Query         psy13231
Match_columns 100
No_of_seqs    105 out of 497
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:28:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13231.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13231hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3913|consensus               99.9 2.1E-25 4.6E-30  176.4   5.4   72   26-100    45-116 (356)
  2 PF00110 wnt:  wnt family;  Int  99.9 2.2E-25 4.8E-30  173.6  -0.7   70   28-100     1-71  (310)
  3 smart00097 WNT1 found in Wnt-1  99.9 4.7E-23   1E-27  160.6   5.5   64   37-100     4-67  (305)
  4 PLN02277 H(+) -translocating i  68.7     5.2 0.00011   35.3   3.1   23   52-74    561-583 (730)
  5 TIGR01104 V_PPase vacuolar-typ  67.5     5.6 0.00012   35.0   3.0   23   52-74    529-551 (697)
  6 PRK00733 hppA membrane-bound p  63.4       8 0.00017   33.9   3.2   24   52-75    504-527 (666)
  7 PLN02255 H(+) -translocating i  60.6     8.8 0.00019   34.1   3.0   23   52-74    592-614 (765)
  8 PF03030 H_PPase:  Inorganic H+  59.3     8.4 0.00018   33.8   2.6   24   52-75    529-552 (682)
  9 COG3728 XtmA Phage terminase,   37.8      20 0.00042   26.5   1.3   26   37-62      2-27  (179)
 10 PF08058 NPCC:  Nuclear pore co  36.4      28  0.0006   24.5   1.9   38    4-51     89-126 (144)
 11 PF14483 Cut8_M:  Cut8 dimerisa  30.5      31 0.00067   19.1   1.1   22   37-58      9-35  (38)
 12 PF06345 Drf_DAD:  DRF Autoregu  28.1      47   0.001   14.9   1.2   13   51-63      1-13  (15)
 13 PF03592 Terminase_2:  Terminas  26.7      22 0.00048   24.2   0.1   15   38-52      1-15  (144)
 14 KOG4114|consensus               23.4 1.1E+02  0.0024   19.5   2.8   30   43-72     29-60  (73)
 15 PF08688 ASD1:  Apx/Shroom doma  21.8      50  0.0011   24.5   1.1   27   27-57    123-149 (182)
 16 KOG3588|consensus               20.8      58  0.0013   27.3   1.4   28   20-52    434-461 (494)
 17 PF04418 DUF543:  Domain of unk  20.5      52  0.0011   20.9   0.9   16   57-72     60-75  (75)

No 1  
>KOG3913|consensus
Probab=99.91  E-value=2.1e-25  Score=176.37  Aligned_cols=72  Identities=31%  Similarity=0.555  Sum_probs=68.7

Q ss_pred             cccccccccccCCCHHHHHHHhcccchHHHHHHHHHHHHHHHHHhcccCCCCCCCCCCCCCcccccccCCCCCCC
Q psy13231         26 PNDCRRARMEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITAHSEAEV  100 (100)
Q Consensus        26 ~~~C~~~~~~~gl~~~Q~~lC~~~p~lm~~i~~G~~~ai~ECq~QF~~~RWNCs~~~~~~~~~~~l~~gtREtAf  100 (100)
                      ..+|+.++   ||+++|+++|+++|++|++|.+|+++||.|||+||+++|||||+.+..+.|++++++|+|||||
T Consensus        45 ~~~C~~l~---gL~~~Q~~~Cr~~p~~~~sv~~G~~~~i~ECq~QFr~~RWNCs~~~~~~~~g~~l~~g~REsAF  116 (356)
T KOG3913|consen   45 KPLCDNLP---GLSPRQRRLCRRNPDVMPSVAEGAREGIQECQFQFRFRRWNCSTLDQLPVFGPLLSRGTRETAF  116 (356)
T ss_pred             ccchhhcc---ccCHHHHHHHHhCcchHHHHHHHHHHHHHHHHHHHHhhccCCCCCccccccchhhcccchHHHH
Confidence            44899999   9999999999999999999999999999999999999999999987667899999999999998


