carb  27.4      22 0.00048   26.6   0.2   35   44-95     25-59  (285)
198 PF14803 Nudix_N_2:  Nudix N-te  27.3      15 0.00031   18.0  -0.6   12   80-91     21-32  (34)
199 PF14447 Prok-RING_4:  Prokaryo  26.9      30 0.00064   19.0   0.6   12  128-139    41-52  (55)
200 PRK12860 transcriptional activ  26.8      33 0.00071   24.1   0.9   29   44-88    133-161 (189)
201 PF11931 DUF3449:  Domain of un  26.7      21 0.00046   25.1   0.0   24   79-102    99-123 (196)
202 PF04438 zf-HIT:  HIT zinc fing  26.1      42 0.00091   15.8   1.0   14  126-139    13-26  (30)
203 PF13824 zf-Mss51:  Zinc-finger  26.0      43 0.00093   18.4   1.1   18   77-94     10-27  (55)
204 KOG2807|consensus               25.8      95   0.002   23.9   3.2   68   80-147   289-366 (378)
205 KOG1994|consensus               25.6      35 0.00075   24.7   0.9   23  124-146   237-259 (268)
206 PF14787 zf-CCHC_5:  GAG-polypr  25.4      29 0.00062   17.3   0.3   17  127-143     3-19  (36)
207 TIGR00280 L37a ribosomal prote  25.4      33 0.00071   21.0   0.6   10  126-135    35-44  (91)
208 PF14369 zf-RING_3:  zinc-finge  25.4      33 0.00072   16.8   0.6   10   83-92     23-32  (35)
209 PF14255 Cys_rich_CPXG:  Cystei  25.2      31 0.00066   18.7   0.4   12  127-138     1-12  (52)
210 PF03884 DUF329:  Domain of unk  25.1      34 0.00073   19.0   0.6   12  127-138     3-14  (57)
211 PRK00762 hypA hydrogenase nick  24.6      23 0.00049   22.9  -0.2   14   44-58     69-82  (124)
212 KOG4118|consensus               24.5      46 0.00099   19.0   1.0   22   82-103    39-60  (74)
213 PLN02748 tRNA dimethylallyltra  24.3      55  0.0012   26.4   1.8   24   80-103   417-441 (468)
214 PF13821 DUF4187:  Domain of un  24.3      36 0.00077   18.7   0.6   19  127-145    28-46  (55)
215 PLN03238 probable histone acet  23.8      83  0.0018   23.7   2.6   24  124-147    46-69  (290)
216 smart00731 SprT SprT homologue  23.4      35 0.00076   22.5   0.6   33   45-92    112-144 (146)
217 PF08271 TF_Zn_Ribbon:  TFIIB z  23.2      40 0.00086   17.1   0.6   10  126-135    19-28  (43)
218 PF01215 COX5B:  Cytochrome c o  23.2      30 0.00065   22.9   0.2   16   79-94    110-125 (136)
219 PTZ00448 hypothetical protein;  23.1      63  0.0014   25.2   1.9   23   81-103   314-336 (373)
220 PF14311 DUF4379:  Domain of un  23.1      34 0.00075   18.4   0.4   15   44-58     27-41  (55)
221 smart00659 RPOLCX RNA polymera  23.0      44 0.00095   17.3   0.8   13  127-139     3-15  (44)
222 KOG0782|consensus               22.8      25 0.00054   29.1  -0.3   29  112-140   239-267 (1004)
223 PLN02748 tRNA dimethylallyltra  22.7      55  0.0012   26.4   1.6   23  125-147   417-440 (468)
224 PRK03976 rpl37ae 50S ribosomal  22.6      39 0.00085   20.6   0.6   10  126-135    36-45  (90)
225 COG1579 Zn-ribbon protein, pos  22.4      38 0.00083   24.7   0.6   42   41-94    193-234 (239)
226 TIGR00686 phnA alkylphosphonat  22.4      27 0.00059   22.1  -0.1   16   80-95     18-33  (109)
227 PRK00564 hypA hydrogenase nick  22.2      32  0.0007   22.0   0.2   14   44-57     70-83  (117)
228 PTZ00043 cytochrome c oxidase   22.2      45 0.00097   24.1   0.9   31   78-111   178-208 (268)
229 PF08209 Sgf11:  Sgf11 (transcr  22.2      45 0.00097   16.2   0.6   21  126-147     4-24  (33)
230 TIGR01384 TFS_arch transcripti  22.0      15 0.00033   22.7  -1.4   41   45-93     62-102 (104)
231 PF03966 Trm112p:  Trm112p-like  21.6      34 0.00073   19.4   0.2   18   75-92     47-64  (68)
232 PLN03239 histone acetyltransfe  21.4      61  0.0013   25.1   1.5   24  124-147   104-127 (351)
233 PF03604 DNA_RNApol_7kD:  DNA d  21.2      47   0.001   16.0   0.6   11  126-136    17-27  (32)
234 PF10263 SprT-like:  SprT-like   21.0      24 0.00052   23.4  -0.6   33   44-92    122-154 (157)
235 COG1439 Predicted nucleic acid  20.6      24 0.00051   24.4  -0.7   13   44-56    138-150 (177)
236 KOG0402|consensus               20.3      32 0.00068   20.7  -0.1   10  126-135    36-45  (92)
237 PF02891 zf-MIZ:  MIZ/SP-RING z  20.0      44 0.00094   17.8   0.4    9   81-89     41-49  (50)

No 1  
>KOG2462|consensus
Probab=99.89  E-value=4.5e-24  Score=151.05  Aligned_cols=112  Identities=28%  Similarity=0.339  Sum_probs=96.9

Q ss_pred             CcchhhhhhcccccccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhc
Q psy13210         26 GFSKLKRALDVNQSMIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      .+.++...............+.|..|+++|.+...|..|.        ++|.  -+++|.+||+.|...+-|+-|+++|+
T Consensus       142 T~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHi--------rTH~--l~c~C~iCGKaFSRPWLLQGHiRTHT  211 (279)
T KOG2462|consen  142 TSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHI--------RTHT--LPCECGICGKAFSRPWLLQGHIRTHT  211 (279)
T ss_pred             cccccchhhcccccccccccccCCCCCceeeehHHHhhHh--------hccC--CCcccccccccccchHHhhccccccc
Confidence            3344444444455555567888999999999999999999        9987  67899999999999999999999999


Q ss_pred             CCCCcH-----------HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210        106 GEKPYA-----------HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       106 ~~~~~~-----------~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ||+||.           ++|+.|+.+|.+.++|.|..|+|+|...+.|.+|..
T Consensus       212 GEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  212 GEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             CCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            999997           899999999999999999999999999999999975


No 2  
>KOG2462|consensus
Probab=99.84  E-value=1.4e-21  Score=138.42  Aligned_cols=105  Identities=30%  Similarity=0.529  Sum_probs=92.5

Q ss_pred             ccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCC---CCCcccccccccccccHHHHHHHHhHhcC-------CCCcH
Q psy13210         42 DISADRLERLRTQCATSAELTQHEIRTIESMIRTDP---FRHKFVCYACDYFSYNIGCMRSHIRTHTG-------EKPYA  111 (155)
Q Consensus        42 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~---~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------~~~~~  111 (155)
                      ....+.|+.|++.+.+.++|.+|.        ++|.   ..+.+.|++||+.|.....|.+|+++|+-       -+.|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHk--------Q~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHK--------QTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFS  198 (279)
T ss_pred             cCCceeccccccccccccccchhh--------cccccccccccccCCCCCceeeehHHHhhHhhccCCCccccccccccc
Confidence            346788999999999999999999        8885   47789999999999999999999999982       12222


Q ss_pred             --HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHhhhhCCCCC
Q psy13210        112 --HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQESI  155 (155)
Q Consensus       112 --~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~p  155 (155)
                        =-|.-|+|+|||||||.|+.|+|.|.-.++|+.|++ +|++.|+
T Consensus       199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ-THS~~K~  243 (279)
T KOG2462|consen  199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ-THSDVKK  243 (279)
T ss_pred             chHHhhcccccccCCCCccCCcccchhcchHHHHHHHH-hhcCCcc
Confidence              367889999999999999999999999999999999 8998874


No 3  
>KOG1074|consensus
Probab=99.76  E-value=1.7e-19  Score=143.24  Aligned_cols=58  Identities=17%  Similarity=0.276  Sum_probs=53.5

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCC
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKP  109 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  109 (155)
                      ...+|..|.++|.+.+.|..|.        +.|++++||+|.+||..|.++.+|+.|...|..+.|
T Consensus       352 ~khkCr~CakvfgS~SaLqiHl--------RSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~~p  409 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHL--------RSHTGERPFQCNVCGNRFSTKGNLKVHFQRHREKYP  409 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhh--------hccCCCCCeeecccccccccccceeeeeeeccccCC
Confidence            4567999999999999999999        999999999999999999999999999998876553


No 4  
>KOG3576|consensus
Probab=99.63  E-value=5.4e-17  Score=110.64  Aligned_cols=102  Identities=22%  Similarity=0.296  Sum_probs=82.8

Q ss_pred             ccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcH----------
Q psy13210         42 DISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA----------  111 (155)
Q Consensus        42 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~----------  111 (155)
                      +...+.|..|++.|.....|.+|+        ..|...+.+.|..||+.|.+..+|++|+++|+|.+||+          
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~--------kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHL--------KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHh--------hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            346788999999999999999999        99999999999999999999999999999999888876          


Q ss_pred             -HHHHHHHH-hcc----------CCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210        112 -HIIRNHYR-KHT----------GRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       112 -~~l~~H~~-~h~----------~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                       ..|..|.+ +|.          .++-|.|+.||.+-.....+..|+..+|.
T Consensus       186 rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  186 RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence             34555643 343          23457788888887777777788775543


No 5  
>KOG3623|consensus
Probab=99.61  E-value=2.8e-16  Score=123.81  Aligned_cols=82  Identities=20%  Similarity=0.367  Sum_probs=75.8

Q ss_pred             cccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHh
Q psy13210         41 IDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRK  120 (155)
Q Consensus        41 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~  120 (155)
                      ...+.|-|+.|++.|...+.|.+|.        =.|++.+||+|.+|.+.|+.+..|..|++.|.               
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHK--------YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHS---------------  946 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHK--------YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHS---------------  946 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhh--------hhhcCCCCcccchhhHhhhhhhhhhhhhhhcc---------------
Confidence            3447899999999999999999998        78999999999999999999999888887777               


Q ss_pred             ccCCCCeecCcCcccccCchHHHHHHh
Q psy13210        121 HTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       121 h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                        ||+||.|+.|+|+|+...+..+||.
T Consensus       947 --GEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  947 --GEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             --CCCcchhhhhhhhcccccchHhhhc
Confidence              8888999999999999999999987


No 6  
>KOG1074|consensus
Probab=99.57  E-value=1.2e-15  Score=121.73  Aligned_cols=60  Identities=18%  Similarity=0.274  Sum_probs=54.0

Q ss_pred             cChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCc
Q psy13210         43 ISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPY  110 (155)
Q Consensus        43 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  110 (155)
                      ..+-.|-+|.++..-.+.|+.|.        ++|++++||+|.+||+.|.++.+|+-|+.+|-..-++
T Consensus       603 TdPNqCiiC~rVlSC~saLqmHy--------rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~  662 (958)
T KOG1074|consen  603 TDPNQCIICLRVLSCPSALQMHY--------RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA  662 (958)
T ss_pred             CCccceeeeeecccchhhhhhhh--------hcccCcCccccccccchhccccchhhcccccccCccc
Confidence            35667999999999999999999        9999999999999999999999999999998754333


No 7  
>KOG3623|consensus
Probab=99.40  E-value=1.6e-13  Score=108.59  Aligned_cols=97  Identities=23%  Similarity=0.420  Sum_probs=78.7

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCC-------------CCcH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGE-------------KPYA  111 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------~~~~  111 (155)
                      ...|..|.+.+.....|..|++.      +-...+..|.|..|.++|.+...|.+|+.+|..-             +.|+
T Consensus       210 lltcpycdrgykrltslkeHiky------rhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFK  283 (1007)
T KOG3623|consen  210 LLTCPYCDRGYKRLTSLKEHIKY------RHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFK  283 (1007)
T ss_pred             hhcchhHHHHHHHHHHHHHHHHH------HHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccc
Confidence            44599999999999999999742      2223556789999999999999999999988531             2222


Q ss_pred             -----------HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210        112 -----------HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       112 -----------~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                                 ..|+.|+|+|.||+||.|+-|+|+|+...+...|+.
T Consensus       284 CtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  284 CTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             ccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence                       778999999999999999999999999999988875


No 8  
>KOG3608|consensus
Probab=99.37  E-value=1.4e-12  Score=95.91  Aligned_cols=111  Identities=23%  Similarity=0.439  Sum_probs=79.4

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhh------------------hhhhc-cCCCCCcccccccccccccHHHHHHHHhHh
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTI------------------ESMIR-TDPFRHKFVCYACDYFSYNIGCMRSHIRTH  104 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~------------------~~~~~-~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  104 (155)
                      +.|.|..|.+.|.+...|..|+..++                  ..|++ .|...+||+|+.|++.|.+.+.|.+|...|
T Consensus       236 n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  236 NSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             CchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc
Confidence            45666666666666666666654221                  12224 456788999999999999999999999888


Q ss_pred             cCCCCcH-------------HHHHHHHHh-ccCC--CCeecCcCcccccCchHHHHHHhhhhCCCCC
Q psy13210        105 TGEKPYA-------------HIIRNHYRK-HTGR--KPFKCVVCKQFFATYSGAYQHLRRTHGQESI  155 (155)
Q Consensus       105 ~~~~~~~-------------~~l~~H~~~-h~~~--~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~p  155 (155)
                      . +-.|.             ..+++|++. |.|.  .+|.|..|++.|.+-.+|.+|++..|+-..|
T Consensus       316 S-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~P  381 (467)
T KOG3608|consen  316 S-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRLP  381 (467)
T ss_pred             c-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccCC
Confidence            7 32232             568888765 5454  4699999999999999999999888875443


No 9  
>KOG3608|consensus
Probab=99.36  E-value=1.7e-12  Score=95.39  Aligned_cols=105  Identities=24%  Similarity=0.311  Sum_probs=84.0

Q ss_pred             ccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCC--Cc-------
Q psy13210         40 MIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEK--PY-------  110 (155)
Q Consensus        40 ~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~--~~-------  110 (155)
                      .+..+..-|+.|+.-|++...|-.|...      ++-....+|+|..|.+.|.+...|..|+..|..--  |.       
T Consensus       202 Hs~eKvvACp~Cg~~F~~~tkl~DH~rR------qt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~  275 (467)
T KOG3608|consen  202 HSNEKVVACPHCGELFRTKTKLFDHLRR------QTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSS  275 (467)
T ss_pred             cCCCeEEecchHHHHhccccHHHHHHHh------hhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCC
Confidence            3444667799999999999999999732      34445678999999999999999999998886421  11       


Q ss_pred             HHHHHHHHHh-ccCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210        111 AHIIRNHYRK-HTGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       111 ~~~l~~H~~~-h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .+.|.+|++. |+.++||+|+.|++.|.+.+.|.+|.. .|+
T Consensus       276 ~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~-~HS  316 (467)
T KOG3608|consen  276 ASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ-VHS  316 (467)
T ss_pred             hHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH-hcc
Confidence            2788889887 888899999999999999999999988 776


No 10 
>PHA00733 hypothetical protein
Probab=99.27  E-value=1.2e-11  Score=80.59  Aligned_cols=88  Identities=16%  Similarity=0.244  Sum_probs=70.4

Q ss_pred             ccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhc
Q psy13210         42 DISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKH  121 (155)
Q Consensus        42 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h  121 (155)
                      ....+.|..|...|.....|..+.+  +..++.+ .+.+||+|+.||+.|.....|..|++.|.                
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~--l~~~~~~-~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~----------------   97 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSY--LYKLLTS-KAVSPYVCPLCLMPFSSSVSLKQHIRYTE----------------   97 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHH--HHhhccc-CCCCCccCCCCCCcCCCHHHHHHHHhcCC----------------
Confidence            3467789999999998887777732  2223233 34789999999999999999998887552                


Q ss_pred             cCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210        122 TGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       122 ~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                         .+|.|++|++.|.+...|..|++..|+
T Consensus        98 ---~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         98 ---HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             ---cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence               258999999999999999999997775


No 11 
>KOG3576|consensus
Probab=99.26  E-value=2.3e-12  Score=88.19  Aligned_cols=72  Identities=18%  Similarity=0.257  Sum_probs=60.2

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhH-hcCCCCcH-----------
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRT-HTGEKPYA-----------  111 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~-----------  111 (155)
                      ..+-|..||+.|...-+|.+|+        ++|++.+||+|..|++.|....+|..|.+. |.....|.           
T Consensus       144 kr~lct~cgkgfndtfdlkrh~--------rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vc  215 (267)
T KOG3576|consen  144 KRHLCTFCGKGFNDTFDLKRHT--------RTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVC  215 (267)
T ss_pred             HHHHHhhccCcccchhhhhhhh--------ccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeee
Confidence            5566999999999999999999        999999999999999999999999999875 54333332           


Q ss_pred             ----------HHHHHHHHhccC
Q psy13210        112 ----------HIIRNHYRKHTG  123 (155)
Q Consensus       112 ----------~~l~~H~~~h~~  123 (155)
                                ..+..|++.|..
T Consensus       216 edcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  216 EDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             cccCCCCCChhHHHHHHHhcCC
Confidence                      567778877543


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.12  E-value=5.3e-11  Score=56.01  Aligned_cols=26  Identities=46%  Similarity=0.980  Sum_probs=23.7

Q ss_pred             HHHHHHHhccCCCCeecCcCcccccC
Q psy13210        113 IIRNHYRKHTGRKPFKCVVCKQFFAT  138 (155)
Q Consensus       113 ~l~~H~~~h~~~~~~~C~~C~k~f~~  138 (155)
                      +|.+|+++|+|++||.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999974


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.03  E-value=1.2e-10  Score=63.84  Aligned_cols=44  Identities=20%  Similarity=0.345  Sum_probs=38.8

Q ss_pred             cccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHH
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAY  143 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~  143 (155)
                      -|+|+.||+.|...++|..|+++|+                   ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~-------------------k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN-------------------TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC-------------------CcccCCcccceecccceeE
Confidence            3799999999999999999988875                   3699999999999888774


