Query         psy13237
Match_columns 84
No_of_seqs    107 out of 211
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:39:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13237.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13237hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01267 F-actin_cap_A:  F-acti 100.0   3E-31 6.5E-36  197.5   9.1   81    3-83    161-243 (271)
  2 KOG0836|consensus              100.0 1.7E-30 3.7E-35  193.6   8.6   82    2-83    167-250 (282)
  3 PF07661 MORN_2:  MORN repeat v  79.9     2.5 5.3E-05   19.2   2.3   14   24-37      5-18  (22)
  4 PF09911 DUF2140:  Uncharacteri  75.7      18 0.00039   25.7   6.7   35   12-46     79-124 (187)
  5 PF09906 DUF2135:  Uncharacteri  71.0     2.6 5.7E-05   24.1   1.3   18   17-34      2-19  (50)
  6 PF08863 YolD:  YolD-like prote  54.3      11 0.00024   22.8   1.9   22   18-39     40-61  (92)
  7 cd08678 C2_C21orf25-like C2 do  51.4      14 0.00031   23.5   2.2   18   15-32    107-124 (126)
  8 COG3177 Fic family protein [Fu  50.1     5.4 0.00012   30.6   0.0   12   23-34    190-201 (348)
  9 KOG0024|consensus               49.3     5.1 0.00011   31.7  -0.2   18   19-36     40-57  (354)
 10 COG2989 Uncharacterized protei  49.0      13 0.00028   31.1   2.1   18   24-41    334-351 (561)
 11 smart00676 DM10 Domains in hyp  48.3      29 0.00064   22.4   3.3   34    4-39      6-41  (104)
 12 PRK08404 V-type ATP synthase s  46.9      32 0.00068   22.2   3.3   21   55-75      2-22  (103)
 13 PF13068 DUF3932:  Protein of u  45.9     3.1 6.8E-05   26.0  -1.5   17    2-18     15-31  (81)
 14 cd08400 C2_Ras_p21A1 C2 domain  44.7      18 0.00038   23.3   1.9   16   15-30    110-125 (126)
 15 cd01254 PH_PLD Phospholipase D  43.9      25 0.00054   22.9   2.5   27    1-27     29-66  (121)
 16 PF13708 Methyltransf_27:  Meth  42.9      23  0.0005   25.1   2.3   20   22-41    158-178 (194)
 17 PF13695 zf-3CxxC:  Zinc-bindin  37.2      39 0.00084   21.4   2.5   22   18-39     17-38  (98)
 18 PF02661 Fic:  Fic/DOC family;   33.6     8.1 0.00018   23.0  -1.0    9   24-32     77-85  (97)
 19 cd06408 PB1_NoxR The PB1 domai  33.0      27 0.00058   22.3   1.2   11   20-30      2-12  (86)
 20 PF14332 DUF4388:  Domain of un  32.4      49  0.0011   20.1   2.4   24   16-39     20-49  (103)
 21 PF07166 DUF1398:  Protein of u  31.6 1.2E+02  0.0026   20.5   4.3   17   24-40     41-58  (125)
 22 PF02246 B1:  Protein L b1 doma  31.4      52  0.0011   20.1   2.2   18   21-39     10-27  (69)
 23 PF03544 TonB_C:  Gram-negative  30.3      89  0.0019   17.7   3.2   21   15-35     12-32  (79)
 24 TIGR02887 spore_ger_x_C germin  29.5   2E+02  0.0043   21.7   5.7   25   19-44    255-279 (371)
 25 KOG3859|consensus               28.4 1.1E+02  0.0023   24.5   4.1   51   20-72     78-134 (406)
 26 PF13216 DUF4024:  Protein of u  26.1      76  0.0016   16.9   2.0   23   19-41      3-25  (35)
 27 PHA02762 hypothetical protein;  25.7 1.6E+02  0.0034   17.6   3.8   40    2-41      9-48  (62)
 28 PF12476 DUF3696:  Protein of u  25.4      50  0.0011   18.5   1.4    8   22-29      5-12  (52)
 29 PF14231 GXWXG:  GXWXG protein   25.0      24 0.00051   21.0  -0.0   11    1-11     15-25  (60)
 30 PHA02633 hypothetical protein;  24.8      76  0.0016   19.2   2.2   21   14-34     41-61  (63)
 31 PF09266 VirDNA-topo-I_N:  Vira  24.3      92   0.002   18.6   2.4   31   27-62      2-32  (58)
 32 PF14593 PH_3:  PH domain; PDB:  24.3 2.1E+02  0.0045   18.5   6.0   57    9-69     42-103 (104)
 33 KOG4173|consensus               22.5      22 0.00047   26.7  -0.6   19   52-70     85-103 (253)
 34 PF12637 TSCPD:  TSCPD domain;   22.2   1E+02  0.0023   19.3   2.6   24   17-40      6-33  (95)
 35 PLN03113 DNA ligase 1; Provisi  22.2 1.2E+02  0.0026   26.2   3.6   31    4-41    392-422 (744)
 36 PF11080 DUF2622:  Protein of u  21.6      55  0.0012   21.3   1.2   10   22-31     10-19  (96)
 37 PF07104 DUF1366:  Protein of u  21.1 2.3E+02   0.005   18.9   4.1   16   65-80     59-74  (116)
 38 cd07900 Adenylation_DNA_ligase  21.0      96  0.0021   22.1   2.5   21   21-41     42-62  (219)
 39 PF10106 DUF2345:  Uncharacteri  21.0      74  0.0016   21.7   1.8   37    3-42     62-101 (155)
 40 PF03714 PUD:  Bacterial pullan  20.9      69  0.0015   20.1   1.5    8   22-29      3-10  (103)
 41 PF09346 SMI1_KNR4:  SMI1 / KNR  20.9      70  0.0015   19.2   1.5   21   59-79      5-25  (130)
 42 PF07270 DUF1438:  Protein of u  20.8      33 0.00072   24.0   0.0   10   24-33     45-54  (151)
 43 PF14977 FAM194:  FAM194 protei  20.7      62  0.0013   23.7   1.4   19   24-42     70-88  (208)
 44 PF15121 TMEM71:  TMEM71 protei  20.3      47   0.001   23.3   0.7   12   29-40     81-92  (149)
 45 KOG0967|consensus               20.1      84  0.0018   27.2   2.2   19   22-40    377-395 (714)