No 2  
>PF00110 wnt:  wnt family;  InterPro: IPR005817 Wnt proteins constitute a large family of secreted molecules that are involved in intercellular signalling during development. The name derives from the first 2 members of the family to be discovered: int-1 (mouse) and wingless (Drosophila) []. It is now recognised that Wnt signalling controls many cell fate decisions in a variety of different organisms, including mammals []. Wnt signalling has been implicated in tumourigenesis, early mesodermal patterning of the embryo, morphogenesis of the brain and kidneys, regulation of mammary gland proliferation and Alzheimer's disease [, ]. Wnt-mediated signalling is believed to proceed initially through binding to cell surface receptors of the frizzled family; the signal is subsequently transduced through several cytoplasmic components to B-catenin, which enters the nucleus and activates the transcription of several genes important in development []. Several non-canonical Wnt signalling pathways have also been elucidated that act independently of B-catenin. Canonical and noncanonical Wnt signaling branches are highly interconnected, and cross-regulate each other []. Members of the Wnt gene family are defined by their sequence similarity to mouse Wnt-1 and Wingless in Drosophila. They encode proteins of ~350-400 residues in length, with orthologues identified in several, mostly vertebrate, species. Very little is known about the structure of Wnts as they are notoriously insoluble, but they share the following features characteristics of secretory proteins: a signal peptide, several potential N-glycosylation sites and 22 conserved cysteines [] that are probably involved in disulphide bonds. The Wnt proteins seem to adhere to the plasma membrane of the secreting cells and are therefore likely to signal over only few cell diameters. Fifteen major Wnt gene families have been identified in vertebrates, with multiple subtypes within some classes. In humans, 19 Wnt proteins have been identified that share 27% to 83% amino-acid sequence identity and a conserved pattern of 23 or 24 cysteine residues []. Wnt genes are highly conserved between vertebrate species sharing overall sequence identity and gene structure, and are slightly less conserved between vertebrates and invertebrates.; GO: 0005102 receptor binding, 0007275 multicellular organismal development, 0016055 Wnt receptor signaling pathway, 0005576 extracellular region; PDB: 4F0A_B.
Probab=99.90  E-value=2.2e-25  Score=173.63  Aligned_cols=70  Identities=30%  Similarity=0.672  Sum_probs=38.8

Q ss_pred             cccccccccCCCHHHHHHHhcccchHHHHHHHHHHHHHHHHHhcccCCCCCCCCCCCCCccc-ccccCCCCCCC
Q psy13231         28 DCRRARMEYGFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTP-DLITAHSEAEV  100 (100)
Q Consensus        28 ~C~~~~~~~gl~~~Q~~lC~~~p~lm~~i~~G~~~ai~ECq~QF~~~RWNCs~~~~~~~~~~-~l~~gtREtAf  100 (100)
                      +|++++   ||+++|+++|+++|++|++|++|+++|++|||+||+++|||||+....+.|++ ++..|||||||
T Consensus         1 iC~~~~---gL~~~Q~~~C~~~p~~m~~i~~G~~~ai~ECq~QF~~~RWNCs~~~~~~~f~~~~~~~gtrE~Af   71 (310)
T PF00110_consen    1 ICDKIP---GLTKRQRRLCRRNPDLMPSIAEGAKMAIEECQHQFRNRRWNCSTVDNNPVFGPPILKKGTRETAF   71 (310)
T ss_dssp             ---------------------HHHHHHHHHHHHHHHHHHHHHHTTTSSS-----T-THHHH-TT--S--HHHHH
T ss_pred             CCcccc---cccccccccccCCHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCcccccccccccccCccccee
Confidence            699999   99999999999999999999999999999999999999999998875567887 99999999997


No 3  
>smart00097 WNT1 found in Wnt-1.
Probab=99.88  E-value=4.7e-23  Score=160.61  Aligned_cols=64  Identities=28%  Similarity=0.513  Sum_probs=61.2

Q ss_pred             CCCHHHHHHHhcccchHHHHHHHHHHHHHHHHHhcccCCCCCCCCCCCCCcccccccCCCCCCC
Q psy13231         37 GFSKGQTKICKGWTEIMPHVTKAAYLAANTCTTLFQDRRWNCSSLFLTPKLTPDLITAHSEAEV  100 (100)
Q Consensus        37 gl~~~Q~~lC~~~p~lm~~i~~G~~~ai~ECq~QF~~~RWNCs~~~~~~~~~~~l~~gtREtAf  100 (100)
                      ||+++|+++|+++|++|++|++|+++|++|||+||+++|||||+....+.|++++.+|||||||
T Consensus         4 ~l~~~Q~~~C~~~~~~~~~v~~g~~~ai~ECq~QF~~~rWNCs~~~~~~~~~~~l~~~trEtAf   67 (305)
T smart00097        4 GLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLDNASVFGKVLRQGTRETAF   67 (305)
T ss_pred             ccCHHHHHHHHhCHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCcCCcccccccccccchHHH
Confidence            8999999999999999999999999999999999999999999876667899999999999998