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=3.5e-10  Score=61.97  Aligned_cols=45  Identities=11%  Similarity=0.050  Sum_probs=40.6

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMR   98 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~   98 (155)
                      -+|.|+.||+.|....+|..|+        ++|.  ++++|..|++.|...+.|.
T Consensus         4 ~~y~C~~CGK~Fs~~~~L~~H~--------r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          4 LGYECPICGEIYIKRKSMITHL--------RKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cccCcchhCCeeccHHHHHHHH--------HhcC--CcccCCcccceecccceeE
Confidence            4689999999999999999999        9998  6899999999999877654


No 15 
>KOG3993|consensus
Probab=98.83  E-value=1e-09  Score=82.55  Aligned_cols=103  Identities=17%  Similarity=0.205  Sum_probs=75.8

Q ss_pred             cChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcC--------CCCcHHH-
Q psy13210         43 ISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTG--------EKPYAHI-  113 (155)
Q Consensus        43 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--------~~~~~~~-  113 (155)
                      .+.|-|..|...|...-.|.+|.        -...-...|+|++|+|+|+-..+|..|++=|..        ..|-+.. 
T Consensus       265 iGdyiCqLCK~kYeD~F~LAQHr--------C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~  336 (500)
T KOG3993|consen  265 IGDYICQLCKEKYEDAFALAQHR--------CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAV  336 (500)
T ss_pred             HHHHHHHHHHHhhhhHHHHhhcc--------CCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhh
Confidence            47888999999999999999996        444444569999999999999999999998852        2221111 


Q ss_pred             ----HHHH-HHh--ccCCCCeecCcCcccccCchHHHHHHhhhhCCC
Q psy13210        114 ----IRNH-YRK--HTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQE  153 (155)
Q Consensus       114 ----l~~H-~~~--h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~  153 (155)
                          +.+- .+.  -..+.-|.|.+|+|.|..+.-|+.|+.++|..+
T Consensus       337 ~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  337 ETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             hhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                0000 000  022346999999999999999999988666544


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.78  E-value=1.3e-08  Score=80.58  Aligned_cols=91  Identities=14%  Similarity=0.156  Sum_probs=71.3

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcH--------------
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA--------------  111 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~--------------  111 (155)
                      +.|+.|+..|. ...|..|+        .++.  +++.|+ ||+.+ ....|..|+.+|.+++++.              
T Consensus       454 ~~C~~Cgk~f~-~s~LekH~--------~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~  520 (567)
T PLN03086        454 VHCEKCGQAFQ-QGEMEKHM--------KVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSA  520 (567)
T ss_pred             ccCCCCCCccc-hHHHHHHH--------HhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccc
Confidence            57999999885 57889998        7663  789999 99765 6689999998888877764              


Q ss_pred             -------HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210        112 -------HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       112 -------~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                             ..|..|..+. |.+++.|..||+.+... .+..|+...|.
T Consensus       521 ~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        521 MDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             cchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhhc
Confidence                   1577888885 88889999999888775 56667765664


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.62  E-value=1.2e-08  Score=47.83  Aligned_cols=26  Identities=27%  Similarity=0.367  Sum_probs=22.9

Q ss_pred             HHhhhHHhhhhhhhccCCCCCccccccccccccc
Q psy13210         60 ELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYN   93 (155)
Q Consensus        60 ~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~   93 (155)
                      +|..|+        ++|++++||+|++|++.|.+
T Consensus         1 ~l~~H~--------~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHM--------RTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHH--------HHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHh--------hhcCCCCCCCCCCCcCeeCc
Confidence            467777        99999999999999999964


No 18 
>PHA00733 hypothetical protein
Probab=98.61  E-value=5.5e-08  Score=63.47  Aligned_cols=54  Identities=22%  Similarity=0.209  Sum_probs=47.5

Q ss_pred             ccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhc
Q psy13210         42 DISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        42 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      ...+|.|+.|++.|.....|..|+        +.+  ..+|.|+.|++.|.....|..|+....
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~--------r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHI--------RYT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHH--------hcC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            356899999999999999999999        765  357999999999999999999988744


No 19 
>PHA00732 hypothetical protein
Probab=98.58  E-value=4.1e-08  Score=58.53  Aligned_cols=44  Identities=30%  Similarity=0.618  Sum_probs=29.6

Q ss_pred             cccccccccccccHHHHHHHHhH-hcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT-HTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ||.|+.||+.|.+..+|..|++. |.                    ++.|+.||+.|.   .|..|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--------------------~~~C~~CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--------------------LTKCPVCNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--------------------CCccCCCCCEeC---Chhhhhc
Confidence            46777777777777777777663 43                    246777777776   3666665


No 20 
>KOG3993|consensus
Probab=98.58  E-value=1e-08  Score=77.34  Aligned_cols=85  Identities=16%  Similarity=0.113  Sum_probs=60.5

Q ss_pred             HHHhhhhhcccCCCcchhhhhhcccccccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccC----------------
Q psy13210         13 RAFYAYEKDAQDGGFSKLKRALDVNQSMIDISADRLERLRTQCATSAELTQHEIRTIESMIRTD----------------   76 (155)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~----------------   76 (155)
                      ..+..+.|..|-..+..-.......-..+..-.|+|..|+++|+-..+|..|.        +.|                
T Consensus       263 n~iGdyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHR--------RWHKPR~eaa~a~~~P~k~  334 (500)
T KOG3993|consen  263 NVIGDYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHR--------RWHKPRPEAAKAGSPPPKQ  334 (500)
T ss_pred             ccHHHHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhh--------cccCCchhhhhcCCCChhh
Confidence            33445555555443322222233334456667899999999999999999998        555                


Q ss_pred             -----------------CCCCcccccccccccccHHHHHHHHhHhc
Q psy13210         77 -----------------PFRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        77 -----------------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                                       ..+..|.|.+|++.|++...|..|+.+|.
T Consensus       335 ~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  335 AVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                             11235899999999999999999998875


No 21 
>PHA00616 hypothetical protein
Probab=98.56  E-value=3.2e-08  Score=51.70  Aligned_cols=29  Identities=17%  Similarity=0.445  Sum_probs=24.9

Q ss_pred             CeecCcCcccccCchHHHHHHhhhhCCCCC
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLRRTHGQESI  155 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~~~H~~~~p  155 (155)
                      ||+|+.||+.|.+.+.|.+|++ .|.+++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r-~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL-SVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH-HhcCCCc
Confidence            6999999999999999999999 4555454


No 22 
>PHA00616 hypothetical protein
Probab=98.51  E-value=5.7e-08  Score=50.77  Aligned_cols=29  Identities=10%  Similarity=0.205  Sum_probs=23.5

Q ss_pred             cccccccccccccHHHHHHHHhHhcCCCC
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHTGEKP  109 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  109 (155)
                      ||+|+.||+.|..++.|..|++.|+++++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc
Confidence            57899999999998888888888875544


No 23 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.35  E-value=1e-06  Score=70.08  Aligned_cols=100  Identities=15%  Similarity=0.274  Sum_probs=72.1

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhh-----------hccCCCCCcccccccccccccHHHHHHHHhHhcCCCCc--
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESM-----------IRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPY--  110 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~-----------~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~--  110 (155)
                      ....|..|..... ...|..|...+...-           .+...-++.+.|+.|++.|. ...|..|+.+|+  .++  
T Consensus       406 ~~V~C~NC~~~i~-l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~C  481 (567)
T PLN03086        406 DTVECRNCKHYIP-SRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQC  481 (567)
T ss_pred             CeEECCCCCCccc-hhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccC
Confidence            4456888876654 457778874333211           11112245678999999996 688999999864  222  


Q ss_pred             -------HHHHHHHHHhccCCCCeecCcCcccccC----------chHHHHHHh
Q psy13210        111 -------AHIIRNHYRKHTGRKPFKCVVCKQFFAT----------YSGAYQHLR  147 (155)
Q Consensus       111 -------~~~l~~H~~~h~~~~~~~C~~C~k~f~~----------~~~L~~H~~  147 (155)
                             ...|..|+.+|.+++++.|.+|++.|..          .+.|..|+.
T Consensus       482 pCg~~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~  535 (567)
T PLN03086        482 PCGVVLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHES  535 (567)
T ss_pred             CCCCCcchhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHH
Confidence                   2789999999999999999999999952          458999988


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.27  E-value=6.6e-07  Score=40.56  Aligned_cols=23  Identities=22%  Similarity=0.504  Sum_probs=20.6

Q ss_pred             ccccccccccccHHHHHHHHhHh
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTH  104 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h  104 (155)
                      |+|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999998875


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.26  E-value=2.1e-06  Score=47.53  Aligned_cols=52  Identities=21%  Similarity=0.494  Sum_probs=39.5

Q ss_pred             cccccccccccccHHHHHHHHhH-hcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT-HTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .|.||+|++ ..+...|..|... |..                ..+.+.|++|...+.  .+|.+|+...|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~----------------~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRS----------------ESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcC----------------CCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            489999999 4556788888665 442                234699999998755  499999997663


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.20  E-value=1.1e-06  Score=39.86  Aligned_cols=22  Identities=36%  Similarity=0.859  Sum_probs=20.9

Q ss_pred             eecCcCcccccCchHHHHHHhh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRR  148 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~  148 (155)
                      |.|+.|++.|.+.+.|.+|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            7899999999999999999984


No 27 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.20  E-value=1.8e-07  Score=68.40  Aligned_cols=70  Identities=19%  Similarity=0.345  Sum_probs=50.5

Q ss_pred             CCCcccccc--cccccccHHHHHHHHhH-hcCCCCcHH-HHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         78 FRHKFVCYA--CDYFSYNIGCMRSHIRT-HTGEKPYAH-IIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        78 ~~~~~~C~~--C~~~f~~~~~l~~H~~~-h~~~~~~~~-~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ++|||+|++  |.+.++....|+-|+.- |...+.... .-..+..--...+||.|++|+|++.+-..|+.|+.
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            359999998  99999999999999875 432221110 00011111336789999999999999999999976


No 28 
>PHA00732 hypothetical protein
Probab=98.15  E-value=9.9e-07  Score=52.60  Aligned_cols=47  Identities=17%  Similarity=0.134  Sum_probs=38.9

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhcc-CCCCCcccccccccccccHHHHHHHHhHhc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRT-DPFRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~-~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      ++.|+.|++.|....+|..|+        +. |.   ++.|+.||+.|.   .+..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~--------r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHA--------RRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHh--------hcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            378999999999999999999        63 54   358999999998   5778876654


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.11  E-value=2.4e-06  Score=38.81  Aligned_cols=24  Identities=38%  Similarity=0.782  Sum_probs=20.1

Q ss_pred             eecCcCcccccCchHHHHHHhhhh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRRTH  150 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~~H  150 (155)
                      |.|++|++.|.+...|..|++.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            789999999999999999999654


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.04  E-value=3.3e-06  Score=39.77  Aligned_cols=25  Identities=32%  Similarity=0.667  Sum_probs=22.7

Q ss_pred             CeecCcCcccccCchHHHHHHhhhh
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLRRTH  150 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~~~H  150 (155)
                      ||.|..|++.|.+...|..|++.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            6899999999999999999999444


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.01  E-value=4.1e-06  Score=51.90  Aligned_cols=66  Identities=23%  Similarity=0.460  Sum_probs=21.6

Q ss_pred             cccccccccccHHHHHHHHhH-hcCCCCcH------HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHhhh
Q psy13210         83 VCYACDYFSYNIGCMRSHIRT-HTGEKPYA------HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRT  149 (155)
Q Consensus        83 ~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~------~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~  149 (155)
                      +|..|+..|.+...|..|+.. |.-..+-.      ..+..+.+.- -...+.|.+|++.|.+...|..|++..
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccccccccccccccccccccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            478888888888888888765 43222211      2222232221 122699999999999999999999943


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.91  E-value=9.9e-06  Score=36.69  Aligned_cols=23  Identities=35%  Similarity=0.592  Sum_probs=18.9

Q ss_pred             ccccccccccccHHHHHHHHhHh
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTH  104 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h  104 (155)
                      |+|++|++.|.+...|..|+..|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            67999999999999999999876


No 33 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.91  E-value=1.4e-05  Score=44.21  Aligned_cols=51  Identities=12%  Similarity=0.116  Sum_probs=39.1

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCC-CCcccccccccccccHHHHHHHHhHhc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPF-RHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~-~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      .|.|+.|++ ..+...|..|..       ..|.. .+.+.||+|...+.  .+|..|+..+.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~-------~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCE-------DEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHH-------hHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            588999999 566789999973       55654 45799999998654  48888887753


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.81  E-value=2.5e-05  Score=41.84  Aligned_cols=33  Identities=18%  Similarity=0.287  Sum_probs=23.8

Q ss_pred             CCCCcccccccccccccHHHHHHHHhHhcCCCC
Q psy13210         77 PFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKP  109 (155)
Q Consensus        77 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  109 (155)
                      .++.|.+|++|+..+....+|.+|+.++.+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            567899999999999999999999988776665


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.74  E-value=1.8e-05  Score=37.14  Aligned_cols=25  Identities=28%  Similarity=0.583  Sum_probs=21.4

Q ss_pred             cccccccccccccHHHHHHHHhHhc
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      ||+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5789999999999999999988764


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.47  E-value=9.8e-05  Score=33.77  Aligned_cols=25  Identities=32%  Similarity=0.745  Sum_probs=22.3

Q ss_pred             eecCcCcccccCchHHHHHHhhhhCC
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRRTHGQ  152 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~~H~~  152 (155)
                      |.|+.|++.|.+.+.|..|++ .|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~-~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR-THXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH-Hhcc
Confidence            679999999999999999999 6653


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.43  E-value=0.00014  Score=33.21  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=20.9

Q ss_pred             ccccccccccccHHHHHHHHhHhc
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999988765


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.25  E-value=0.00036  Score=37.42  Aligned_cols=30  Identities=20%  Similarity=0.424  Sum_probs=21.9

Q ss_pred             CCCCeecCcCcccccCchHHHHHHhhhhCC
Q psy13210        123 GRKPFKCVVCKQFFATYSGAYQHLRRTHGQ  152 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~  152 (155)
                      .+.|-.|++|+..+++..+|++|+...|..
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            567899999999999999999999866653


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.22  E-value=0.00034  Score=31.73  Aligned_cols=24  Identities=33%  Similarity=0.587  Sum_probs=19.5

Q ss_pred             eecCcCcccccCchHHHHHHhhhhC
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      |.|+.|+.... .+.|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999999998 9999999997664


No 40 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.16  E-value=0.00032  Score=43.29  Aligned_cols=58  Identities=16%  Similarity=0.192  Sum_probs=21.6

Q ss_pred             hhhhhhhhccCcHHHhhhHHhhhhhh----------hc--cC---CCCCcccccccccccccHHHHHHHHhHh
Q psy13210         47 RLERLRTQCATSAELTQHEIRTIESM----------IR--TD---PFRHKFVCYACDYFSYNIGCMRSHIRTH  104 (155)
Q Consensus        47 ~c~~C~~~~~~~~~l~~h~~~~~~~~----------~~--~~---~~~~~~~C~~C~~~f~~~~~l~~H~~~h  104 (155)
                      .|..|+..|.+...|..|+.....-.          .+  ..   .-...+.|.+|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            37778888888888888863111100          00  00   0122589999999999999999999974


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.12  E-value=0.00036  Score=31.94  Aligned_cols=21  Identities=38%  Similarity=0.797  Sum_probs=20.1

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      |.|++|++.|.+...|..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            689999999999999999998


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.04  E-value=0.00043  Score=31.65  Aligned_cols=23  Identities=26%  Similarity=0.579  Sum_probs=19.2

Q ss_pred             ccccccccccccHHHHHHHHhHh
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTH  104 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h  104 (155)
                      |.|.+|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56888999999999998888764


No 43 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.96  E-value=0.00017  Score=53.19  Aligned_cols=60  Identities=12%  Similarity=0.128  Sum_probs=46.1

Q ss_pred             cChhhhhh--hhhhccCcHHHhhhHHhhhhhh-----------hccCCCCCcccccccccccccHHHHHHHHh
Q psy13210         43 ISADRLER--LRTQCATSAELTQHEIRTIESM-----------IRTDPFRHKFVCYACDYFSYNIGCMRSHIR  102 (155)
Q Consensus        43 ~~~~~c~~--C~~~~~~~~~l~~h~~~~~~~~-----------~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  102 (155)
                      ..+|+|++  |++.+.....|+-|+.....+.           ...-...|||.|++|++.++....|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            37899976  9999999999999985433222           111134589999999999999999988854


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.90  E-value=0.00093  Score=30.26  Aligned_cols=23  Identities=22%  Similarity=0.673  Sum_probs=17.9

Q ss_pred             ccccccccccccHHHHHHHHhHhc
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      |+|+.|+.... ...|..|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67999999998 889999988854


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.78  E-value=0.0006  Score=31.92  Aligned_cols=21  Identities=29%  Similarity=0.792  Sum_probs=20.1

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      |.|+.|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            789999999999999999987


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.77  E-value=0.00083  Score=45.49  Aligned_cols=27  Identities=22%  Similarity=0.516  Sum_probs=20.5

Q ss_pred             HHHHHHhccCCCCeecCcCcccccCch
Q psy13210        114 IRNHYRKHTGRKPFKCVVCKQFFATYS  140 (155)
Q Consensus       114 l~~H~~~h~~~~~~~C~~C~k~f~~~~  140 (155)
                      +.+|.++|+++++|.|..|+..|....
T Consensus       131 ~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        131 VRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             HHHHHHHhcCCccEECCCCCceeEEec
Confidence            445555566888999999999987654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.46  E-value=0.0013  Score=30.70  Aligned_cols=22  Identities=27%  Similarity=0.699  Sum_probs=18.1

Q ss_pred             ccccccccccccHHHHHHHHhH
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      |-|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5688888888888888888765


No 48 
>KOG1146|consensus
Probab=96.44  E-value=0.00099  Score=57.44  Aligned_cols=96  Identities=20%  Similarity=0.350  Sum_probs=70.0