No 1  
>PF01267 F-actin_cap_A:  F-actin capping protein alpha subunit;  InterPro: IPR002189 This entry represents a component of the WASH complex. The WASH complex is present at the surface of endosomes and recruits and activates the Arp2/3 complex to induce actin polymerisation. The WASH complex plays a key role in the fission of tubules that serve as transport intermediates during endosome sorting []. The WASH complex's subunit structure: F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH (WASH1, WASH2P, WASH3P, WASH4P, WASH5P or WASH6P), FAM21 (FAM21A, FAM21B or FAM21C), KIAA1033, KIAA0196 (strumpellin) and CCDC53. The actin filament system, a prominent part of the cytoskeleton in eukaryotic cells, is both a static structure and a dynamic network that can undergo rearrangements: it is thought to be involved in processes such as cell movement and phagocytosis [], as well as muscle contraction. The F-actin capping protein binds in a calcium-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike gelsolin and severin this protein does not sever actin filaments. The F-actin capping protein is a heterodimer composed of two unrelated subunits: alpha and beta (see IPR001698 from INTERPRO). Neither of the subunits shows sequence similarity to other filament-capping proteins []. The alpha subunit is a protein of about 268 to 286 amino acid residues whose sequence is well conserved in eukaryotic species [].; GO: 0003779 actin binding, 0030036 actin cytoskeleton organization, 0008290 F-actin capping protein complex; PDB: 1MQ1_D 1MWN_X 2KBM_Y 2KZ7_A 3AAE_C 3AA6_A 3LK4_G 1IZN_A 3AA7_A 3AAA_A ....
Probab=99.97  E-value=3e-31  Score=197.48  Aligned_cols=81  Identities=44%  Similarity=0.677  Sum_probs=73.9

