Diaphorina citri psyllid: psy13234

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190--

MNRAEMSSDDIVSGGLLLFSFTFTTYLVSLERNYRLPTAPPQGHGLVLLVFWTMLLIFANLTFVNLKRLDWWFSLKTLDDKIEMYIFVVYYVGSLTLFVLGLKAPGLTHTRNYYNLNGDSSSSQNNLESERLMHTGSTWAGAAKKIKTLAPFLWPKKSALLKLQVIICILLLIIARVINLFVPISKMEFCPPNISFFDVWVNHGTSACFMDTVSSSILATFLLLFGGTQLWMYKKYSNRATNVLPSKLYYFQIFMSVLMCLVVVVKYALEAALIHQRTLFMYQIVSGGLLLFSFTFATYLVSLERNYRLPTAPPQGHGLVLLVFWTMLLIFANLTFVNLKRLDWWFSLKTQNNLESERLMHTGSTWAGAAKKIKTLAPFLWPKKSALLKLQVIICILLLIIARVINLFVPIYNRLLVIIIIIIILSGWETLNMNSLVDKPLVFRWDYVLIFVGFKFLQGGGTGGMGVLNNVRSLLWIGVQQYTTREIEIELFRHLHGLSLRWHLSRKTGEVLRVMNRGTDSISNLLNYVLFQIIPTILDIVIAIVFFVSTFSTWYGVIVFTTMALYLGKNTVGERGLKLSGGEKQRVAIALNSLVDKPLVFRWDYVLIFVGFKFLQGGGTGGMGVLNNVRSLLWIGVQQYTTREIEIELFRHLHGLSLRWHLSRKTGEVLRVMNRGTDSISNLLNYVLFQIIPTILDIVIAIVFFVSTFSTWYGVIVFTTMALYLVTSIVVTEWRTKFQRKMNLADNALNTRSIDSLLNFETVKYYGAEEYEIKEYGKAIQTYQVAEYQNSLSLVFLNSLQNLIITGGLLAGSLLCVHEVVNNQTLTVGDYTLFVSYILQLYVPLNWFDALTRYLEASLVPLPKKTNAKECRTISCICHLTKAVTRIVLKRIENKIEENMEEDQFGFRKGKGTRDAIGCLRMIALESQLVWYLLQVGQSGAGKSTIIRLLFRFYDVESGDIFIDNQNIKTVSQASLRQAIGVVPQDTVLFNNSIKFNIQYARINASEEEVKEAATSADIHERILSFPDGYDTQYARINASEEEVKEAATSADIHERILSFPDGYDTQVGERGLKLSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLSTIIHADEILVMHAGEIVERGRHEELLERNGVYASMWIQQNTKQSEPSSDESPPSSTAQ

ccccccccHHHHHHHHHHHHHHHHHHEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEccccccEEEEEHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHcEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccEEEEEEEEEEEEccccccccccccccccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEcccccccccHHHHHHcccccccccccccccHHHHHHcccccccHHHHHHHHHHccccHHHcccccccccHHHHHcccHHHHHHHHHHcHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEccEEEEEccHHHHHHcccccHHHHHHHHcccccccccccccccccc

********DDIVSGGLLLFSFTFTTYLVSLERNYRLPTAPPQGHGLVLLVFWTMLLIFANLTFVNLKRLDWWFSLKTLDDKIEMYIFVVYYVGSLTLFVLGLKAPGLTHTRNYYNL*******************GSTWAGAAKKIKTLAPFLWPKKSALLKLQVIICILLLIIARVINLFVPISKMEFCPPNISFFDVWVNHGTSACFMDTVSSSILATFLLLFGGTQLWMYKKYSNRATNVLPSKLYYFQIFMSVLMCLVVVVKYALEAALIHQRTLFMYQIVSGGLLLFSFTFATYLVSLERNYRLPTAPPQGHGLVLLVFWTMLLIFANLTFVNLKRLDWWFSLKTQN***SERLMHTGSTWAGAAKKIKTLAPFLWPKKSALLKLQVIICILLLIIARVINLFVPIYNRLLVIIIIIIILSGWETLNMNSLVDKPLVFRWDYVLIFVGFKFLQGGGTGGMGVLNNVRSLLWIGVQQYTTREIEIELFRHLHGLSLRWHLSRKTGEVLRVMNRGTDSISNLLNYVLFQIIPTILDIVIAIVFFVSTFSTWYGVIVFTTMALYLGKNTVGERGLKLSGGEKQRVAIALNSLVDKPLVFRWDYVLIFVGFKFLQGGGTGGMGVLNNVRSLLWIGVQQYTTREIEIELFRHLHGLSLRWHLSRKTGEVLRVMNRGTDSISNLLNYVLFQIIPTILDIVIAIVFFVSTFSTWYGVIVFTTMALYLVTSIVVTEWRTKFQRKMNLADNALNTRSIDSLLNFETVKYYGAEEYEIKEYGKAIQTYQVAEYQNSLSLVFLNSLQNLIITGGLLAGSLLCVHEVVNNQTLTVGDYTLFVSYILQLYVPLNWFDALTRYLEASLVPLPKKTNAKECRTISCICHLTKAVTRIVLKRIENKIEENMEEDQFGFRKGKGTRDAIGCLRMIALESQLVWYLLQVGQSGAGKSTIIRLLFRFYDVESGDIFIDNQNIKTVSQASLRQAIGVVPQDTVLFNNSIKFNIQYARINASEEEVKEAATSADIHERILSFPDGYDTQYARINASEEEVKEAATSADIHERILSFPDGYDTQVGERGLKLSGGEKQRVAIARTLLKAPQIVLLDEATSALDTKTERNIQSALNRVCASRTTIIVAHRLSTIIHADEILVMHAGEIVERGRHEELLERNGVYASMWI*********************

xxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxHHxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxHxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-binding cassette sub-family B member 6, mitochondrial	Binds heme and porphyrins and functions in their ATP-dependent uptake into the mitochondria. Plays a crucial role in heme synthesis.	confident	Q9DC29
ATP-binding cassette sub-family B member 6, mitochondrial	Binds heme and porphyrins and functions in their ATP-dependent uptake into the mitochondria. Plays a crucial role in heme synthesis.	confident	Q9NP58
ATP-binding cassette sub-family B member 6, mitochondrial	Binds heme and porphyrins and functions in their ATP-dependent uptake into the mitochondria. Plays a crucial role in heme synthesis.	confident	Q08D64

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031967 [CC]	organelle envelope	probable	GO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 623-1014,1049-1174
View the alignment between query and template
View the model in PyMOL

Template: 1G6H, chain A
Confidence level:very confident
Coverage over the Query: 896-1055,1067-1159
View the alignment between query and template
View the model in PyMOL

Template: 4F4C, chain A
Confidence level:very confident
Coverage over the Query: 503-1014,1049-1175
View the alignment between query and template
View the model in PyMOL

Template: 3B5X, chain A
Confidence level:very confident
Coverage over the Query: 371-417,434-517
View the alignment between query and template
View the model in PyMOL