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhH-hcC-CCCcHHHHHHHHHh--
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRT-HTG-EKPYAHIIRNHYRK--  120 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~-~~~~~~~l~~H~~~--  120 (155)
                      ...|..|+..+...+.+..|++       ..+...+.++|+.|+..|+....|..|++. |.. ...|......|.+.  
T Consensus       436 l~e~~~~e~~~~s~r~~~~~t~-------~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~ar  508 (1406)
T KOG1146|consen  436 LVELTKAEPLLESKRSLEGQTV-------VLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLAR  508 (1406)
T ss_pred             cccccchhhhhhhhccccccee-------eeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccc
Confidence            3446677777777777777763       456667889999999999999999999998 433 22233222223222  


Q ss_pred             ----ccCCCCeecCcCcccccCchHHHHHHh
Q psy13210        121 ----HTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       121 ----h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                          -.+.+||.|..|..+++....|.+|+.
T Consensus       509 g~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  509 GEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccccCCCCcccceeeeeeeecchHHHHHHH
Confidence                124568999999999999999999986


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.23  E-value=0.0045  Score=28.42  Aligned_cols=21  Identities=19%  Similarity=0.278  Sum_probs=16.5

Q ss_pred             ccccccccccccHHHHHHHHhH
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      .+|+.||+.| ..+.|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4699999999 77778888653


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.97  E-value=0.0054  Score=28.13  Aligned_cols=20  Identities=20%  Similarity=0.472  Sum_probs=17.5

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      .+|+.||+.| ..+.|.+|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            5799999999 7788999976


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.74  E-value=0.0076  Score=29.74  Aligned_cols=22  Identities=27%  Similarity=0.560  Sum_probs=20.4

Q ss_pred             CeecCcCcccccCchHHHHHHh
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      +|.|++|++.|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            6899999999999999999976


No 52 
>PRK04860 hypothetical protein; Provisional
Probab=95.69  E-value=0.004  Score=42.22  Aligned_cols=39  Identities=15%  Similarity=0.182  Sum_probs=32.6

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIG   95 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~   95 (155)
                      .|.|. |+.   ....+.+|+        +++.++++|.|..|+..|....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~--------ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHN--------RVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHH--------HHhcCCccEECCCCCceeEEec
Confidence            58897 887   556888998        9999999999999999886543


No 53 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.27  E-value=0.0023  Score=49.19  Aligned_cols=98  Identities=20%  Similarity=0.263  Sum_probs=76.2

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhc--cCCCC--Cccccc--ccccccccHHHHHHHHhHhcCCCCcH-------
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIR--TDPFR--HKFVCY--ACDYFSYNIGCMRSHIRTHTGEKPYA-------  111 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~-------  111 (155)
                      .+.|..|...|.....+..|.        +  .|..+  +++.|+  .|++.|.....+..|...|.+..++.       
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~--------~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  360 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHL--------RSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS  360 (467)
T ss_pred             CCCCccccCCccccccccccc--------cccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCc
Confidence            577999999999999999999        7  79998  999999  79999999999999999998766553       


Q ss_pred             -----------------------------------------HHHHHHHHhccCCC--CeecCcCcccccCchHHHHHHhh
Q psy13210        112 -----------------------------------------HIIRNHYRKHTGRK--PFKCVVCKQFFATYSGAYQHLRR  148 (155)
Q Consensus       112 -----------------------------------------~~l~~H~~~h~~~~--~~~C~~C~k~f~~~~~L~~H~~~  148 (155)
                                                               ..+..|...|...+  .+.+..|.+.|.....+..|++ 
T Consensus       361 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  439 (467)
T COG5048         361 SKFSPLLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKK-  439 (467)
T ss_pred             cccccccCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCccccccccc-
Confidence                                                     11222333343433  3567778888888888888877 


Q ss_pred             hhC
Q psy13210        149 THG  151 (155)
Q Consensus       149 ~H~  151 (155)
                      .|.
T Consensus       440 ~~~  442 (467)
T COG5048         440 IHT  442 (467)
T ss_pred             ccc
Confidence            443


No 54 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.91  E-value=0.015  Score=31.78  Aligned_cols=30  Identities=23%  Similarity=0.595  Sum_probs=26.6

Q ss_pred             cCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210        122 TGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       122 ~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      -||--+.|+-||+.|...-+..+|....|+
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            467779999999999999999999987775


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.70  E-value=0.028  Score=27.63  Aligned_cols=23  Identities=17%  Similarity=0.397  Sum_probs=20.0

Q ss_pred             cccccccccccccHHHHHHHHhH
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      +|.|.+|+..|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            57899999999999999988875


No 56 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.93  E-value=0.037  Score=34.97  Aligned_cols=31  Identities=26%  Similarity=0.595  Sum_probs=24.5

Q ss_pred             cccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCc
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATY  139 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~  139 (155)
                      ...|+.||+.|+..                            +..|..|+.||..|.-.
T Consensus         9 KR~Cp~CG~kFYDL----------------------------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen    9 KRTCPSCGAKFYDL----------------------------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cccCCCCcchhccC----------------------------CCCCccCCCCCCccCcc
Confidence            35799999999654                            34578999999988766


No 57 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.23  E-value=0.47  Score=29.91  Aligned_cols=71  Identities=23%  Similarity=0.424  Sum_probs=45.1

Q ss_pred             CcccccccccccccHHHHHHHHhH-hcCCCCcH-HHHHHHHHhcc--------------CCC---------Ceec----C
Q psy13210         80 HKFVCYACDYFSYNIGCMRSHIRT-HTGEKPYA-HIIRNHYRKHT--------------GRK---------PFKC----V  130 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~-~~l~~H~~~h~--------------~~~---------~~~C----~  130 (155)
                      +...|..|+..... +.+..|++. |....... ..+..-.+...              +..         -|.|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            45679999887766 888888884 43222221 11111111100              011         1889    9


Q ss_pred             cCcccccCchHHHHHHhhhhC
Q psy13210        131 VCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       131 ~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .|++...+...+.+|++..|+
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999997774


No 58 
>KOG2893|consensus
Probab=92.57  E-value=0.025  Score=40.48  Aligned_cols=45  Identities=18%  Similarity=0.297  Sum_probs=36.1

Q ss_pred             hhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHH-HhHh
Q psy13210         48 LERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSH-IRTH  104 (155)
Q Consensus        48 c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H-~~~h  104 (155)
                      |..|++.|....-|.+|+        ++    |-|+|.+|-+...+.-.|..| +.+|
T Consensus        13 cwycnrefddekiliqhq--------ka----khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQ--------KA----KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhh--------hh----ccceeeeehhhhccCCCceeehhhhh
Confidence            889999999999999999        33    459999999887777666655 4444


No 59 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=92.13  E-value=0.076  Score=26.57  Aligned_cols=34  Identities=15%  Similarity=0.263  Sum_probs=24.6

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      ..|+.|+..|.-..+             .+.......+|+.|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~-------------~ip~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDE-------------KIPPKGRKVRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHH-------------HCCCCCcEEECCCCCCEeC
Confidence            458888888876544             4455566789999998873


No 60 
>KOG2893|consensus
Probab=92.06  E-value=0.048  Score=39.08  Aligned_cols=51  Identities=20%  Similarity=0.434  Sum_probs=41.6

Q ss_pred             CCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHHHHHhhhhC
Q psy13210         79 RHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .|+| |=+|++.|.+..-|..|++.-.                     |+|.+|.|..-+--.|..|--++|.
T Consensus         9 ~kpw-cwycnrefddekiliqhqkakh---------------------fkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKAKH---------------------FKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhhcc---------------------ceeeeehhhhccCCCceeehhhhhh
Confidence            3566 7889999999999998877543                     8999999998888888888655664


No 61 
>KOG2231|consensus
Probab=91.74  E-value=0.2  Score=41.23  Aligned_cols=95  Identities=16%  Similarity=0.044  Sum_probs=49.8

Q ss_pred             HHHHhHHHhhhhhcccCCCc------------chhhhhhcccccc-cccChhhhhhhh---------hhccCcHHHhhhH
Q psy13210          8 FHQLCRAFYAYEKDAQDGGF------------SKLKRALDVNQSM-IDISADRLERLR---------TQCATSAELTQHE   65 (155)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~-~~~~~~~c~~C~---------~~~~~~~~l~~h~   65 (155)
                      ....+.++....|..++..+            ..+.....+..++ ..+..+.|..|-         ....+...|..|+
T Consensus        90 ~y~~~~~~~~~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~  169 (669)
T KOG2231|consen   90 TYTKLEACLHHSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHL  169 (669)
T ss_pred             HHHHHHHHHhhhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHH
Confidence            34555566667777776655            1233333444443 444555665541         2223445566665


Q ss_pred             HhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhc
Q psy13210         66 IRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      .....+ .+.+.+ . -.|..|...|-....|.+|++.+.
T Consensus       170 ~~gd~d-~~s~rG-h-p~C~~C~~~fld~~el~rH~~~~h  206 (669)
T KOG2231|consen  170 MFGDPD-DESCRG-H-PLCKFCHERFLDDDELYRHLRFDH  206 (669)
T ss_pred             hcCCCc-cccccC-C-ccchhhhhhhccHHHHHHhhccce
Confidence            222110 011111 1 258888888888888888887643


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.61  E-value=0.047  Score=41.95  Aligned_cols=57  Identities=25%  Similarity=0.502  Sum_probs=47.4

Q ss_pred             CcccccccccccccHHHHHHHHh--HhcCCCCcHHHHHHHHHhccCC--CCeecC--cCcccccCchHHHHHHhhhhCCC
Q psy13210         80 HKFVCYACDYFSYNIGCMRSHIR--THTGEKPYAHIIRNHYRKHTGR--KPFKCV--VCKQFFATYSGAYQHLRRTHGQE  153 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~~~~~~~l~~H~~~h~~~--~~~~C~--~C~k~f~~~~~L~~H~~~~H~~~  153 (155)
                      .++.|..|...|.....|..|.+  .|.                 ++  +|+.|+  .|++.|.+...+.+|.. .|.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~-----------------~~~~~~~~~p~~~~~~~~~~~~~~~~~~~-~~~~~  349 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHS-----------------GESLKPFSCPYSLCGKLFSRNDALKRHIL-LHTSI  349 (467)
T ss_pred             cCCCCccccCCccccccccccccccccc-----------------cccCCceeeeccCCCccccccccccCCcc-cccCC
Confidence            46789999999999998888877  455                 67  789999  79999999999999998 66654


Q ss_pred             C
Q psy13210        154 S  154 (155)
Q Consensus       154 ~  154 (155)
                      +
T Consensus       350 ~  350 (467)
T COG5048         350 S  350 (467)
T ss_pred             C
Confidence            3


No 63 
>KOG1146|consensus
Probab=91.56  E-value=0.03  Score=48.83  Aligned_cols=98  Identities=10%  Similarity=0.135  Sum_probs=66.6

Q ss_pred             ccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcH--HHHHHHHH
Q psy13210         42 DISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA--HIIRNHYR  119 (155)
Q Consensus        42 ~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~--~~l~~H~~  119 (155)
                      ..+.+.|..|...+...-.+. +.           ....+|.|..|.-.|.....|..|.+.-.  +.+.  .....+..
T Consensus      1257 ~sGe~~c~~~~~~~~~~~~~~-~l-----------~~~~~~~~~~~~~~~~~~~~l~~~~~k~~--~~~~~~~~~~~~~l 1322 (1406)
T KOG1146|consen 1257 ASGEGECGAVDELLTPSFGIS-TL-----------DVTHRYLCRQCKMAFDGEAPLTAHQRKFC--FAGRGSGGSMPPPL 1322 (1406)
T ss_pred             CCCcchhhhccccccCcccee-ec-----------ccchhHHHHHHHhhhcchhHHHHHHHHHH--hccCccccCCCCcc
Confidence            346677888888777655544 43           22356889999999999988888873211  0000  22233344


Q ss_pred             hccCCCCeecCcCcccccCchHHHHHHhhhhCCCC
Q psy13210        120 KHTGRKPFKCVVCKQFFATYSGAYQHLRRTHGQES  154 (155)
Q Consensus       120 ~h~~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~~~  154 (155)
                      .+..-.+| |..|...|+....|..|++..+...|
T Consensus      1323 ~~~d~~~~-c~~c~~~~~~~~alqihm~~~~~~~k 1356 (1406)
T KOG1146|consen 1323 RVPDCTYH-CLACEVLLSGREALQIHMRSSAHRRK 1356 (1406)
T ss_pred             cCcccccc-chHHHhhcchhHHHHHHHHHhhhccc
Confidence            45555667 99999999999999999998776654


No 64 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=91.43  E-value=0.22  Score=25.95  Aligned_cols=28  Identities=29%  Similarity=0.549  Sum_probs=19.3

Q ss_pred             CCCCeecCcCcccccC----chHHHHHHhhhh
Q psy13210        123 GRKPFKCVVCKQFFAT----YSGAYQHLRRTH  150 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~----~~~L~~H~~~~H  150 (155)
                      ++....|.+|++.+..    .+.|.+|++..|
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            4556789999998876    489999996455


No 65 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.26  E-value=0.11  Score=25.41  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=8.5

Q ss_pred             CCeecCcCccc
Q psy13210        125 KPFKCVVCKQF  135 (155)
Q Consensus       125 ~~~~C~~C~k~  135 (155)
                      .++.|++||..
T Consensus        16 ~~~~CP~Cg~~   26 (33)
T cd00350          16 APWVCPVCGAP   26 (33)
T ss_pred             CCCcCcCCCCc
Confidence            46899999863


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.05  E-value=0.14  Score=28.09  Aligned_cols=29  Identities=10%  Similarity=0.075  Sum_probs=20.3

Q ss_pred             cCCCCCcccccccccccccHHHHHHHHhH
Q psy13210         75 TDPFRHKFVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        75 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      +..++.-+.||-||..|....+..+|...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            34456667777777777777777777664


No 67 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.09  E-value=0.21  Score=32.29  Aligned_cols=34  Identities=18%  Similarity=0.256  Sum_probs=25.1

Q ss_pred             cccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHH
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGA  142 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L  142 (155)
                      ...|+.||+.|+..                            +..|..|+.||..|.-...+
T Consensus         9 Kr~Cp~cg~kFYDL----------------------------nk~p~vcP~cg~~~~~~~~~   42 (129)
T TIGR02300         9 KRICPNTGSKFYDL----------------------------NRRPAVSPYTGEQFPPEEAL   42 (129)
T ss_pred             cccCCCcCcccccc----------------------------CCCCccCCCcCCccCcchhh
Confidence            35799999998653                            34578999999988665333


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.00  E-value=0.13  Score=25.79  Aligned_cols=34  Identities=15%  Similarity=0.148  Sum_probs=22.4

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      +.|+.|+..|.-..+             ..........|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~-------------~~~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDS-------------QLGANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHH-------------HcCCCCCEEECCCCCCEEE
Confidence            468889888876544             2222223578999998774


No 69 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.95  E-value=0.15  Score=25.60  Aligned_cols=34  Identities=12%  Similarity=0.093  Sum_probs=23.9

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      ..|+.|+..|.-..+             +........+|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~-------------~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-------------KLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH-------------HcccCCcEEECCCCCcEee
Confidence            358888888876543             3444556778999998874


No 70 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=89.84  E-value=0.19  Score=34.25  Aligned_cols=26  Identities=31%  Similarity=0.793  Sum_probs=20.6

Q ss_pred             CCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcc
Q psy13210         79 RHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQ  134 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k  134 (155)
                      .+.|.|++||.++                              .|+.|-+||+||-
T Consensus       132 ~~~~vC~vCGy~~------------------------------~ge~P~~CPiCga  157 (166)
T COG1592         132 GKVWVCPVCGYTH------------------------------EGEAPEVCPICGA  157 (166)
T ss_pred             CCEEEcCCCCCcc------------------------------cCCCCCcCCCCCC
Confidence            3479999999853                              2677899999994


No 71 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=89.41  E-value=0.35  Score=25.92  Aligned_cols=26  Identities=35%  Similarity=0.556  Sum_probs=20.7

Q ss_pred             CeecCcCcccccCc-----hHHHHHHhhhhC
Q psy13210        126 PFKCVVCKQFFATY-----SGAYQHLRRTHG  151 (155)
Q Consensus       126 ~~~C~~C~k~f~~~-----~~L~~H~~~~H~  151 (155)
                      .-.|..|++.++..     +.|.+|++..|.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            35699999988765     799999985554


No 72 
>KOG4173|consensus
Probab=89.40  E-value=0.39  Score=33.78  Aligned_cols=90  Identities=17%  Similarity=0.128  Sum_probs=61.1

Q ss_pred             Chhhhhh--hhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhc
Q psy13210         44 SADRLER--LRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKH  121 (155)
Q Consensus        44 ~~~~c~~--C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h  121 (155)
                      ..+-|+.  |...|...-++..|-        .+..+   -.|..|.+.|.+..-|..|+..-.       ....-..+-
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY--------~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~H-------Ds~Fqa~ve  139 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHY--------HTLHG---NSCSFCKRAFPTGHLLDAHILEWH-------DSLFQALVE  139 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhh--------hhccc---chhHHHHHhCCchhhhhHHHHHHH-------HHHHHHHHH
Confidence            4566765  777777666666665        32222   259999999999999998877522       111223334


Q ss_pred             cCCCCeecC--cCcccccCchHHHHHHhhhhC
Q psy13210        122 TGRKPFKCV--VCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       122 ~~~~~~~C~--~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .|..-|.|-  .|+..|.+.-....|+-..|.
T Consensus       140 RG~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  140 RGQDMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             cCccHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            455568895  499999999999888876664


No 73 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=88.63  E-value=0.32  Score=31.87  Aligned_cols=23  Identities=39%  Similarity=0.723  Sum_probs=15.2

Q ss_pred             CeecCcCcccccCchHHHHHHhhhhC
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      ...|-+||+.|..   |.+|++.+|+
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~g   94 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHG   94 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-
T ss_pred             eeEEccCCcccch---HHHHHHHccC
Confidence            4789999999988   6999995545


No 74 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.33  E-value=0.26  Score=25.98  Aligned_cols=30  Identities=13%  Similarity=0.254  Sum_probs=20.3

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      .|+|..||..+....                  ......|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~------------------~~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDE------------------YGTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECC------------------CCCceECCCCCCeEE
Confidence            478899998775432                  112578999997654


No 75 
>KOG2482|consensus
Probab=86.64  E-value=0.53  Score=35.68  Aligned_cols=70  Identities=16%  Similarity=0.399  Sum_probs=48.8

