BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13217
         (422 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1EJ6|A Chain A, Reovirus Core
 pdb|2CSE|U Chain U, Features Of Reovirus Outer-Capsid Protein Mu1 Revealed By
           Electron And Image Reconstruction Of The Virion At 7.0-A
           Resolution
          Length = 1289

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 261 LALEETTTFFSAEMLPRLVVGSFLAKFISDILEQSFVESELEPGEMFYKLV 311
           L+L  T  +  A  +PR +   +L+ F+S I+     E+ L P E + ++ 
Sbjct: 304 LSLLATNGYQLARPIPRQLTNRWLSSFVSQIMSDGVNETPLWPQERYVQIA 354


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,742,799
Number of Sequences: 62578
Number of extensions: 401747
Number of successful extensions: 892
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 890
Number of HSP's gapped (non-prelim): 5
length of query: 422
length of database: 14,973,337
effective HSP length: 101
effective length of query: 321
effective length of database: 8,652,959
effective search space: 2777599839
effective search space used: 2777599839
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)