No 4  
>PLN02277 H(+) -translocating inorganic pyrophosphatase
Probab=68.66  E-value=5.2  Score=35.31  Aligned_cols=23  Identities=22%  Similarity=0.254  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhcccC
Q psy13231         52 IMPHVTKAAYLAANTCTTLFQDR   74 (100)
Q Consensus        52 lm~~i~~G~~~ai~ECq~QF~~~   74 (100)
                      .|.+|.+++..-++||++|||..
T Consensus       561 ~m~AVg~aA~~mVeEVRRQFrei  583 (730)
T PLN02277        561 ACAAVGRTAQEVVNEVRRQFAER  583 (730)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcC
Confidence            48899999999999999999875


No 5  
>TIGR01104 V_PPase vacuolar-type H(+)-translocating pyrophosphatase. This model describes proton pyrophosphatases from eukaryotes (predominantly plants), archaea and bacteria. It is an integral membrane protein and is suggested to have about 15 membrane spanning domains. Proton translocating inorganic pyrophosphatase, like H(+)-ATPase, acidifies the vacuoles and is pivotal to the vacuolar secondary active transport systems in plants.
Probab=67.47  E-value=5.6  Score=34.95  Aligned_cols=23  Identities=22%  Similarity=0.206  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhcccC
Q psy13231         52 IMPHVTKAAYLAANTCTTLFQDR   74 (100)
Q Consensus        52 lm~~i~~G~~~ai~ECq~QF~~~   74 (100)
                      .|.+|.+++..-++||++|||..
T Consensus       529 ~m~AVg~aA~~mV~EVRRQFrei  551 (697)
T TIGR01104       529 TMKSVGRAALKMVEEVRRQFNTI  551 (697)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhC
Confidence            48899999999999999999875


No 6  
>PRK00733 hppA membrane-bound proton-translocating pyrophosphatase; Validated
Probab=63.36  E-value=8  Score=33.86  Aligned_cols=24  Identities=21%  Similarity=0.189  Sum_probs=21.7

Q ss_pred             hHHHHHHHHHHHHHHHHHhcccCC
Q psy13231         52 IMPHVTKAAYLAANTCTTLFQDRR   75 (100)
Q Consensus        52 lm~~i~~G~~~ai~ECq~QF~~~R   75 (100)
                      .|.+|.+++...++|+++|||..+
T Consensus       504 ~m~AVg~aA~~mV~EVRrQFre~p  527 (666)
T PRK00733        504 AMTAVGRAAGAMVEEVRRQFREIP  527 (666)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCc
Confidence            478999999999999999999764


No 7  
>PLN02255 H(+) -translocating inorganic pyrophosphatase
Probab=60.64  E-value=8.8  Score=34.09  Aligned_cols=23  Identities=22%  Similarity=0.169  Sum_probs=21.1

Q ss_pred             hHHHHHHHHHHHHHHHHHhcccC
Q psy13231         52 IMPHVTKAAYLAANTCTTLFQDR   74 (100)
Q Consensus        52 lm~~i~~G~~~ai~ECq~QF~~~   74 (100)
                      .|.+|.+++..-++|+++|||..
T Consensus       592 ~m~AVg~aA~~mV~EVRRQFrei  614 (765)
T PLN02255        592 TMKSVGSAALKMVEEVRRQFNTI  614 (765)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhC
Confidence            48899999999999999999875