Q ss_pred             ccccccccccccHHHHHHHHhH--hcCCCCcH----------------------HHHHHHHH-hc------------cCC
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRT--HTGEKPYA----------------------HIIRNHYR-KH------------TGR  124 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~--h~~~~~~~----------------------~~l~~H~~-~h------------~~~  124 (155)
                      +.|-.|.+.|+++..|..||+.  |-...|-.                      +.+.+-.. .+            .+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a  275 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDA  275 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCC
Confidence            7899999999999999999986  54433321                      12211000 00            012


Q ss_pred             CC--eecCcCcccccCchHHHHHHhhhhC
Q psy13210        125 KP--FKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       125 ~~--~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      .+  ..|-+|.....+...|..|+..+|.
T Consensus       276 ~a~~v~CLfC~~~~en~~~l~eHmk~vHe  304 (423)
T KOG2482|consen  276 EALSVVCLFCTNFYENPVFLFEHMKIVHE  304 (423)
T ss_pred             CccceEEEeeccchhhHHHHHHHHHHHHH
Confidence            23  6899999999999999999998874


No 76 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=85.29  E-value=0.57  Score=35.59  Aligned_cols=40  Identities=25%  Similarity=0.486  Sum_probs=23.8

Q ss_pred             HHHHHHHHhccCCCCe----ecCcCcccccCchHHHHHHhhhhC
Q psy13210        112 HIIRNHYRKHTGRKPF----KCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       112 ~~l~~H~~~h~~~~~~----~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      ..|..|......+.-|    .|.+|...|-....|.+|.|..|.
T Consensus       202 ~~Lr~H~~~G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~HE  245 (493)
T COG5236         202 STLRDHKNGGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHE  245 (493)
T ss_pred             ccccccccCCccccCcCCCchhhhccceecChHHHHHHHHhhhh
Confidence            4455555543322122    377777777777777777775553


No 77 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=84.68  E-value=0.44  Score=33.91  Aligned_cols=30  Identities=17%  Similarity=0.461  Sum_probs=23.7

Q ss_pred             CCCCeecCcCcccccCchHHHHHHhhhhCC
Q psy13210        123 GRKPFKCVVCKQFFATYSGAYQHLRRTHGQ  152 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~  152 (155)
                      ++..|.|+.|+|.|.-..-..+|+...|.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            455799999999999999999999988864


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=83.66  E-value=0.84  Score=30.48  Aligned_cols=23  Identities=9%  Similarity=0.173  Sum_probs=16.5

Q ss_pred             ccCCCCCcccccccccccccHHH
Q psy13210         74 RTDPFRHKFVCYACDYFSYNIGC   96 (155)
Q Consensus        74 ~~~~~~~~~~C~~C~~~f~~~~~   96 (155)
                      +.-.+...|.|+.|+..|.....
T Consensus        92 ~~e~~~~~Y~Cp~C~~~y~~~ea  114 (147)
T smart00531       92 EDETNNAYYKCPNCQSKYTFLEA  114 (147)
T ss_pred             hcccCCcEEECcCCCCEeeHHHH
Confidence            34455677999999998875543


No 79 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.20  E-value=1.1  Score=20.62  Aligned_cols=20  Identities=25%  Similarity=0.371  Sum_probs=16.4

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ..|++|++.+ ....+..|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            4699999998 6678888876


No 80 
>PHA00626 hypothetical protein
Probab=82.83  E-value=0.56  Score=25.76  Aligned_cols=17  Identities=24%  Similarity=0.634  Sum_probs=13.2

Q ss_pred             CCcccccccccccccHH
Q psy13210         79 RHKFVCYACDYFSYNIG   95 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~~   95 (155)
                      ...|+|+.||+.|....
T Consensus        21 snrYkCkdCGY~ft~~~   37 (59)
T PHA00626         21 SDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CcceEcCCCCCeechhh
Confidence            36799999999886554


No 81 
>KOG2186|consensus
Probab=82.11  E-value=0.86  Score=33.09  Aligned_cols=48  Identities=10%  Similarity=0.091  Sum_probs=34.4

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHHHhH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      .|.|..||....- ..+..|+        -..++ .-|.|-.||+.|.. .+...|..-
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~--------srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHM--------SRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhccc-cchHHHH--------HhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            3679999987654 4677787        33333 67899999999988 666666553


No 82 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.09  E-value=0.19  Score=26.03  Aligned_cols=30  Identities=13%  Similarity=0.176  Sum_probs=20.0

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDY   89 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~   89 (155)
                      .|+|..||..|.....              ... ..+..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~--------------~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS--------------ISE-DDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEE--------------cCC-CCCCcCCCCCC
Confidence            5789999988865422              111 35567999987


No 83 
>KOG2482|consensus
Probab=81.90  E-value=3.6  Score=31.37  Aligned_cols=65  Identities=17%  Similarity=0.436  Sum_probs=47.0

Q ss_pred             cccccccccccccH-HHHHHHHhH-hc------CCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         81 KFVCYACDYFSYNI-GCMRSHIRT-HT------GEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        81 ~~~C~~C~~~f~~~-~~l~~H~~~-h~------~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ..+|-.|+..+.-. +....|+.. |.      .+-.|...|..|+..-..  .+.|-+|.|.|+.+..|..|||
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~--r~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLE--RLRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHh--hheeeeeccccCCcHHHHHHHH
Confidence            45799999866544 556666654 42      133455778887765333  3899999999999999999998


No 84 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=81.73  E-value=0.5  Score=26.30  Aligned_cols=34  Identities=6%  Similarity=0.088  Sum_probs=20.7

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYF   90 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~   90 (155)
                      -.|.|+.||...-....             +......+|.|+.||..
T Consensus        26 v~F~CPnCGe~~I~Rc~-------------~CRk~g~~Y~Cp~CGF~   59 (61)
T COG2888          26 VKFPCPNCGEVEIYRCA-------------KCRKLGNPYRCPKCGFE   59 (61)
T ss_pred             eEeeCCCCCceeeehhh-------------hHHHcCCceECCCcCcc
Confidence            35778888854433222             22233478999999863


No 85 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=81.54  E-value=1.2  Score=30.16  Aligned_cols=38  Identities=16%  Similarity=0.199  Sum_probs=28.5

Q ss_pred             ccCCCCCcccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCccccc
Q psy13210         74 RTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFA  137 (155)
Q Consensus        74 ~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~  137 (155)
                      ....+..-|.|+.|+..|+....+..                          -|.|+.||....
T Consensus       102 ~~e~~~~~Y~Cp~c~~r~tf~eA~~~--------------------------~F~Cp~Cg~~L~  139 (158)
T TIGR00373       102 EFETNNMFFICPNMCVRFTFNEAMEL--------------------------NFTCPRCGAMLD  139 (158)
T ss_pred             hhccCCCeEECCCCCcEeeHHHHHHc--------------------------CCcCCCCCCEee
Confidence            44456677999999999888877641                          299999997543


No 86 
>KOG2071|consensus
Probab=81.04  E-value=0.87  Score=36.96  Aligned_cols=28  Identities=14%  Similarity=0.153  Sum_probs=19.3

Q ss_pred             CCCcccccccccccccHHHHHHHHhHhc
Q psy13210         78 FRHKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        78 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      ...+.+|..||..|.+......||..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3456677778887777776666666654


No 87 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=79.83  E-value=0.67  Score=24.92  Aligned_cols=30  Identities=10%  Similarity=0.068  Sum_probs=19.6

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDY   89 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~   89 (155)
                      .|+|..|+..|.....              ... ..+-.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~--------------~~~-~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQK--------------MSD-DPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEe--------------cCC-CCCCCCCCCCC
Confidence            5789999988865321              111 34457999986


No 88 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.32  E-value=1.1  Score=28.24  Aligned_cols=16  Identities=13%  Similarity=0.252  Sum_probs=12.6

Q ss_pred             CCCCeecCcCcccccC
Q psy13210        123 GRKPFKCVVCKQFFAT  138 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~  138 (155)
                      +..|..|++||++|..
T Consensus        23 NrdPiVsPytG~s~P~   38 (129)
T COG4530          23 NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             CCCccccCcccccchH
Confidence            4457999999999843


No 89 
>KOG2231|consensus
Probab=79.18  E-value=2.4  Score=35.25  Aligned_cols=15  Identities=27%  Similarity=0.696  Sum_probs=8.1

Q ss_pred             ccCchHHHHHHhhhh
Q psy13210        136 FATYSGAYQHLRRTH  150 (155)
Q Consensus       136 f~~~~~L~~H~~~~H  150 (155)
                      |.....|..|-|..|
T Consensus       222 y~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  222 YNDYDDLEEHFRKGH  236 (669)
T ss_pred             cccchHHHHHhhhcC
Confidence            555555666655444


No 90 
>KOG4167|consensus
Probab=78.99  E-value=0.51  Score=39.25  Aligned_cols=26  Identities=27%  Similarity=0.594  Sum_probs=23.7

Q ss_pred             CcccccccccccccHHHHHHHHhHhc
Q psy13210         80 HKFVCYACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      ..|.|.+|++.|....+++.||++|.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            34999999999999999999999985


No 91 
>KOG2785|consensus
Probab=78.93  E-value=3.9  Score=31.58  Aligned_cols=65  Identities=22%  Similarity=0.429  Sum_probs=46.5

Q ss_pred             ccccccccccccHHHHHHHHhHhcC----CCCcH---HHHHHHHHhccCCCCeecCcCc---ccccCchHHHHHHh
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTHTG----EKPYA---HIIRNHYRKHTGRKPFKCVVCK---QFFATYSGAYQHLR  147 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h~~----~~~~~---~~l~~H~~~h~~~~~~~C~~C~---k~f~~~~~L~~H~~  147 (155)
                      -.|-.|++.+.+...-..||..+.|    ++-|.   ..|..-+..-.+ .-+.|-+|.   +.|.+-.+.+.||+
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~-~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVG-IGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhc-cCceEEEeccccCcccccHHHHHHHh
Confidence            5689999999999999999998765    23332   233333322111 237888888   99999999999987


No 92 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=78.14  E-value=1.9  Score=32.85  Aligned_cols=65  Identities=25%  Similarity=0.546  Sum_probs=43.8

Q ss_pred             cccccccccccHHHHHHHHhHhcCC-------CCc--H-----HHHHHHHHhccCCCCeecCc--C--c--ccccCchHH
Q psy13210         83 VCYACDYFSYNIGCMRSHIRTHTGE-------KPY--A-----HIIRNHYRKHTGRKPFKCVV--C--K--QFFATYSGA  142 (155)
Q Consensus        83 ~C~~C~~~f~~~~~l~~H~~~h~~~-------~~~--~-----~~l~~H~~~h~~~~~~~C~~--C--~--k~f~~~~~L  142 (155)
                      .|..|...|.+...|..|++.....       .|.  .     ..|..|.+    .--|.|.+  |  +  ..|.....|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~----~~hy~ct~qtc~~~k~~vf~~~~el  297 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFR----NAHYCCTFQTCRVGKCYVFPYHTEL  297 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhh----cCceEEEEEEEecCcEEEeccHHHH
Confidence            5999999999999999998863311       111  1     45555544    33366644  3  2  258888899


Q ss_pred             HHHHhhhhC
Q psy13210        143 YQHLRRTHG  151 (155)
Q Consensus       143 ~~H~~~~H~  151 (155)
                      ..|+-+.|+
T Consensus       298 ~~h~~~~h~  306 (493)
T COG5236         298 LEHLTRFHK  306 (493)
T ss_pred             HHHHHHHhh
Confidence            999877776


No 93 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=77.87  E-value=1  Score=25.09  Aligned_cols=34  Identities=9%  Similarity=0.112  Sum_probs=20.0

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYF   90 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~   90 (155)
                      ..|.|+.||...-..-.             +-.....+|.|+.||..
T Consensus        24 ~~F~CPnCG~~~I~RC~-------------~CRk~~~~Y~CP~CGF~   57 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCE-------------KCRKQSNPYTCPKCGFE   57 (59)
T ss_pred             CEeeCCCCCCeeEeech-------------hHHhcCCceECCCCCCc
Confidence            45778888865222111             22223368999999863


No 94 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=77.64  E-value=2  Score=32.87  Aligned_cols=24  Identities=8%  Similarity=-0.063  Sum_probs=19.6

Q ss_pred             cChhhhhhhhhhccCcHHHhhhHH
Q psy13210         43 ISADRLERLRTQCATSAELTQHEI   66 (155)
Q Consensus        43 ~~~~~c~~C~~~~~~~~~l~~h~~   66 (155)
                      ...+.|..|++.|....-+..|..
T Consensus       236 ~~~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         236 FPKVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ccceeeHhhhhHhhhhHHHHHHHh
Confidence            356779999999999888888863


No 95 
>KOG2593|consensus
Probab=77.34  E-value=2.5  Score=33.09  Aligned_cols=34  Identities=18%  Similarity=0.355  Sum_probs=25.7

Q ss_pred             HHhhhhhhhccCCCCCcccccccccccccHHHHH
Q psy13210         65 EIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMR   98 (155)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~   98 (155)
                      |++-+++-++-.....-|.|+.|.+.|.....+.
T Consensus       112 m~krled~~~d~t~~~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  112 MRKRLEDRLRDDTNVAGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             HHHHHHHHhhhccccccccCCccccchhhhHHHH
Confidence            4555566666677788899999999998776654


No 96 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.25  E-value=1.9  Score=29.88  Aligned_cols=23  Identities=17%  Similarity=0.151  Sum_probs=17.0

Q ss_pred             cCCCCCcccccccccccccHHHH
Q psy13210         75 TDPFRHKFVCYACDYFSYNIGCM   97 (155)
Q Consensus        75 ~~~~~~~~~C~~C~~~f~~~~~l   97 (155)
                      .-.+..-|.|+.|+..|.....+
T Consensus       111 ~e~~~~~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        111 EEENNMFFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             hccCCCEEECCCCCcEEeHHHHh
Confidence            33455678999999988777664


No 97 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=74.07  E-value=1.7  Score=20.00  Aligned_cols=10  Identities=30%  Similarity=0.570  Sum_probs=8.2

Q ss_pred             cccccccccc
Q psy13210         83 VCYACDYFSY   92 (155)
Q Consensus        83 ~C~~C~~~f~   92 (155)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5899998885


No 98 
>KOG2186|consensus
Probab=73.48  E-value=2.3  Score=30.94  Aligned_cols=47  Identities=19%  Similarity=0.404  Sum_probs=33.5

Q ss_pred             cccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      -|.|..||-...-+ .+.+|+..-.                 + .-|.|..|++.|.. .+...|..
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCr-----------------n-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCR-----------------N-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhcc-----------------C-CeeEEeeccccccc-chhhhhhh
Confidence            37899999876544 3555766544                 3 34999999999988 66666754


No 99 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=73.06  E-value=1.6  Score=19.70  Aligned_cols=11  Identities=27%  Similarity=0.812  Sum_probs=8.3

Q ss_pred             CCccccccccc
Q psy13210         79 RHKFVCYACDY   89 (155)
Q Consensus        79 ~~~~~C~~C~~   89 (155)
                      ..+|.|+.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            35788999984


No 100
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=71.61  E-value=3.7  Score=25.74  Aligned_cols=24  Identities=29%  Similarity=0.642  Sum_probs=18.2

Q ss_pred             ccc----cccccccccHHHHHHHHhHhc
Q psy13210         82 FVC----YACDYFSYNIGCMRSHIRTHT  105 (155)
Q Consensus        82 ~~C----~~C~~~f~~~~~l~~H~~~h~  105 (155)
                      |.|    +.|++.+.+...|.+|.+.+.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            677    778888888888888877643


No 101
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=70.97  E-value=2.8  Score=29.93  Aligned_cols=29  Identities=24%  Similarity=0.351  Sum_probs=21.9

Q ss_pred             CCCCcccccccccccccHHHHHHHHhH-hc
Q psy13210         77 PFRHKFVCYACDYFSYNIGCMRSHIRT-HT  105 (155)
Q Consensus        77 ~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~  105 (155)
                      ..+..|.|++|+|.|.-..-+.+|+.. |.
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            355679999999999999999999876 54


No 102
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=70.93  E-value=2.5  Score=27.74  Aligned_cols=22  Identities=23%  Similarity=0.368  Sum_probs=18.0

Q ss_pred             eecCcCcccccCchHHHHHHhhhhC
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      +.|-++||.|.+   |++|+.++++
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccC
Confidence            679999999986   9999994443


No 103
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=70.48  E-value=0.96  Score=33.91  Aligned_cols=49  Identities=12%  Similarity=0.020  Sum_probs=23.2

Q ss_pred             HhhhhhcccCCCcchhhhhhcccccccccChhhhhhhhhhccCcHHHhhhH
Q psy13210         15 FYAYEKDAQDGGFSKLKRALDVNQSMIDISADRLERLRTQCATSAELTQHE   65 (155)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~   65 (155)
                      ++...|-.+++.|+......  .........|.|..|...|-..-+.-.|.
T Consensus       360 ~ks~~Cf~CQ~~fp~~~~~~--~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe  408 (421)
T COG5151         360 PKSTHCFVCQGPFPKPPVSP--FDESTSSGRYQCELCKSTFCSDCDVFIHE  408 (421)
T ss_pred             CCCccceeccCCCCCCCCCc--ccccccccceechhhhhhhhhhhHHHHHH
Confidence            33444555555553322221  12223334566666666666655555554


No 104
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=69.89  E-value=0.52  Score=39.58  Aligned_cols=45  Identities=24%  Similarity=0.428  Sum_probs=27.8

Q ss_pred             cccccccccccH---HHHHHHHhHhcCCCCcHHHHHHHHHhccCCCCeecCcCccc
Q psy13210         83 VCYACDYFSYNI---GCMRSHIRTHTGEKPYAHIIRNHYRKHTGRKPFKCVVCKQF  135 (155)
Q Consensus        83 ~C~~C~~~f~~~---~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~  135 (155)
                      .|..||..+.-+   ..|..|+..+.        |..|.--+....|..|+.||-.
T Consensus       437 ~C~~Cg~v~~Cp~Cd~~lt~H~~~~~--------L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         437 LCRDCGYIAECPNCDSPLTLHKATGQ--------LRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             ecccCCCcccCCCCCcceEEecCCCe--------eEeCCCCCCCCCCCCCCCCCCC
Confidence            466666666554   34555544432        5555555556778999999854


No 105
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=67.56  E-value=2.3  Score=26.45  Aligned_cols=16  Identities=13%  Similarity=0.046  Sum_probs=11.0

Q ss_pred             hhhhhhhhhccCcHHH
Q psy13210         46 DRLERLRTQCATSAEL   61 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l   61 (155)
                      ..|..||..|..-+..
T Consensus         3 H~CtrCG~vf~~g~~~   18 (112)
T COG3364           3 HQCTRCGEVFDDGSEE   18 (112)
T ss_pred             ceecccccccccccHH
Confidence            4688888888775443


No 106
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=65.13  E-value=2.5  Score=21.50  Aligned_cols=32  Identities=19%  Similarity=0.242  Sum_probs=15.4

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccccc
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFS   91 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f   91 (155)
                      .+|..|+.-..-..              ....+.+.++|.+|+..-
T Consensus         3 ~rC~~C~aylNp~~--------------~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    3 VRCRRCRAYLNPFC--------------QFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             -B-TTT--BS-TTS--------------EEETTTTEEEETTT--EE
T ss_pred             cccCCCCCEECCcc--------------eEcCCCCEEECcCCCCcC
Confidence            46777765544332              334455779999998753


No 107
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=64.53  E-value=5.3  Score=20.11  Aligned_cols=23  Identities=30%  Similarity=0.514  Sum_probs=9.4

Q ss_pred             CCeecCcCcccccCch--HHHHHHh
Q psy13210        125 KPFKCVVCKQFFATYS--GAYQHLR  147 (155)
Q Consensus       125 ~~~~C~~C~k~f~~~~--~L~~H~~  147 (155)
                      +.|-|++|+..|...+  ....|.+
T Consensus         2 ~ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    2 PRYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             -S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             cCeecccccceecCCChHHHHHhhc
Confidence            4588999999994433  4456644


No 108
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=64.47  E-value=4  Score=27.19  Aligned_cols=53  Identities=8%  Similarity=0.090  Sum_probs=29.4

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHHHHHHH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIGCMRSH  100 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H  100 (155)
                      .-+|..|+.....-..-..-.   .-........+.-+.|+.||+.|...+.+.+-
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~---~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKD---RVPPYVYETYDEFWRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CCccCCCCcEeeechhhcccc---ccCccccccCCeEEECCCCCCEecccccHHHH
Confidence            457999987654332211110   00000111223468899999999988876654


No 109
>KOG2785|consensus
Probab=64.13  E-value=4.6  Score=31.21  Aligned_cols=60  Identities=10%  Similarity=0.098  Sum_probs=40.6

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhh-----hhh----------------------hc--cCCCCCcccccccccccccH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTI-----ESM----------------------IR--TDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~-----~~~----------------------~~--~~~~~~~~~C~~C~~~f~~~   94 (155)
                      ..|.|..|...|.....-..|.+...     +..                      ..  .-..+-++.|.+|.+.|...
T Consensus         2 t~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~   81 (390)
T KOG2785|consen    2 TGFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASP   81 (390)
T ss_pred             CcceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccCh
Confidence            35788999988888766666664111     100                      00  01234568899999999999


Q ss_pred             HHHHHHHhH
Q psy13210         95 GCMRSHIRT  103 (155)
Q Consensus        95 ~~l~~H~~~  103 (155)
                      .....|+.+
T Consensus        82 ~a~~~hl~S   90 (390)
T KOG2785|consen   82 KAHENHLKS   90 (390)
T ss_pred             hhHHHHHHH
Confidence            999988865


No 110
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=63.80  E-value=3.1  Score=20.68  Aligned_cols=30  Identities=13%  Similarity=0.058  Sum_probs=17.7

Q ss_pred             hhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         47 RLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        47 ~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      .|..|+.+|..                ...+....-+|+.||..+.
T Consensus         3 ~C~~Cg~~Yh~----------------~~~pP~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    3 ICPKCGRIYHI----------------EFNPPKVEGVCDNCGGELV   32 (36)
T ss_dssp             EETTTTEEEET----------------TTB--SSTTBCTTTTEBEB
T ss_pred             CcCCCCCcccc----------------ccCCCCCCCccCCCCCeeE
Confidence            37778877753                2333444567888887554


No 111
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=63.60  E-value=5  Score=21.01  Aligned_cols=22  Identities=23%  Similarity=0.551  Sum_probs=19.8

Q ss_pred             eecCcCcccccCchHHHHHHhh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRR  148 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~  148 (155)
                      |.|-.|..+..-++.|-.|++.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            7899999999999999999874


No 112
>KOG4167|consensus
Probab=63.35  E-value=2  Score=35.89  Aligned_cols=25  Identities=28%  Similarity=0.598  Sum_probs=22.4

Q ss_pred             CeecCcCcccccCchHHHHHHhhhhC
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLRRTHG  151 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~~~H~  151 (155)
                      -|.|.+|+|.|...-++..||+ .|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK-~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMK-THR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHH-HHH
Confidence            4999999999999999999999 554


No 113
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=62.79  E-value=3.8  Score=20.51  Aligned_cols=13  Identities=23%  Similarity=0.792  Sum_probs=10.6

Q ss_pred             eecCcCcccccCc
Q psy13210        127 FKCVVCKQFFATY  139 (155)
Q Consensus       127 ~~C~~C~k~f~~~  139 (155)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            7899999988644


No 114
>KOG3408|consensus
Probab=62.02  E-value=5.4  Score=25.66  Aligned_cols=25  Identities=24%  Similarity=0.688  Sum_probs=22.6

Q ss_pred             CCCCeecCcCcccccCchHHHHHHh
Q psy13210        123 GRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      |...|-|-.|.+-|.....|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            5567999999999999999999977


No 115
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=61.30  E-value=3.9  Score=21.94  Aligned_cols=12  Identities=8%  Similarity=0.022  Sum_probs=9.6

Q ss_pred             Chhhhhhhhhhc
Q psy13210         44 SADRLERLRTQC   55 (155)
Q Consensus        44 ~~~~c~~C~~~~   55 (155)
                      ..|.|..|++.+
T Consensus         5 ~~Y~C~~Cg~~~   16 (49)
T COG1996           5 MEYKCARCGREV   16 (49)
T ss_pred             EEEEhhhcCCee
Confidence            357899999887


No 116
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=60.73  E-value=2  Score=25.02  Aligned_cols=41  Identities=5%  Similarity=-0.034  Sum_probs=24.0

Q ss_pred             hhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccc--ccccccccHHH
Q psy13210         46 DRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCY--ACDYFSYNIGC   96 (155)
Q Consensus        46 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~--~C~~~f~~~~~   96 (155)
                      ..|+.|+........-....          ...+.-+.|.  .||.+|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~----------~~~~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD----------TTKERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh----------hhheeeeecCCCCCCCEEEEEEE
Confidence            46888886653332222211          1344567888  89999876654


No 117
>KOG2593|consensus
Probab=60.59  E-value=5.1  Score=31.48  Aligned_cols=43  Identities=12%  Similarity=0.116  Sum_probs=29.5

Q ss_pred             cccccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccc
Q psy13210         37 NQSMIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYF   90 (155)
Q Consensus        37 ~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~   90 (155)
                      .........|.|+.|.+.|...-.+..           .-...-.|.|..|+.-
T Consensus       120 ~~d~t~~~~Y~Cp~C~kkyt~Lea~~L-----------~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  120 LRDDTNVAGYVCPNCQKKYTSLEALQL-----------LDNETGEFHCENCGGE  162 (436)
T ss_pred             hhhccccccccCCccccchhhhHHHHh-----------hcccCceEEEecCCCc
Confidence            344566689999999999875544332           3333456999999853


No 118
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=58.67  E-value=5.7  Score=20.08  Aligned_cols=14  Identities=36%  Similarity=0.783  Sum_probs=12.7

Q ss_pred             CeecCcCcccccCc
Q psy13210        126 PFKCVVCKQFFATY  139 (155)
Q Consensus       126 ~~~C~~C~k~f~~~  139 (155)
                      ||.|..|++.|...
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            79999999999875


No 119
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=58.15  E-value=1.6  Score=22.27  Aligned_cols=12  Identities=25%  Similarity=0.431  Sum_probs=8.9

Q ss_pred             cccccccccccc
Q psy13210         81 KFVCYACDYFSY   92 (155)
Q Consensus        81 ~~~C~~C~~~f~   92 (155)
                      -|.|..||..+.
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            478888887764


No 120
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=57.88  E-value=11  Score=19.24  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=13.8

Q ss_pred             ccccccccccccH--HHHHHHHhHh
Q psy13210         82 FVCYACDYFSYNI--GCMRSHIRTH  104 (155)
Q Consensus        82 ~~C~~C~~~f~~~--~~l~~H~~~h  104 (155)
                      -+|+.||-.|...  .+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            4677777666544  4555565555


No 121
>KOG2907|consensus
Probab=57.79  E-value=4.3  Score=25.73  Aligned_cols=41  Identities=10%  Similarity=0.154  Sum_probs=24.5

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYN   93 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~   93 (155)
                      ..+|+.||..--.+..++...        .-.-.-.-|.|+.|++.|..
T Consensus        74 ~~kCpkCghe~m~Y~T~QlRS--------ADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTLQLRS--------ADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             hccCcccCCchhhhhhhhccc--------ccCCceEEEEcCccceeeec
Confidence            456999987655554444322        11111234899999998864


No 122
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=57.75  E-value=4.5  Score=24.46  Aligned_cols=34  Identities=6%  Similarity=-0.117  Sum_probs=22.1

Q ss_pred             cChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         43 ISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        43 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      ...+.|+.|++.-.                  .......|+|..||..|.-.
T Consensus        33 ~~~~~Cp~C~~~~V------------------kR~a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          33 RAKHVCPFCGRTTV------------------KRIATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             hcCCcCCCCCCcce------------------eeeccCeEEcCCCCCeeccc
Confidence            35577888886521                  11233568999999988654


No 123
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=57.23  E-value=4.4  Score=28.86  Aligned_cols=53  Identities=17%  Similarity=0.254  Sum_probs=30.4

Q ss_pred             CCcccccccccccccHHHHHHHHhH-hcCCCCcHHHHHHHHHhccCCCC-----eecCcCcccccCc
Q psy13210         79 RHKFVCYACDYFSYNIGCMRSHIRT-HTGEKPYAHIIRNHYRKHTGRKP-----FKCVVCKQFFATY  139 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~~~l~~H~~~h~~~~~-----~~C~~C~k~f~~~  139 (155)
                      ++...||+|+..|..+.-.....+. .....     +..   .-.+..|     ..|+.||.+|...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D-----~~~---~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSD-----FCP---RYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCC-----Ccc---ccCCCCCeeeeEEECCCCCCccccc
Confidence            3567999999999888544433332 11110     111   0113334     4699999987654


No 124
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=56.84  E-value=5.3  Score=20.41  Aligned_cols=12  Identities=25%  Similarity=0.343  Sum_probs=9.7

Q ss_pred             Cccccccccccc
Q psy13210         80 HKFVCYACDYFS   91 (155)
Q Consensus        80 ~~~~C~~C~~~f   91 (155)
                      ++-.|++||..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467899999877


No 125
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.83  E-value=3.3  Score=27.27  Aligned_cols=15  Identities=0%  Similarity=-0.049  Sum_probs=11.9

Q ss_pred             ChhhhhhhhhhccCc
Q psy13210         44 SADRLERLRTQCATS   58 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~   58 (155)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            568899999888664


No 126
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=56.22  E-value=3.6  Score=19.30  Aligned_cols=20  Identities=25%  Similarity=0.529  Sum_probs=12.4

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      |.|..|++.| .......|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            6799999999 4444555543


No 127
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.91  E-value=4.1  Score=23.90  Aligned_cols=34  Identities=9%  Similarity=0.008  Sum_probs=19.5

Q ss_pred             cChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccccc
Q psy13210         43 ISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFS   91 (155)
Q Consensus        43 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f   91 (155)
                      .-.|+|..|+..|    ++.+++        .   ..-.-.|+.|+..+
T Consensus        10 tY~Y~c~~cg~~~----dvvq~~--------~---ddplt~ce~c~a~~   43 (82)
T COG2331          10 TYSYECTECGNRF----DVVQAM--------T---DDPLTTCEECGARL   43 (82)
T ss_pred             ceEEeecccchHH----HHHHhc--------c---cCccccChhhChHH
Confidence            3457788888765    444444        1   11223588887644


No 128
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=54.76  E-value=9.4  Score=30.56  Aligned_cols=27  Identities=19%  Similarity=0.497  Sum_probs=24.2

Q ss_pred             eecCcCcccccCchHHHHHHhhhhCCC
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRRTHGQE  153 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~~H~~~  153 (155)
                      +.|+.|.+.|.....+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            569999999999999999999888764


No 129
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=54.59  E-value=6.2  Score=21.16  Aligned_cols=18  Identities=28%  Similarity=0.538  Sum_probs=14.4

Q ss_pred             CCCeecCcCcccccCchH
Q psy13210        124 RKPFKCVVCKQFFATYSG  141 (155)
Q Consensus       124 ~~~~~C~~C~k~f~~~~~  141 (155)
                      ++.+.|..||..|...+.
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            467899999999877654


No 130
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=54.51  E-value=6.5  Score=33.03  Aligned_cols=44  Identities=9%  Similarity=0.099  Sum_probs=26.9

Q ss_pred             hhhcccccccccChhh-hhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccc
Q psy13210         32 RALDVNQSMIDISADR-LERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDY   89 (155)
Q Consensus        32 ~~~~~~~~~~~~~~~~-c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~   89 (155)
                      +..+-....+....|+ |+.|.+.|....+-+            .|.  +|.-|+.||-
T Consensus       137 ~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRR------------fHA--Qp~aCp~CGP  181 (750)
T COG0068         137 EALPYDRENTSMADFPLCPFCDKEYKDPLNRR------------FHA--QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcccCccccCcCCHHHHHHhcCccccc------------ccc--ccccCcccCC
Confidence            3334444444454454 888888887766533            333  4567999986


No 131
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=54.20  E-value=5  Score=20.64  Aligned_cols=15  Identities=40%  Similarity=0.815  Sum_probs=10.2

Q ss_pred             CCeecCcCcccccCc
Q psy13210        125 KPFKCVVCKQFFATY  139 (155)
Q Consensus       125 ~~~~C~~C~k~f~~~  139 (155)
                      -|+.|+.|++.|...
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            479999999999875


No 132
>KOG2636|consensus
Probab=51.15  E-value=11  Score=29.81  Aligned_cols=29  Identities=14%  Similarity=0.350  Sum_probs=23.1

Q ss_pred             cCCCCCcccccccc-cccccHHHHHHHHhH
Q psy13210         75 TDPFRHKFVCYACD-YFSYNIGCMRSHIRT  103 (155)
Q Consensus        75 ~~~~~~~~~C~~C~-~~f~~~~~l~~H~~~  103 (155)
                      .|.-...|.|.+|| +++.-...+.+|...
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhHH
Confidence            33445679999999 888888999999763


No 133
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=51.00  E-value=8.8  Score=18.97  Aligned_cols=31  Identities=10%  Similarity=0.055  Sum_probs=14.8

Q ss_pred             hhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         48 LERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        48 c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      |+.|.+.+....+-            +.|.  .+..|..||-.+.
T Consensus         2 C~~C~~Ey~~p~~R------------R~~~--~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFDPSNR------------RFHY--QFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCSTTST------------TTT---TT--BTTCC-SCC
T ss_pred             CHHHHHHHcCCCCC------------cccC--cCccCCCCCCCEE
Confidence            66677666555432            2222  3456888886653


No 134
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=50.87  E-value=6.8  Score=25.63  Aligned_cols=15  Identities=13%  Similarity=0.213  Sum_probs=12.0

Q ss_pred             cccccccccccccHH
Q psy13210         81 KFVCYACDYFSYNIG   95 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~   95 (155)
                      |++|..||+.|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578888888888765


No 135
>COG1773 Rubredoxin [Energy production and conversion]
Probab=49.47  E-value=7.5  Score=21.37  Aligned_cols=15  Identities=20%  Similarity=0.536  Sum_probs=11.9

Q ss_pred             cccccccccccccHH
Q psy13210         81 KFVCYACDYFSYNIG   95 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~   95 (155)
                      .|+|..||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            588999999986554


No 136
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=49.42  E-value=8.1  Score=18.84  Aligned_cols=11  Identities=36%  Similarity=1.029  Sum_probs=8.4

Q ss_pred             ccccccccccc
Q psy13210         81 KFVCYACDYFS   91 (155)
Q Consensus        81 ~~~C~~C~~~f   91 (155)
                      .|.|..||..+
T Consensus         2 ~~~C~~CG~i~   12 (34)
T cd00729           2 VWVCPVCGYIH   12 (34)
T ss_pred             eEECCCCCCEe
Confidence            47888888865


No 137
>KOG2636|consensus
Probab=49.09  E-value=12  Score=29.63  Aligned_cols=27  Identities=15%  Similarity=0.376  Sum_probs=22.2

Q ss_pred             HhccCCCCeecCcCc-ccccCchHHHHH
Q psy13210        119 RKHTGRKPFKCVVCK-QFFATYSGAYQH  145 (155)
Q Consensus       119 ~~h~~~~~~~C~~C~-k~f~~~~~L~~H  145 (155)
                      +.|.-...|.|.+|| +++.-.-.+.+|
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHH
Confidence            467777889999999 788887778777


No 138
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=48.95  E-value=4  Score=26.02  Aligned_cols=40  Identities=15%  Similarity=0.252  Sum_probs=25.3

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      .+.|+.|+..-.....++.-.        .--+.-.-|.|..||..|+
T Consensus        72 ~~~CpkCg~~ea~y~~~QtRs--------aDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQTRS--------ADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             cccCCCCCCceeEEEeeehhc--------cCCCceEEEEecccCCEee
Confidence            367999987665555444432        1122234589999999875


No 139
>PF12907 zf-met2:  Zinc-binding
Probab=48.68  E-value=5.4  Score=20.39  Aligned_cols=27  Identities=22%  Similarity=0.508  Sum_probs=19.2