No 8  
>PF03030 H_PPase:  Inorganic H+ pyrophosphatase;  InterPro: IPR004131 Two types of proteins that hydrolyse inorganic pyrophosphate (PPi), very different in both amino acid sequence and structure, have been characterised to date: soluble and membrane-bound proton-pumping pyrophosphatases (sPPases and H(+)-PPases, respectively). sPPases are ubiquitous proteins that hydrolyse PPi to release heat, whereas H+-PPases, so far unidentified in animal and fungal cells, couple the energy of PPi hydrolysis to proton movement across biological membranes [, ]. The latter type is represented by this group of proteins. H+-PPases (3.6.1.1 from EC) are also called vacuolar-type inorganic pyrophosphatases (V-PPase) or pyrophosphate-energised vacuolar membrane proton pumps []. In plants, vacuoles contain two enzymes for acidifying the interior of the vacuole, the V-ATPase and the V-PPase (V is for vacuolar) []. Two distinct biochemical subclasses of H+-PPases have been characterised to date: K+-stimulated and K+-insensitive [, ]. For additional information please see [, ].; GO: 0004427 inorganic diphosphatase activity, 0009678 hydrogen-translocating pyrophosphatase activity, 0015992 proton transport, 0016020 membrane; PDB: 4A01_A.
Probab=59.28  E-value=8.4  Score=33.80  Aligned_cols=24  Identities=21%  Similarity=0.170  Sum_probs=21.6

Q ss_pred             hHHHHHHHHHHHHHHHHHhcccCC
Q psy13231         52 IMPHVTKAAYLAANTCTTLFQDRR   75 (100)
Q Consensus        52 lm~~i~~G~~~ai~ECq~QF~~~R   75 (100)
                      .|.+|.+++..-++|+++|||..+
T Consensus       529 ~m~aVg~aA~~mV~EvRrQFre~p  552 (682)
T PF03030_consen  529 TMKAVGRAAGKMVEEVRRQFREIP  552 (682)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHST
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCC
Confidence            478999999999999999999874


No 9  
>COG3728 XtmA Phage terminase, small subunit [DNA replication, recombination, and repair]
Probab=37.79  E-value=20  Score=26.52  Aligned_cols=26  Identities=8%  Similarity=0.144  Sum_probs=16.5

Q ss_pred             CCCHHHHHHHhcccchHHHHHHHHHH
Q psy13231         37 GFSKGQTKICKGWTEIMPHVTKAAYL   62 (100)
Q Consensus        37 gl~~~Q~~lC~~~p~lm~~i~~G~~~   62 (100)
                      -||.+|++||..+-.--++-..|++.
T Consensus         2 ~Lt~kQrrF~~eyi~~~naT~sA~~A   27 (179)
T COG3728           2 ELTEKQRRFVDEYIKTFNATQSAIKA   27 (179)
T ss_pred             cccHHHHHHHHHHHHcccHhHHHHHh
Confidence            38999999997655444443344433


No 10 
>PF08058 NPCC:  Nuclear pore complex component;  InterPro: IPR012578 Proteins containing this domain are components of the nuclear pore complex []. One member of this domain is Nucleoporin POM34 (Q12445 from SWISSPROT) which is thought to have a role in anchoring peripheral Nups into the pore and mediating pore formation [].
Probab=36.43  E-value=28  Score=24.48  Aligned_cols=38  Identities=13%  Similarity=0.081  Sum_probs=27.1

Q ss_pred             eecccccccccccCCCCcCCCCcccccccccccCCCHHHHHHHhcccc
Q psy13231          4 VDFHNLQPSEGLQGSTNLNWTSPNDCRRARMEYGFSKGQTKICKGWTE   51 (100)
Q Consensus         4 ~~~~~~~~~~~~~~~s~~~~~~~~~C~~~~~~~gl~~~Q~~lC~~~p~   51 (100)
                      +-.-||+.+++..      +.++..|..++    ||++|+++.--.|.
T Consensus        89 i~~~NIv~al~~L------~r~~D~~~DLP----LT~~QR~LLGL~~~  126 (144)
T PF08058_consen   89 IFLLNIVIALWPL------FRPKDDCSDLP----LTPKQRKLLGLDPS  126 (144)
T ss_pred             HHHHHHHHHHHHH------cCCcCCcccCC----CCHHHHHHcCCCCC
Confidence            4455777655543      23467899998    99999999876666


No 11 
>PF14483 Cut8_M:  Cut8 dimerisation domain; PDB: 3Q5W_A 3Q5X_A.
Probab=30.49  E-value=31  Score=19.09  Aligned_cols=22  Identities=23%  Similarity=0.453  Sum_probs=15.6