Q ss_pred             eecCcCcccccCc---hHHHHHHhhhhCCC
Q psy13210        127 FKCVVCKQFFATY---SGAYQHLRRTHGQE  153 (155)
Q Consensus       127 ~~C~~C~k~f~~~---~~L~~H~~~~H~~~  153 (155)
                      +.|.+|-.+|...   ..|..|-...|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            6799999666544   56888877677654


No 140
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=48.60  E-value=7.6  Score=20.99  Aligned_cols=12  Identities=17%  Similarity=0.437  Sum_probs=6.8

Q ss_pred             ecCcCcccccCc
Q psy13210        128 KCVVCKQFFATY  139 (155)
Q Consensus       128 ~C~~C~k~f~~~  139 (155)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999998765


No 141
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=48.40  E-value=10  Score=19.58  Aligned_cols=17  Identities=24%  Similarity=0.223  Sum_probs=13.3

Q ss_pred             eecCcCcccccCchHHH
Q psy13210        127 FKCVVCKQFFATYSGAY  143 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~  143 (155)
                      =.|.+||+.|++.-...
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            46999999999875543


No 142
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=48.27  E-value=14  Score=29.61  Aligned_cols=26  Identities=19%  Similarity=0.365  Sum_probs=21.3

Q ss_pred             cccccccccccccHHHHHHHHhH-hcC
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT-HTG  106 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~-h~~  106 (155)
                      -+.|+.|.+.|.+...+..|+.. |.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            47789999999999999999874 665


No 143
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=48.17  E-value=1.2  Score=22.62  Aligned_cols=10  Identities=30%  Similarity=0.736  Sum_probs=7.5

Q ss_pred             cccccccccc
Q psy13210         82 FVCYACDYFS   91 (155)
Q Consensus        82 ~~C~~C~~~f   91 (155)
                      |.|..||..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7788888765


No 144
>PHA02998 RNA polymerase subunit; Provisional
Probab=47.62  E-value=3.6  Score=28.34  Aligned_cols=39  Identities=10%  Similarity=0.129  Sum_probs=24.0

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCC----CcccccccccccccHH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFR----HKFVCYACDYFSYNIG   95 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~----~~~~C~~C~~~f~~~~   95 (155)
                      ..+|+.|+..-...-.+            ++.+..    .-|.|..||..|..+.
T Consensus       143 ~v~CPkCg~~~A~f~ql------------QTRSADEPmT~FYkC~~CG~~wkppk  185 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMI------------QTRAADEPPLVRHACRDCKKHFKPPK  185 (195)
T ss_pred             CCCCCCCCCCceEEEEE------------eeccCCCCceEEEEcCCCCCccCCcc
Confidence            46799998544333222            333332    3388999999987653


No 145
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=47.57  E-value=2.3  Score=26.35  Aligned_cols=13  Identities=23%  Similarity=0.519  Sum_probs=7.2

Q ss_pred             CCccccccccccc
Q psy13210         79 RHKFVCYACDYFS   91 (155)
Q Consensus        79 ~~~~~C~~C~~~f   91 (155)
                      ++.|.|+.||..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            3456666666543


No 146
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=46.82  E-value=4.4  Score=24.70  Aligned_cols=37  Identities=5%  Similarity=-0.069  Sum_probs=22.8

Q ss_pred             ccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         40 MIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        40 ~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      ......+.|+.|++.-..                  ......+.|..|++.|.-.
T Consensus        31 ~~q~a~y~CpfCgk~~vk------------------R~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         31 ISQHAKYFCPFCGKHAVK------------------RQAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             HHHhCCccCCCCCCCcee------------------eeeeEEEEcCCCCCEEeCC
Confidence            344566788888753211                  1122568899999887643


No 147
>KOG1842|consensus
Probab=45.05  E-value=12  Score=29.61  Aligned_cols=26  Identities=23%  Similarity=0.458  Sum_probs=16.5

Q ss_pred             cccccccccccccHHHHHHHHhH-hcC
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT-HTG  106 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~-h~~  106 (155)
                      .|.||+|..-|.....|..|... |.+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccc
Confidence            36666666666666666666655 443


No 148
>KOG4173|consensus
Probab=43.82  E-value=13  Score=26.44  Aligned_cols=62  Identities=13%  Similarity=0.150  Sum_probs=42.2

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhh--hccCCCCCcccccc--cccccccHHHHHHHHhH-hc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESM--IRTDPFRHKFVCYA--CDYFSYNIGCMRSHIRT-HT  105 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~--~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~-h~  105 (155)
                      -+-.|..|.+.|.+...|..|..--..+-  ..+..+..-|.|-+  |+-.|.+...-..|+-. |.
T Consensus       105 h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~Hk  171 (253)
T KOG4173|consen  105 HGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMHK  171 (253)
T ss_pred             ccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhcc
Confidence            34469999999999999999973000000  01112344588955  99999999999999765 53


No 149
>KOG0717|consensus
Probab=43.75  E-value=13  Score=29.70  Aligned_cols=21  Identities=29%  Similarity=0.550  Sum_probs=19.7

Q ss_pred             eecCcCcccccCchHHHHHHh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      +-|.+|.|+|.+.-.|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            889999999999999999976


No 150
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.45  E-value=12  Score=30.32  Aligned_cols=9  Identities=33%  Similarity=0.859  Sum_probs=5.3

Q ss_pred             CeecCcCcc
Q psy13210        126 PFKCVVCKQ  134 (155)
Q Consensus       126 ~~~C~~C~k  134 (155)
                      |..|+.||-
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            456666654


No 151
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=43.03  E-value=24  Score=24.14  Aligned_cols=50  Identities=10%  Similarity=0.190  Sum_probs=30.7

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccC-----CCCCcccccccccccccHHHHHHHHh
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTD-----PFRHKFVCYACDYFSYNIGCMRSHIR  102 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~-----~~~~~~~C~~C~~~f~~~~~l~~H~~  102 (155)
                      .-+|..|+......+.-..-.        .+.     ....-+.|+.||+.|...+++..-.+
T Consensus        97 ~~RCp~CN~~L~~vs~eev~~--------~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656          97 FSRCPECNGELEKVSREEVKE--------KVPEKVYRNYEEFYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             cccCcccCCEeccCcHHHHhh--------ccchhhhhcccceeECCCCcccccCchHHHHHHH
Confidence            457999987665443222111        111     12344679999999998888775544


No 152
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=42.68  E-value=13  Score=23.11  Aligned_cols=17  Identities=35%  Similarity=0.825  Sum_probs=13.3

Q ss_pred             ccCCCCeecCcCcccccC
Q psy13210        121 HTGRKPFKCVVCKQFFAT  138 (155)
Q Consensus       121 h~~~~~~~C~~C~k~f~~  138 (155)
                      +.| +|+.|++||.-|.-
T Consensus        75 ~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          75 EKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             eCC-CceeCCCCCcEEEE
Confidence            345 68999999988764


No 153
>PRK14873 primosome assembly protein PriA; Provisional
Probab=42.47  E-value=14  Score=31.10  Aligned_cols=10  Identities=30%  Similarity=0.268  Sum_probs=6.2

Q ss_pred             hhhhhhhhcc
Q psy13210         47 RLERLRTQCA   56 (155)
Q Consensus        47 ~c~~C~~~~~   56 (155)
                      .|..|+..+.
T Consensus       385 ~C~~Cg~~~~  394 (665)
T PRK14873        385 ACARCRTPAR  394 (665)
T ss_pred             EhhhCcCeeE
Confidence            4777766554


No 154
>PRK05978 hypothetical protein; Provisional
Probab=41.77  E-value=7.6  Score=26.05  Aligned_cols=34  Identities=18%  Similarity=0.005  Sum_probs=21.4

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      -.-+|+.|++.--...-|+.+.                 .|+.||..|...
T Consensus        32 l~grCP~CG~G~LF~g~Lkv~~-----------------~C~~CG~~~~~~   65 (148)
T PRK05978         32 FRGRCPACGEGKLFRAFLKPVD-----------------HCAACGEDFTHH   65 (148)
T ss_pred             HcCcCCCCCCCcccccccccCC-----------------CccccCCccccC
Confidence            3456999986654443333332                 699999877543


No 155
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=41.59  E-value=15  Score=19.35  Aligned_cols=14  Identities=36%  Similarity=0.702  Sum_probs=10.4

Q ss_pred             cccccccccccccH
Q psy13210         81 KFVCYACDYFSYNI   94 (155)
Q Consensus        81 ~~~C~~C~~~f~~~   94 (155)
                      .+.|+.||..+.-.
T Consensus        20 ~~vC~~Cg~~~~~~   33 (52)
T smart00661       20 RFVCRKCGYEEPIE   33 (52)
T ss_pred             EEECCcCCCeEECC
Confidence            57899998876554


No 156
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=41.37  E-value=13  Score=22.73  Aligned_cols=15  Identities=13%  Similarity=0.292  Sum_probs=12.4

Q ss_pred             CCccccccccccccc
Q psy13210         79 RHKFVCYACDYFSYN   93 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~   93 (155)
                      -+|-.|..||+.|.+
T Consensus        56 v~Pa~CkkCGfef~~   70 (97)
T COG3357          56 VRPARCKKCGFEFRD   70 (97)
T ss_pred             ecChhhcccCccccc
Confidence            357789999999976


No 157
>KOG4124|consensus
Probab=40.38  E-value=1.6  Score=33.35  Aligned_cols=69  Identities=20%  Similarity=0.335  Sum_probs=43.0

Q ss_pred             CCcccccc--cccccccHHHHHHHHhH-hcCCCCcH-HHHHHHHHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         79 RHKFVCYA--CDYFSYNIGCMRSHIRT-HTGEKPYA-HIIRNHYRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        79 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h~~~~~~~-~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      .++++|++  |.+.++....|+-|-.. |...-... -.-+-|+.--...|+|.|++|.++++....|..|+-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceee
Confidence            46788877  99988888877766443 32100000 001112222234689999999999998888776654


No 158
>KOG2071|consensus
Probab=39.99  E-value=19  Score=29.63  Aligned_cols=29  Identities=21%  Similarity=0.429  Sum_probs=24.1

Q ss_pred             CCCCeecCcCcccccCchHHHHHHhhhhCC
Q psy13210        123 GRKPFKCVVCKQFFATYSGAYQHLRRTHGQ  152 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~~~L~~H~~~~H~~  152 (155)
                      ...|-.|..||.+|........|+. .|.+
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md-~H~d  443 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMD-IHDD  443 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhh-hhhh
Confidence            3557889999999999999999888 6643


No 159
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=39.80  E-value=12  Score=25.32  Aligned_cols=17  Identities=24%  Similarity=0.661  Sum_probs=13.8

Q ss_pred             CeecCcCcccccCchHH
Q psy13210        126 PFKCVVCKQFFATYSGA  142 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L  142 (155)
                      .+.|+.||++|.....+
T Consensus        28 ~~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         28 RRECLACGKRFTTFERV   44 (154)
T ss_pred             eeeccccCCcceEeEec
Confidence            48999999999876543


No 160
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=39.68  E-value=4.7  Score=30.94  Aligned_cols=69  Identities=14%  Similarity=0.247  Sum_probs=22.4

Q ss_pred             cccCCCcchhhhhhcccccccc-----cChhhhhhhhhhccCcHHHhhhHHhhhhhhhccC-CCCCccccccccccccc
Q psy13210         21 DAQDGGFSKLKRALDVNQSMID-----ISADRLERLRTQCATSAELTQHEIRTIESMIRTD-PFRHKFVCYACDYFSYN   93 (155)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~-----~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~-~~~~~~~C~~C~~~f~~   93 (155)
                      ...+..|..+......++.+..     ...+.|..|...+-..+..-.-....    +..+ ...+-|+|..|++....
T Consensus       223 e~~e~yf~~Le~kEkmeekm~~i~e~k~kav~C~~C~yt~~~~~~~C~~~~H~----l~~~~a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  223 ERQERYFEKLEKKEKMEEKMESIREVKCKAVTCKQCKYTAFKPSDRCKEEGHP----LKWHDAVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             ---------------------S-S--EEEEEEETTT--EESS--HHHHHTT------EEEEEEE-EEEE-T-TS-EEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhCcEEEEEEEEcCCCCCcccCcchhHHhcCCc----eEEeeeeeeeEECCCCCCeeee
Confidence            3344445444444444443333     36778999988777666554322100    1222 23566899999986543


No 161
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=39.42  E-value=14  Score=19.90  Aligned_cols=13  Identities=23%  Similarity=0.669  Sum_probs=10.7

Q ss_pred             ccccccccccccH
Q psy13210         82 FVCYACDYFSYNI   94 (155)
Q Consensus        82 ~~C~~C~~~f~~~   94 (155)
                      |+|..||+.+...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999988754


No 162
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=39.10  E-value=32  Score=27.74  Aligned_cols=42  Identities=10%  Similarity=-0.002  Sum_probs=25.6

Q ss_pred             ccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCC------CCcccccccccc
Q psy13210         40 MIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPF------RHKFVCYACDYF   90 (155)
Q Consensus        40 ~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~------~~~~~C~~C~~~   90 (155)
                      ......|+|..|+..|.....-...         .+.++      +..|.||.||..
T Consensus       420 ~~~~~~~~c~~c~~~yd~~~g~~~~---------~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        420 ADLGPRMQCSVCQWIYDPAKGEPMQ---------DVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             cCCCCeEEECCCCeEECCCCCCccc---------CCCCCCChhhCCCCCcCcCCCCc
Confidence            3445788999999888654321111         22222      335899999964


No 163
>KOG0717|consensus
Probab=39.06  E-value=18  Score=28.92  Aligned_cols=22  Identities=23%  Similarity=0.773  Sum_probs=19.6

Q ss_pred             eecCcCcccccCchHHHHHHhh
Q psy13210        127 FKCVVCKQFFATYSGAYQHLRR  148 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H~~~  148 (155)
                      ..|..|+..|.+..-|-.|+..
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~  482 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKK  482 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhh
Confidence            6799999999999999999873


No 164
>PLN02294 cytochrome c oxidase subunit Vb
Probab=38.41  E-value=16  Score=25.08  Aligned_cols=16  Identities=19%  Similarity=0.355  Sum_probs=13.0

Q ss_pred             CCcccccccccccccH
Q psy13210         79 RHKFVCYACDYFSYNI   94 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~   94 (155)
                      .+++.|++||..|.-+
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            4688999999998644


No 165
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=37.29  E-value=25  Score=19.34  Aligned_cols=12  Identities=33%  Similarity=0.764  Sum_probs=4.1

Q ss_pred             Cccccccccccc
Q psy13210         80 HKFVCYACDYFS   91 (155)
Q Consensus        80 ~~~~C~~C~~~f   91 (155)
                      +.|+|++||.+=
T Consensus        32 r~y~Cp~CgAtG   43 (55)
T PF05741_consen   32 RKYVCPICGATG   43 (55)
T ss_dssp             GG---TTT---G
T ss_pred             hcCcCCCCcCcC
Confidence            458899998763


No 166
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.23  E-value=22  Score=20.01  Aligned_cols=16  Identities=13%  Similarity=0.366  Sum_probs=12.1

Q ss_pred             CCCCeecCcCcccccC
Q psy13210        123 GRKPFKCVVCKQFFAT  138 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~  138 (155)
                      .+.-..|++|+..|+.
T Consensus        45 ~~gev~CPYC~t~y~l   60 (62)
T COG4391          45 DEGEVVCPYCSTRYRL   60 (62)
T ss_pred             CCCcEecCccccEEEe
Confidence            3445789999998864


No 167
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=36.51  E-value=17  Score=23.73  Aligned_cols=17  Identities=29%  Similarity=0.749  Sum_probs=13.5

Q ss_pred             CCCCeecCcCcccccCc
Q psy13210        123 GRKPFKCVVCKQFFATY  139 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~  139 (155)
                      |...|.|..|++.|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            34569999999998754


No 168
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=35.60  E-value=15  Score=19.42  Aligned_cols=14  Identities=21%  Similarity=0.529  Sum_probs=10.9

Q ss_pred             ccccccccccccHH
Q psy13210         82 FVCYACDYFSYNIG   95 (155)
Q Consensus        82 ~~C~~C~~~f~~~~   95 (155)
                      |+|..||..+....
T Consensus         2 y~C~~CgyvYd~~~   15 (47)
T PF00301_consen    2 YQCPVCGYVYDPEK   15 (47)
T ss_dssp             EEETTTSBEEETTT
T ss_pred             cCCCCCCEEEcCCc
Confidence            78999998876554


No 169
>KOG3408|consensus
Probab=34.58  E-value=27  Score=22.61  Aligned_cols=26  Identities=19%  Similarity=0.534  Sum_probs=19.1

Q ss_pred             CCCcccccccccccccHHHHHHHHhH
Q psy13210         78 FRHKFVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        78 ~~~~~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      +...|-|-.|.+-|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44456788888888888888877764


No 170
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=34.38  E-value=18  Score=19.58  Aligned_cols=17  Identities=12%  Similarity=0.444  Sum_probs=11.3

Q ss_pred             CCCCeecCcCcccccCc
Q psy13210        123 GRKPFKCVVCKQFFATY  139 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~  139 (155)
                      +...|.|.+|++.+...
T Consensus        32 ~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   32 EPIKLRCHYCERIITED   48 (52)
T ss_dssp             TTCEEEETTT--EEEHH
T ss_pred             CCCEEEeeCCCCEeccc
Confidence            55569999999987643


No 171
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=33.90  E-value=15  Score=23.25  Aligned_cols=14  Identities=7%  Similarity=0.043  Sum_probs=9.2

Q ss_pred             ChhhhhhhhhhccC
Q psy13210         44 SADRLERLRTQCAT   57 (155)
Q Consensus        44 ~~~~c~~C~~~~~~   57 (155)
                      ...+|..|+..|..
T Consensus        69 ~~~~C~~Cg~~~~~   82 (113)
T PF01155_consen   69 ARARCRDCGHEFEP   82 (113)
T ss_dssp             -EEEETTTS-EEEC
T ss_pred             CcEECCCCCCEEec
Confidence            34679999988865


No 172
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=33.73  E-value=16  Score=19.88  Aligned_cols=42  Identities=12%  Similarity=0.051  Sum_probs=23.7

Q ss_pred             Chhhhhh--hhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccc----cccccccH
Q psy13210         44 SADRLER--LRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYA----CDYFSYNI   94 (155)
Q Consensus        44 ~~~~c~~--C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~----C~~~f~~~   94 (155)
                      ....|+.  |...+. ...|..|.        ...-..++..|+.    |+..+...
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~--------~~~C~~~~v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHL--------ENECPKRPVPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHH--------HTTSTTSEEE-SS----S--EEEHH
T ss_pred             CEeeCCCCCccccee-HHHHHHHH--------HccCCCCcEECCCCCCCCCCccchh
Confidence            3456766  444343 56888887        6555666788999    88776543


No 173
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=33.09  E-value=18  Score=20.35  Aligned_cols=30  Identities=13%  Similarity=0.173  Sum_probs=12.8

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      .-.|..|++.|...                    .+.+-|..||..|-..
T Consensus         9 ~~~C~~C~~~F~~~--------------------~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen    9 ASNCMICGKKFSLF--------------------RRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             -SB-TTT--B-BSS--------------------S-EEE-TTT--EEECC
T ss_pred             CCcCcCcCCcCCCc--------------------eeeEccCCCCCEECCc
Confidence            34588899888542                    1345688888776544


No 174
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.02  E-value=16  Score=19.42  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=12.4

Q ss_pred             ecCcCcccccCchHHH
Q psy13210        128 KCVVCKQFFATYSGAY  143 (155)
Q Consensus       128 ~C~~C~k~f~~~~~L~  143 (155)
                      .|++|++.|++.-...
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            5999999998865443


No 175
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=32.91  E-value=20  Score=28.39  Aligned_cols=15  Identities=20%  Similarity=0.366  Sum_probs=12.3

Q ss_pred             CeecCcCcccccCch
Q psy13210        126 PFKCVVCKQFFATYS  140 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~  140 (155)
                      -|.|+-||+.+....
T Consensus       367 g~rC~kCg~~~~~~~  381 (421)
T COG1571         367 GFRCKKCGTRARETL  381 (421)
T ss_pred             CcccccccccCCccc
Confidence            599999999887653


No 176
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=32.80  E-value=16  Score=27.51  Aligned_cols=35  Identities=14%  Similarity=0.052  Sum_probs=23.7

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIG   95 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~   95 (155)
                      -+.+|+.|+.....+ .|..                ..+.|+.||.-|+-..
T Consensus        37 lw~kc~~C~~~~~~~-~l~~----------------~~~vcp~c~~h~rltA   71 (296)
T CHL00174         37 LWVQCENCYGLNYKK-FLKS----------------KMNICEQCGYHLKMSS   71 (296)
T ss_pred             CeeECCCccchhhHH-HHHH----------------cCCCCCCCCCCcCCCH
Confidence            477899998765433 2333                2368999999887554


No 177
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=32.09  E-value=30  Score=26.72  Aligned_cols=29  Identities=21%  Similarity=0.472  Sum_probs=22.0

Q ss_pred             cCCCCCcccccccc-cccccHHHHHHHHhH
Q psy13210         75 TDPFRHKFVCYACD-YFSYNIGCMRSHIRT  103 (155)
Q Consensus        75 ~~~~~~~~~C~~C~-~~f~~~~~l~~H~~~  103 (155)
                      .|.-.+.|.|.+|| +++.-...+.+|...
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF~E  397 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHFEE  397 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhhhh
Confidence            34445779999999 777777888888653


No 178
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=31.80  E-value=22  Score=21.71  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=7.2

Q ss_pred             CeecCcCccc
Q psy13210        126 PFKCVVCKQF  135 (155)
Q Consensus       126 ~~~C~~C~k~  135 (155)
                      .|.|++||+.
T Consensus        35 ky~Cp~Cgk~   44 (90)
T PF01780_consen   35 KYTCPFCGKT   44 (90)
T ss_dssp             -BEESSSSSS
T ss_pred             CCcCCCCCCc
Confidence            4888888874


No 179
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=31.75  E-value=15  Score=19.82  Aligned_cols=25  Identities=24%  Similarity=0.608  Sum_probs=15.4

Q ss_pred             CCeecCcCcccccCchHHHHHHhhhh
Q psy13210        125 KPFKCVVCKQFFATYSGAYQHLRRTH  150 (155)
Q Consensus       125 ~~~~C~~C~k~f~~~~~L~~H~~~~H  150 (155)
                      ..|.|+.|+..|...-.+-.|.. .|
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~-LH   44 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET-LH   44 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT-S-
T ss_pred             CeEECCCCCCccccCcChhhhcc-cc
Confidence            46999999999998888887776 44


No 180
>PF14353 CpXC:  CpXC protein
Probab=31.62  E-value=8.9  Score=24.73  Aligned_cols=55  Identities=18%  Similarity=0.254  Sum_probs=29.3

Q ss_pred             ccccccccccccHHHHHHHHhHhcCCCCcHHHHHHHHHhccCC-CCeecCcCcccccCchHHHHH
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRTHTGEKPYAHIIRNHYRKHTGR-KPFKCVVCKQFFATYSGAYQH  145 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~l~~H~~~h~~~-~~~~C~~C~k~f~~~~~L~~H  145 (155)
                      ..||.|+..|......    .+.....|   .++.-+.  .|+ -.|.|+.||..|.-...+..|
T Consensus         2 itCP~C~~~~~~~v~~----~I~~~~~p---~l~e~il--~g~l~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWT----SINADEDP---ELKEKIL--DGSLFSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             cCCCCCCCeeEEEEEe----EEcCcCCH---HHHHHHH--cCCcCEEECCCCCCceecCCCEEEE
Confidence            3688888877554321    11222222   1121111  222 248999999998776555444


No 181
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=30.72  E-value=24  Score=17.35  Aligned_cols=13  Identities=31%  Similarity=0.478  Sum_probs=6.8

Q ss_pred             eecCcCcccccCc
Q psy13210        127 FKCVVCKQFFATY  139 (155)
Q Consensus       127 ~~C~~C~k~f~~~  139 (155)
                      -.|.+|++.|.-+
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            3699999988754


No 182
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=30.67  E-value=17  Score=23.11  Aligned_cols=14  Identities=0%  Similarity=-0.256  Sum_probs=9.8

Q ss_pred             ChhhhhhhhhhccC
Q psy13210         44 SADRLERLRTQCAT   57 (155)
Q Consensus        44 ~~~~c~~C~~~~~~   57 (155)
                      ...+|..|+..|..
T Consensus        69 ~~~~C~~Cg~~~~~   82 (113)
T PRK12380         69 AQAWCWDCSQVVEI   82 (113)
T ss_pred             cEEEcccCCCEEec
Confidence            45679999976643


No 183
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=30.31  E-value=23  Score=19.37  Aligned_cols=12  Identities=25%  Similarity=0.312  Sum_probs=9.4

Q ss_pred             cccccccccccc
Q psy13210         82 FVCYACDYFSYN   93 (155)
Q Consensus        82 ~~C~~C~~~f~~   93 (155)
                      ++|+.||..+.-
T Consensus         3 ~~CP~CG~~iev   14 (54)
T TIGR01206         3 FECPDCGAEIEL   14 (54)
T ss_pred             cCCCCCCCEEec
Confidence            689999987643


No 184
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=30.08  E-value=28  Score=21.88  Aligned_cols=25  Identities=24%  Similarity=0.598  Sum_probs=21.5

Q ss_pred             CCCCeecCcCcccccCchHHHHHHh
Q psy13210        123 GRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       123 ~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      |-..+-|-+|.+-|-+.-.|..|.+
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            4456889999999999999999876


No 185
>KOG1088|consensus
Probab=29.77  E-value=23  Score=22.69  Aligned_cols=22  Identities=14%  Similarity=0.081  Sum_probs=17.8

Q ss_pred             ccCCCCCcccccccccccccHH
Q psy13210         74 RTDPFRHKFVCYACDYFSYNIG   95 (155)
Q Consensus        74 ~~~~~~~~~~C~~C~~~f~~~~   95 (155)
                      .++..+...+|+.||..|.-..
T Consensus        91 e~~v~EG~l~CpetG~vfpI~~  112 (124)
T KOG1088|consen   91 EIDVIEGELVCPETGRVFPISD  112 (124)
T ss_pred             hhhhccceEecCCCCcEeeccc
Confidence            5666777889999999997654


No 186
>PRK01343 zinc-binding protein; Provisional
Probab=29.70  E-value=35  Score=18.93  Aligned_cols=14  Identities=14%  Similarity=0.221  Sum_probs=10.8

Q ss_pred             CCeecCcCcccccC
Q psy13210        125 KPFKCVVCKQFFAT  138 (155)
Q Consensus       125 ~~~~C~~C~k~f~~  138 (155)
                      ....|+.|++.+.+
T Consensus         8 p~~~CP~C~k~~~~   21 (57)
T PRK01343          8 PTRPCPECGKPSTR   21 (57)
T ss_pred             CCCcCCCCCCcCcC
Confidence            45779999998754


No 187
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=29.04  E-value=41  Score=22.69  Aligned_cols=46  Identities=13%  Similarity=0.302  Sum_probs=20.0

Q ss_pred             Chhhhhhhhhhcc------CcHHHhhhHHhhhhhhhccCC----CCCccccccccc
Q psy13210         44 SADRLERLRTQCA------TSAELTQHEIRTIESMIRTDP----FRHKFVCYACDY   89 (155)
Q Consensus        44 ~~~~c~~C~~~~~------~~~~l~~h~~~~~~~~~~~~~----~~~~~~C~~C~~   89 (155)
                      ...+|..|++.|-      ..+.+..|.+..-.+....|.    ++...+|..||.
T Consensus        13 ~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   13 CVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             CEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             cEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            3456777777762      446666776533333223333    455688988875


No 188
>PRK12722 transcriptional activator FlhC; Provisional
Probab=28.94  E-value=30  Score=24.22  Aligned_cols=30  Identities=20%  Similarity=0.187  Sum_probs=20.2

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDY   89 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~   89 (155)
                      ....|..|+-.|....                +.....|+|+.|.-
T Consensus       133 ~l~~C~~Cgg~fv~~~----------------~e~~~~f~CplC~~  162 (187)
T PRK12722        133 QLSSCNCCGGHFVTHA----------------HDPVGSFVCGLCQP  162 (187)
T ss_pred             eeccCCCCCCCeeccc----------------cccCCCCcCCCCCC
Confidence            3456999998886432                12235789999976


No 189
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=28.84  E-value=31  Score=16.71  Aligned_cols=12  Identities=25%  Similarity=0.586  Sum_probs=9.0

Q ss_pred             CeecCcCccccc
Q psy13210        126 PFKCVVCKQFFA  137 (155)
Q Consensus       126 ~~~C~~C~k~f~  137 (155)
                      -+.|..||..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            367888888764


No 190
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=28.73  E-value=16  Score=27.48  Aligned_cols=44  Identities=11%  Similarity=0.108  Sum_probs=23.9

Q ss_pred             cccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         41 IDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        41 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      .....+.|+.|+..-.....++...        .--+.-.-|.|..||..+.
T Consensus       254 ~~t~~~~C~~C~~~~~~~~q~Qtrs--------aDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       254 AVTDLFTCGKCKQKKCTYYQLQTRS--------ADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             CCcccccCCCCCCccceEEEecccC--------CCCCCeEEEEcCCCCCeee
Confidence            3446789999985544433322211        1111123478999997654


No 191
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.60  E-value=28  Score=17.31  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=6.1

Q ss_pred             CeecCcCcccc
Q psy13210        126 PFKCVVCKQFF  136 (155)
Q Consensus       126 ~~~C~~C~k~f  136 (155)
                      -|.|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            49999999654


No 192
>PRK04351 hypothetical protein; Provisional
Probab=28.48  E-value=22  Score=23.88  Aligned_cols=35  Identities=14%  Similarity=0.072  Sum_probs=22.9

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      -.|.|..|+..+.+..              +.  +...|.|..|+..+...
T Consensus       111 y~Y~C~~Cg~~~~r~R--------------r~--n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        111 YLYECQSCGQQYLRKR--------------RI--NTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEEECCCCCCEeeeee--------------ec--CCCcEEeCCCCcEeeec
Confidence            3578988997665421              11  23668999999876543


No 193
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.27  E-value=19  Score=24.11  Aligned_cols=36  Identities=14%  Similarity=0.107  Sum_probs=22.9

Q ss_pred             ccccccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccccc
Q psy13210         38 QSMIDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFS   91 (155)
Q Consensus        38 ~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f   91 (155)
                      ......+.+.|..||.....                 .+++ ..-+|+.||..-
T Consensus       105 GE~~g~G~l~C~~Cg~~~~~-----------------~~~~-~l~~Cp~C~~~~  140 (146)
T PF07295_consen  105 GEVVGPGTLVCENCGHEVEL-----------------THPE-RLPPCPKCGHTE  140 (146)
T ss_pred             CcEecCceEecccCCCEEEe-----------------cCCC-cCCCCCCCCCCe
Confidence            34455578889999976432                 2232 345799998753


No 194
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=27.85  E-value=7.4  Score=22.39  Aligned_cols=14  Identities=14%  Similarity=0.147  Sum_probs=8.4

Q ss_pred             CcccccccccccccH
Q psy13210         80 HKFVCYACDYFSYNI   94 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~   94 (155)
                      +.-+| .||++..-+
T Consensus        19 kTkkC-~CG~~l~vk   32 (68)
T PF09082_consen   19 KTKKC-VCGKTLKVK   32 (68)
T ss_dssp             SEEEE-TTTEEEE--
T ss_pred             ceeEe-cCCCeeeee
Confidence            45579 899865433


No 195
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=27.64  E-value=19  Score=22.89  Aligned_cols=9  Identities=22%  Similarity=0.807  Sum_probs=4.3

Q ss_pred             ccccccccc
Q psy13210         82 FVCYACDYF   90 (155)
Q Consensus        82 ~~C~~C~~~   90 (155)
                      ..|..||..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            445555543


No 196
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=27.61  E-value=21  Score=26.83  Aligned_cols=35  Identities=14%  Similarity=0.038  Sum_probs=23.2

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIG   95 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~   95 (155)
                      -+.+|+.|+.....+ .|...                .+.|+.||.-|+-..
T Consensus        26 ~~~~c~~c~~~~~~~-~l~~~----------------~~vc~~c~~h~rl~a   60 (292)
T PRK05654         26 LWTKCPSCGQVLYRK-ELEAN----------------LNVCPKCGHHMRISA   60 (292)
T ss_pred             CeeECCCccchhhHH-HHHhc----------------CCCCCCCCCCeeCCH
Confidence            477899998765432 23222                358999999886543


No 197
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=27.41  E-value=22  Score=26.61  Aligned_cols=35  Identities=20%  Similarity=0.140  Sum_probs=23.5

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccHH
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNIG   95 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~   95 (155)
                      -+.+|+.|+.....+ +|...                -+.|+.||.-|+-..
T Consensus        25 ~~~~c~~c~~~~~~~-~l~~~----------------~~vc~~c~~h~rl~a   59 (285)
T TIGR00515        25 VWTKCPKCGQVLYTK-ELERN----------------LEVCPKCDHHMRMDA   59 (285)
T ss_pred             CeeECCCCcchhhHH-HHHhh----------------CCCCCCCCCcCcCCH
Confidence            477899999765433 33332                368999999877543


No 198
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=27.25  E-value=15  Score=18.04  Aligned_cols=12  Identities=33%  Similarity=1.021  Sum_probs=8.3

Q ss_pred             Cccccccccccc
Q psy13210         80 HKFVCYACDYFS   91 (155)
Q Consensus        80 ~~~~C~~C~~~f   91 (155)
                      ..+.|+.||...
T Consensus        21 ~R~vC~~Cg~Ih   32 (34)
T PF14803_consen   21 ERLVCPACGFIH   32 (34)
T ss_dssp             -EEEETTTTEEE
T ss_pred             cceECCCCCCEE
Confidence            347788888764


No 199
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=26.92  E-value=30  Score=19.05  Aligned_cols=12  Identities=25%  Similarity=0.481  Sum_probs=9.4

Q ss_pred             ecCcCcccccCc
Q psy13210        128 KCVVCKQFFATY  139 (155)
Q Consensus       128 ~C~~C~k~f~~~  139 (155)
                      -|++|++.|...
T Consensus        41 gCPfC~~~~~~~   52 (55)
T PF14447_consen   41 GCPFCGTPFEFD   52 (55)
T ss_pred             CCCCCCCcccCC
Confidence            499999988653


No 200
>PRK12860 transcriptional activator FlhC; Provisional
Probab=26.77  E-value=33  Score=24.05  Aligned_cols=29  Identities=34%  Similarity=0.550  Sum_probs=19.7

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACD   88 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~   88 (155)
                      ....|..|+-.|....                +.....|+|+.|.
T Consensus       133 ~l~~C~~Cgg~fv~~~----------------~e~~~~f~CplC~  161 (189)
T PRK12860        133 QLARCCRCGGKFVTHA----------------HDLRHNFVCGLCQ  161 (189)
T ss_pred             eeccCCCCCCCeeccc----------------cccCCCCcCCCCC
Confidence            4457999998886432                2223568999997


No 201
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=26.73  E-value=21  Score=25.12  Aligned_cols=24  Identities=21%  Similarity=0.490  Sum_probs=0.0

Q ss_pred             CCcccccccccccc-cHHHHHHHHh
Q psy13210         79 RHKFVCYACDYFSY-NIGCMRSHIR  102 (155)
Q Consensus        79 ~~~~~C~~C~~~f~-~~~~l~~H~~  102 (155)
                      .+.|+|.+||.... -...+.+|..
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             -------------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHhcC
Confidence            45699999997554 5577888865


No 202
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=26.09  E-value=42  Score=15.81  Aligned_cols=14  Identities=14%  Similarity=0.690  Sum_probs=7.8

Q ss_pred             CeecCcCcccccCc
Q psy13210        126 PFKCVVCKQFFATY  139 (155)
Q Consensus       126 ~~~C~~C~k~f~~~  139 (155)
                      .|.|+.|+..+-+.
T Consensus        13 kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen   13 KYRCPRCGARYCSL   26 (30)
T ss_dssp             SEE-TTT--EESSH
T ss_pred             EEECCCcCCceeCc
Confidence            58888888776653


No 203
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=26.04  E-value=43  Score=18.42  Aligned_cols=18  Identities=22%  Similarity=0.384  Sum_probs=13.1