Q ss_pred             CCCHHHH-----HHHhcccchHHHHHH
Q psy13231         37 GFSKGQT-----KICKGWTEIMPHVTK   58 (100)
Q Consensus        37 gl~~~Q~-----~lC~~~p~lm~~i~~   58 (100)
                      +|.+.|.     ++|.+||++-..|..
T Consensus         9 ~Ld~~qL~~lL~~l~~~HPei~~~i~~   35 (38)
T PF14483_consen    9 TLDKDQLQSLLQSLCERHPEIQQEIRS   35 (38)
T ss_dssp             TS-HHHHHHHHHHHHHHSTHHHHHHHT
T ss_pred             HcCHHHHHHHHHHHHHhChhHHHHHHh
Confidence            4555554     479999999888764


No 12 
>PF06345 Drf_DAD:  DRF Autoregulatory Domain;  InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs). It binds the N-terminal GTPase-binding domain; this link is broken when GTP-bound Rho binds to the GBD and activates the protein. The addition of diaphanous activating domains (DAD) to mammalian cells induces actin filament formation, stabilises microtubules, and activates serum-response mediated transcription [].; PDB: 3O4X_H 3OBV_E 2BAP_C 2F31_B.
Probab=28.14  E-value=47  Score=14.90  Aligned_cols=13  Identities=15%  Similarity=0.158  Sum_probs=8.9

Q ss_pred             chHHHHHHHHHHH
Q psy13231         51 EIMPHVTKAAYLA   63 (100)
Q Consensus        51 ~lm~~i~~G~~~a   63 (100)
                      ++|.++.++++.+
T Consensus         1 gvmdsllealqtg   13 (15)
T PF06345_consen    1 GVMDSLLEALQTG   13 (15)
T ss_dssp             -HHHHHHHHHHHS
T ss_pred             CcHHHHHHHHHcc
Confidence            3678888887654


No 13 
>PF03592 Terminase_2:  Terminase small subunit ;  InterPro: IPR005335 Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].; GO: 0006323 DNA packaging; PDB: 3ZQP_B 2CMP_A 3ZQO_C 3ZQN_B 3ZQQ_B 3ZQM_D.
Probab=26.75  E-value=22  Score=24.19  Aligned_cols=15  Identities=7%  Similarity=0.184  Sum_probs=10.2

Q ss_pred             CCHHHHHHHhcccch
Q psy13231         38 FSKGQTKICKGWTEI   52 (100)
Q Consensus        38 l~~~Q~~lC~~~p~l   52 (100)
                      ||++|+.||..+..-
T Consensus         1 LT~kQ~~F~~~Yl~~   15 (144)
T PF03592_consen    1 LTPKQKRFVDEYLKD   15 (144)
T ss_dssp             --HHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHhc
Confidence            789999999765553


No 14 
>KOG4114|consensus
Probab=23.36  E-value=1.1e+02  Score=19.47  Aligned_cols=30  Identities=20%  Similarity=0.262  Sum_probs=25.0

Q ss_pred             HHHHhcccch--HHHHHHHHHHHHHHHHHhcc
Q psy13231         43 TKICKGWTEI--MPHVTKAAYLAANTCTTLFQ   72 (100)
Q Consensus        43 ~~lC~~~p~l--m~~i~~G~~~ai~ECq~QF~   72 (100)
                      -+-|..+|+.  ++..-.+...+..||+.+.-
T Consensus        29 ~reCldn~~~~~vPeeC~al~~af~dCKRslv   60 (73)
T KOG4114|consen   29 PRECLDNPELKDVPEECIALMKAFLDCKRSLV   60 (73)
T ss_pred             HHHHhcCCccccCcHHHHHHHHHHHHHHHHHH
Confidence            3469999998  88888889999999998753