Q ss_pred             CCCCcccccccccccccH
Q psy13210         77 PFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        77 ~~~~~~~C~~C~~~f~~~   94 (155)
                      .....|.|+.||..+.-.
T Consensus        10 ~~~v~~~Cp~cGipthcS   27 (55)
T PF13824_consen   10 PAHVNFECPDCGIPTHCS   27 (55)
T ss_pred             ccccCCcCCCCCCcCccC
Confidence            345679999999865544


No 204
>KOG2807|consensus
Probab=25.75  E-value=95  Score=23.88  Aligned_cols=68  Identities=13%  Similarity=0.219  Sum_probs=41.6

Q ss_pred             CcccccccccccccHHHHHHHHhHhcCCCCcH-----H-HHHHH----HHhccCCCCeecCcCcccccCchHHHHHHh
Q psy13210         80 HKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA-----H-IIRNH----YRKHTGRKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~-----~-~l~~H----~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      -|..|++|+-+.-..-+|.+-..--..-++|.     . .-.++    ...-.+...|.|..|.-.|...-+.-.|..
T Consensus       289 LP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             CCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccceeeccchHHHHhh
Confidence            36679999988887777774432222233332     0 00000    111123446999999999999988888877


No 205
>KOG1994|consensus
Probab=25.61  E-value=35  Score=24.69  Aligned_cols=23  Identities=17%  Similarity=0.507  Sum_probs=19.8

Q ss_pred             CCCeecCcCcccccCchHHHHHH
Q psy13210        124 RKPFKCVVCKQFFATYSGAYQHL  146 (155)
Q Consensus       124 ~~~~~C~~C~k~f~~~~~L~~H~  146 (155)
                      ..-|-|-+||..|.+...|..|=
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhC
Confidence            34599999999999999999873


No 206
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=25.43  E-value=29  Score=17.27  Aligned_cols=17  Identities=24%  Similarity=0.153  Sum_probs=10.4

Q ss_pred             eecCcCcccccCchHHH
Q psy13210        127 FKCVVCKQFFATYSGAY  143 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~  143 (155)
                      =.|+-|++.|-+.+...
T Consensus         3 ~~CprC~kg~Hwa~~C~   19 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECR   19 (36)
T ss_dssp             -C-TTTSSSCS-TTT--
T ss_pred             ccCcccCCCcchhhhhh
Confidence            36999999998887654


No 207
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=25.42  E-value=33  Score=21.01  Aligned_cols=10  Identities=20%  Similarity=0.707  Sum_probs=7.4

Q ss_pred             CeecCcCccc
Q psy13210        126 PFKCVVCKQF  135 (155)
Q Consensus       126 ~~~C~~C~k~  135 (155)
                      .|.|++||+.
T Consensus        35 ~y~CpfCgk~   44 (91)
T TIGR00280        35 KYVCPFCGKK   44 (91)
T ss_pred             CccCCCCCCC
Confidence            4888888753


No 208
>PF14369 zf-RING_3:  zinc-finger
Probab=25.36  E-value=33  Score=16.80  Aligned_cols=10  Identities=20%  Similarity=0.225  Sum_probs=8.1

Q ss_pred             cccccccccc
Q psy13210         83 VCYACDYFSY   92 (155)
Q Consensus        83 ~C~~C~~~f~   92 (155)
                      .|+.|+..|-
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998874


No 209
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=25.20  E-value=31  Score=18.73  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=8.6

Q ss_pred             eecCcCcccccC
Q psy13210        127 FKCVVCKQFFAT  138 (155)
Q Consensus       127 ~~C~~C~k~f~~  138 (155)
                      +.|++||..+..
T Consensus         1 i~CPyCge~~~~   12 (52)
T PF14255_consen    1 IQCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCCeeEE
Confidence            468999876643


No 210
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=25.11  E-value=34  Score=18.97  Aligned_cols=12  Identities=25%  Similarity=0.578  Sum_probs=6.6

Q ss_pred             eecCcCcccccC
Q psy13210        127 FKCVVCKQFFAT  138 (155)
Q Consensus       127 ~~C~~C~k~f~~  138 (155)
                      ..|+.|++.+.+
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            579999998766


No 211
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=24.57  E-value=23  Score=22.94  Aligned_cols=14  Identities=0%  Similarity=-0.225  Sum_probs=9.8

Q ss_pred             ChhhhhhhhhhccCc
Q psy13210         44 SADRLERLRTQCATS   58 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~   58 (155)
                      ...+| .|+..|...
T Consensus        69 ~~~~C-~Cg~~~~~~   82 (124)
T PRK00762         69 VEIEC-ECGYEGVVD   82 (124)
T ss_pred             eeEEe-eCcCccccc
Confidence            45679 999776543


No 212
>KOG4118|consensus
Probab=24.50  E-value=46  Score=19.00  Aligned_cols=22  Identities=14%  Similarity=0.283  Sum_probs=12.3

Q ss_pred             ccccccccccccHHHHHHHHhH
Q psy13210         82 FVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        82 ~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      |+|.+|-....+...+..|...
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~   60 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFEN   60 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhh
Confidence            4566665555555555555544


No 213
>PLN02748 tRNA dimethylallyltransferase
Probab=24.30  E-value=55  Score=26.44  Aligned_cols=24  Identities=21%  Similarity=0.368  Sum_probs=20.7

Q ss_pred             Cccccccccc-ccccHHHHHHHHhH
Q psy13210         80 HKFVCYACDY-FSYNIGCMRSHIRT  103 (155)
Q Consensus        80 ~~~~C~~C~~-~f~~~~~l~~H~~~  103 (155)
                      +.|.|+.|++ ++........|+..
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5678999998 89999999999875


No 214
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=24.28  E-value=36  Score=18.65  Aligned_cols=19  Identities=11%  Similarity=0.214  Sum_probs=16.1

Q ss_pred             eecCcCcccccCchHHHHH
Q psy13210        127 FKCVVCKQFFATYSGAYQH  145 (155)
Q Consensus       127 ~~C~~C~k~f~~~~~L~~H  145 (155)
                      +=|-+||..|.+...|.++
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             ceeeeeCCccCCHHHHHhC
Confidence            6799999999999888654


No 215
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=23.83  E-value=83  Score=23.67  Aligned_cols=24  Identities=21%  Similarity=0.520  Sum_probs=21.7

Q ss_pred             CCCeecCcCcccccCchHHHHHHh
Q psy13210        124 RKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       124 ~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      ..-|.|+.|=+-|.+...|.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            445999999999999999999987


No 216
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=23.39  E-value=35  Score=22.55  Aligned_cols=33  Identities=12%  Similarity=0.092  Sum_probs=20.6

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      .|.|..|+..+...               +.+.....+.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~~~---------------rr~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLRV---------------RRSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCceE---------------ccccCcceEEcCCCCCEEE
Confidence            67788888765421               2222225688999987653


No 217
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=23.20  E-value=40  Score=17.12  Aligned_cols=10  Identities=20%  Similarity=0.541  Sum_probs=6.3

Q ss_pred             CeecCcCccc
Q psy13210        126 PFKCVVCKQF  135 (155)
Q Consensus       126 ~~~C~~C~k~  135 (155)
                      .+.|..||.-
T Consensus        19 ~~vC~~CG~V   28 (43)
T PF08271_consen   19 ELVCPNCGLV   28 (43)
T ss_dssp             EEEETTT-BB
T ss_pred             eEECCCCCCE
Confidence            3788888754


No 218
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=23.16  E-value=30  Score=22.90  Aligned_cols=16  Identities=13%  Similarity=0.061  Sum_probs=12.7

Q ss_pred             CCcccccccccccccH
Q psy13210         79 RHKFVCYACDYFSYNI   94 (155)
Q Consensus        79 ~~~~~C~~C~~~f~~~   94 (155)
                      .++..|+.||..|.-.
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            3588999999988643


No 219
>PTZ00448 hypothetical protein; Provisional
Probab=23.09  E-value=63  Score=25.19  Aligned_cols=23  Identities=17%  Similarity=0.532  Sum_probs=20.1

Q ss_pred             cccccccccccccHHHHHHHHhH
Q psy13210         81 KFVCYACDYFSYNIGCMRSHIRT  103 (155)
Q Consensus        81 ~~~C~~C~~~f~~~~~l~~H~~~  103 (155)
                      .|.|..|+..|.+......|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888888888876


No 220
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=23.06  E-value=34  Score=18.39  Aligned_cols=15  Identities=7%  Similarity=-0.133  Sum_probs=10.2

Q ss_pred             ChhhhhhhhhhccCc
Q psy13210         44 SADRLERLRTQCATS   58 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~   58 (155)
                      -.++|..|+..|...
T Consensus        27 v~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   27 VWWKCPKCGHEWKAS   41 (55)
T ss_pred             EEEECCCCCCeeEcc
Confidence            347788887776554


No 221
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=23.00  E-value=44  Score=17.34  Aligned_cols=13  Identities=15%  Similarity=0.296  Sum_probs=9.5

Q ss_pred             eecCcCcccccCc
Q psy13210        127 FKCVVCKQFFATY  139 (155)
Q Consensus       127 ~~C~~C~k~f~~~  139 (155)
                      |.|..||..|...
T Consensus         3 Y~C~~Cg~~~~~~   15 (44)
T smart00659        3 YICGECGRENEIK   15 (44)
T ss_pred             EECCCCCCEeecC
Confidence            7788888777644


No 222
>KOG0782|consensus
Probab=22.83  E-value=25  Score=29.11  Aligned_cols=29  Identities=24%  Similarity=0.249  Sum_probs=21.4

Q ss_pred             HHHHHHHHhccCCCCeecCcCcccccCch
Q psy13210        112 HIIRNHYRKHTGRKPFKCVVCKQFFATYS  140 (155)
Q Consensus       112 ~~l~~H~~~h~~~~~~~C~~C~k~f~~~~  140 (155)
                      +.+.+|..+|.-..-=+|..|||.|.++-
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf  267 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKF  267 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhhe
Confidence            46777777776555567999999987763


No 223
>PLN02748 tRNA dimethylallyltransferase
Probab=22.68  E-value=55  Score=26.41  Aligned_cols=23  Identities=17%  Similarity=0.336  Sum_probs=19.0

Q ss_pred             CCeecCcCcc-cccCchHHHHHHh
Q psy13210        125 KPFKCVVCKQ-FFATYSGAYQHLR  147 (155)
Q Consensus       125 ~~~~C~~C~k-~f~~~~~L~~H~~  147 (155)
                      +.|.|+.|++ .+........|++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhc
Confidence            4688999998 7988888888865


No 224
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=22.60  E-value=39  Score=20.62  Aligned_cols=10  Identities=30%  Similarity=0.627  Sum_probs=7.6

Q ss_pred             CeecCcCccc
Q psy13210        126 PFKCVVCKQF  135 (155)
Q Consensus       126 ~~~C~~C~k~  135 (155)
                      .|.|++|++.
T Consensus        36 ~y~CpfCgk~   45 (90)
T PRK03976         36 KHVCPVCGRP   45 (90)
T ss_pred             CccCCCCCCC
Confidence            4889998753


No 225
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.43  E-value=38  Score=24.67  Aligned_cols=42  Identities=10%  Similarity=0.116  Sum_probs=25.6

Q ss_pred             cccChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccccH
Q psy13210         41 IDISADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYNI   94 (155)
Q Consensus        41 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~   94 (155)
                      ....+..|..|.......  ...-+        +.  +...-.||.||+...+.
T Consensus       193 vpl~g~~C~GC~m~l~~~--~~~~V--------~~--~d~iv~CP~CgRILy~~  234 (239)
T COG1579         193 VPLEGRVCGGCHMKLPSQ--TLSKV--------RK--KDEIVFCPYCGRILYYD  234 (239)
T ss_pred             EeecCCcccCCeeeecHH--HHHHH--------hc--CCCCccCCccchHHHhh
Confidence            334566799998765442  22222        23  44556799999876544


No 226
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=22.43  E-value=27  Score=22.06  Aligned_cols=16  Identities=19%  Similarity=0.413  Sum_probs=12.0

Q ss_pred             CcccccccccccccHH
Q psy13210         80 HKFVCYACDYFSYNIG   95 (155)
Q Consensus        80 ~~~~C~~C~~~f~~~~   95 (155)
                      ..|.|++|+..+....
T Consensus        18 ~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686        18 TQLICPSCLYEWNENE   33 (109)
T ss_pred             CeeECccccccccccc
Confidence            4588999998876553


No 227
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.23  E-value=32  Score=21.96  Aligned_cols=14  Identities=0%  Similarity=-0.230  Sum_probs=9.8

Q ss_pred             ChhhhhhhhhhccC
Q psy13210         44 SADRLERLRTQCAT   57 (155)
Q Consensus        44 ~~~~c~~C~~~~~~   57 (155)
                      ...+|..|+..|..
T Consensus        70 ~~~~C~~Cg~~~~~   83 (117)
T PRK00564         70 VELECKDCSHVFKP   83 (117)
T ss_pred             CEEEhhhCCCcccc
Confidence            45679999976643


No 228
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=22.22  E-value=45  Score=24.13  Aligned_cols=31  Identities=19%  Similarity=0.401  Sum_probs=19.7

Q ss_pred             CCCcccccccccccccHHHHHHHHhHhcCCCCcH
Q psy13210         78 FRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA  111 (155)
Q Consensus        78 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  111 (155)
                      ..++..|+.||..|.-..-+.   ..-.|..||.
T Consensus       178 EGkpqRCpECGqVFKLVr~~~---s~~dg~dp~~  208 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLVRVLY---SLPDGEDPFP  208 (268)
T ss_pred             CCCCccCCCCCcEEEEEEEEe---ecCCCCCCCC
Confidence            456789999999997643221   1344666664


No 229
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.18  E-value=45  Score=16.21  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=13.8

Q ss_pred             CeecCcCcccccCchHHHHHHh
Q psy13210        126 PFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       126 ~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      -+.|+.|++.+.. +.+..|+.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHHH
Confidence            4789999997653 45666654


No 230
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=22.03  E-value=15  Score=22.70  Aligned_cols=41  Identities=15%  Similarity=0.175  Sum_probs=22.7

Q ss_pred             hhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCccccccccccccc
Q psy13210         45 ADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSYN   93 (155)
Q Consensus        45 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~   93 (155)
                      ...|+.|+..-.....++...        .--+.-.-|.|..||..+..
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q~Rs--------adE~~T~fy~C~~C~~~w~~  102 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQTRR--------ADEPETRFYKCTKCGYVWRE  102 (104)
T ss_pred             cCCCCCCCCCeeEEEEeccCC--------CCCCcEEEEEeCCCCCeeEe
Confidence            467999986554333322211        11112234889999987653


No 231
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=21.63  E-value=34  Score=19.40  Aligned_cols=18  Identities=11%  Similarity=0.275  Sum_probs=13.3

Q ss_pred             cCCCCCcccccccccccc
Q psy13210         75 TDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        75 ~~~~~~~~~C~~C~~~f~   92 (155)
                      .+..+....|+.||+.|.
T Consensus        47 ~~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   47 VEIVEGELICPECGREYP   64 (68)
T ss_dssp             EETTTTEEEETTTTEEEE
T ss_pred             ccccCCEEEcCCCCCEEe
Confidence            445566788999988875


No 232
>PLN03239 histone acetyltransferase; Provisional
Probab=21.38  E-value=61  Score=25.05  Aligned_cols=24  Identities=21%  Similarity=0.253  Sum_probs=21.4

Q ss_pred             CCCeecCcCcccccCchHHHHHHh
Q psy13210        124 RKPFKCVVCKQFFATYSGAYQHLR  147 (155)
Q Consensus       124 ~~~~~C~~C~k~f~~~~~L~~H~~  147 (155)
                      +.-|.|+.|-+-|.+...|.+|+.
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHH
Confidence            346999999999999999999976


No 233
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=21.24  E-value=47  Score=15.97  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=7.7

Q ss_pred             CeecCcCcccc
Q psy13210        126 PFKCVVCKQFF  136 (155)
Q Consensus       126 ~~~C~~C~k~f  136 (155)
                      +..|+.||..-
T Consensus        17 ~irC~~CG~RI   27 (32)
T PF03604_consen   17 PIRCPECGHRI   27 (32)
T ss_dssp             TSSBSSSS-SE
T ss_pred             cEECCcCCCeE
Confidence            57899998754


No 234
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=21.03  E-value=24  Score=23.36  Aligned_cols=33  Identities=15%  Similarity=0.169  Sum_probs=20.4

Q ss_pred             ChhhhhhhhhhccCcHHHhhhHHhhhhhhhccCCCCCcccccccccccc
Q psy13210         44 SADRLERLRTQCATSAELTQHEIRTIESMIRTDPFRHKFVCYACDYFSY   92 (155)
Q Consensus        44 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~   92 (155)
                      -.|.|..|+..+....              +.  ....+.|..|+..+.
T Consensus       122 ~~~~C~~C~~~~~r~~--------------~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHR--------------RS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeec--------------cc--chhhEECCCCCCEEE
Confidence            3566888887664322              22  223478999987654


No 235
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=20.57  E-value=24  Score=24.45  Aligned_cols=13  Identities=8%  Similarity=-0.169  Sum_probs=9.8

Q ss_pred             Chhhhhhhhhhcc
Q psy13210         44 SADRLERLRTQCA   56 (155)
Q Consensus        44 ~~~~c~~C~~~~~   56 (155)
                      ..++|..|.+.|.
T Consensus       138 w~~rC~GC~~~f~  150 (177)
T COG1439         138 WRLRCHGCKRIFP  150 (177)
T ss_pred             eeEEEecCceecC
Confidence            3566888998886


No 236
>KOG0402|consensus
Probab=20.25  E-value=32  Score=20.67  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=8.4

Q ss_pred             CeecCcCccc
Q psy13210        126 PFKCVVCKQF  135 (155)
Q Consensus       126 ~~~C~~C~k~  135 (155)
                      .|.|++|||.
T Consensus        36 ky~CsfCGK~   45 (92)
T KOG0402|consen   36 KYTCSFCGKK   45 (92)
T ss_pred             hhhhhhcchh
Confidence            3999999985


No 237
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=20.00  E-value=44  Score=17.78  Aligned_cols=9  Identities=33%  Similarity=0.899  Sum_probs=3.7

Q ss_pred             ccccccccc
Q psy13210         81 KFVCYACDY   89 (155)
Q Consensus        81 ~~~C~~C~~   89 (155)
                      .|+|++|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            389999975


Done!