No 15 
>PF08688 ASD1:  Apx/Shroom domain ASD1;  InterPro: IPR014800 Cell shape changes require the coordination of actin and microtubule cytoskeletons. The Shroom family is a small group of related proteins that are defined by sequence similarity and in most cases by some link to the actin cytoskeleton. The Shroom (Shrm) protein family is found only in animals. Proteins of this family are predicted to be utilised in multiple morphogenic and developmental processes across animal phyla to regulate cells shape or intracellular architecture in an actin and myosin-dependent manner []. While the founding member of the Shrm family is Shrm1 (formerly Apx), it appears that this protein is found only in Xenopus []. In mice and humans, the Shrm family of proteins consists of:  Shrm2 (formerly Apxl), a protein involved in the morphogenesis, maintenance, and/or function of vascular endothelial cells.  Shrm3 (formerly Shroom), a protein necessary for neural tube closure in vertebrate development as deficiency in Shrm results in spina bifida. Shrm3 is also conserved in some invertebrates, as orthologues can be found in sea urchins.  Shrm4, a regulator of cyto-skeletal architecture that may play an important role in vertebrate development. It is implicated in X-linked mental retardation in humans.    This protein family is based on the conservation of a specific arrangement of an N-terminal PDZ domain, a centrally positioned sequence motif termed ASD1 (Apx/Shrm Domain 1) and a C-terminal motif termed ASD2 [, , ]. Shrm2 and Shrm3 contain all three domains, while Shrm4 contains the PDZ and ASD2 domains, but lacks a discernible ASD1 element. To date, the ASD1 and ASD2 elements have only been found in Shrm-related proteins and do not appear in combination with other conserved domains. ASD1 is required for targeting actin, while ASD2 is capable of eliciting an actomyosin based constriction event [, ]. ASD2 is the most highly conserved sequence element shared by Shrm1, Shrm2, Shrm3, and Shrm4. It possesses a well conserved series of leucine residues that exhibit spacing consistent with that of a leucine zipper motif [].  This region is found in the actin binding protein Shroom. ASD1 has been implicated directly in F-actin binding. 
Probab=21.77  E-value=50  Score=24.46  Aligned_cols=27  Identities=26%  Similarity=0.128  Sum_probs=23.9

Q ss_pred             ccccccccccCCCHHHHHHHhcccchHHHHH
Q psy13231         27 NDCRRARMEYGFSKGQTKICKGWTEIMPHVT   57 (100)
Q Consensus        27 ~~C~~~~~~~gl~~~Q~~lC~~~p~lm~~i~   57 (100)
                      .+|.+-+    ||..|+..|...|+=|+-|.
T Consensus       123 RiGgRkR----lTaEQKkrSYSEPEKmneVG  149 (182)
T PF08688_consen  123 RIGGRKR----LTAEQKKRSYSEPEKMNEVG  149 (182)
T ss_pred             ccccccc----CCHHHhhhccCCchhhhhcc
Confidence            4777766    99999999999999999886


No 16 
>KOG3588|consensus
Probab=20.77  E-value=58  Score=27.31  Aligned_cols=28  Identities=18%  Similarity=0.460  Sum_probs=21.5

Q ss_pred             CcCCCCcccccccccccCCCHHHHHHHhcccch
Q psy13231         20 NLNWTSPNDCRRARMEYGFSKGQTKICKGWTEI   52 (100)
Q Consensus        20 ~~~~~~~~~C~~~~~~~gl~~~Q~~lC~~~p~l   52 (100)
                      -.++..+..|+.     .|++.|.++|......
T Consensus       434 l~H~~H~~~C~~-----~l~p~Qy~mC~~SkA~  461 (494)
T KOG3588|consen  434 LFHLWHPKRCDD-----NLTPEQYRMCIGSKAM  461 (494)
T ss_pred             eEEeecccccCC-----CCCHHHHHHHhhhhhh
Confidence            346677889975     6999999999776543


No 17 
>PF04418 DUF543:  Domain of unknown function (DUF543);  InterPro: IPR007512 This family of short eukaryotic proteins has no known function. Most of the members of this family are only 80 amino acid residues long. However the Arabidopsis homologue is over 300 residues long. These proteins contain a conserved N-terminal cysteine and a conserved motif GXGXGXG in the carboxy terminal half that may be functionally important.
Probab=20.52  E-value=52  Score=20.89  Aligned_cols=16  Identities=19%  Similarity=0.212  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHhcc
Q psy13231         57 TKAAYLAANTCTTLFQ   72 (100)
Q Consensus        57 ~~G~~~ai~ECq~QF~   72 (100)
                      .-|+=+|..+|++.|+
T Consensus        60 G~G~G~aY~~c~~~f~   75 (75)
T PF04418_consen   60 GFGIGMAYSECQRDFN   75 (75)
T ss_pred             ccccchhHHHHHHhcC
Confidence            4467788899999884


Done!