Q ss_pred             cccceeEee--CCCceEEEEEEEeeEeeecccEEEEeccceecceeecCchhhHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy13237          3 DRSLADFIE--GNNVEVKGNLKVQVHYYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIEESETAYQQAISENYMIIR   80 (84)
Q Consensus         3 ~~w~~~~~~--~~~~~l~G~I~V~vHYyEdGNVqL~s~k~~~~~~~~s~~~~~A~~iv~~I~~~E~~~q~~L~e~y~~Ls   80 (84)
                      |||||.|.-  ..+.+|+|+|+|+|||||||||||+++|++..++.++++.++|++||++|+++|++||++|+++|++||
T Consensus       161 G~WrS~w~~~~~~~~~l~G~I~V~vHYyEdGNVqL~~~k~~~~~~~~~~~~~~a~~iv~~I~~~E~~~q~~L~e~~~~ls  240 (271)
T PF01267_consen  161 GRWRSEWTVDFSSSGTLSGKIKVQVHYYEDGNVQLNSSKEVSETVSVSNDEQFASDIVKAIKEAENKYQTSLNESYNNLS  240 (271)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEEEE-TTEEEEEEEEEEEEEEEE--SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceeeEEEEEecCCCceEEEEEEeeEEEEeecEEEEEEccccceeeccCChhhhHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            999999994  356799999999999999999999999999999998888899999999999999999999999999999


Q ss_pred             ccC
Q psy13237         81 KTC   83 (84)
Q Consensus        81 e~t   83 (84)
                      ++|
T Consensus       241 ~~t  243 (271)
T PF01267_consen  241 EKT  243 (271)
T ss_dssp             HTH
T ss_pred             HHH
Confidence            975


No 2  
>KOG0836|consensus
Probab=99.97  E-value=1.7e-30  Score=193.64  Aligned_cols=82  Identities=54%  Similarity=0.786  Sum_probs=77.5

Q ss_pred             CcccceeEeeC-C-CceEEEEEEEeeEeeecccEEEEeccceecceeecCchhhHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy13237          2 FDRSLADFIEG-N-NVEVKGNLKVQVHYYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIEESETAYQQAISENYMII   79 (84)
Q Consensus         2 ~~~w~~~~~~~-~-~~~l~G~I~V~vHYyEdGNVqL~s~k~~~~~~~~s~~~~~A~~iv~~I~~~E~~~q~~L~e~y~~L   79 (84)
                      -|||||.|.-+ . ..+|+|.|+|||||||||||||.++|++.+++.+++..++|++++++|+++||+||++|+++|++|
T Consensus       167 NG~WRS~w~~~v~~~~~l~G~i~vqvHYyEdGNV~l~s~Kd~qds~~vsn~~q~a~e~~~iI~~~Eneyq~ai~e~yq~l  246 (282)
T KOG0836|consen  167 NGRWRSEWNYDVQPTTELKGRIKVQVHYYEDGNVQLVSSKDIQDSLTVSNEVQTAKEFIKIIEEAENEYQAAISENYQTL  246 (282)
T ss_pred             CCceeeeeeeccCchheeeeEEEEEEEEEecCcEEEEecCcchhhheeechHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            49999999932 2 589999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccC
Q psy13237         80 RKTC   83 (84)
Q Consensus        80 se~t   83 (84)
                      ||+|
T Consensus       247 sD~t  250 (282)
T KOG0836|consen  247 SDTT  250 (282)
T ss_pred             ChhH
Confidence            9986


No 3  
>PF07661 MORN_2:  MORN repeat variant;  InterPro: IPR011652 This entry represents an apparent variant of the IPR003409 from INTERPRO repeat.
Probab=79.93  E-value=2.5  Score=19.21  Aligned_cols=14  Identities=29%  Similarity=0.572  Sum_probs=10.7

Q ss_pred             eeEeeecccEEEEe
Q psy13237         24 QVHYYEDGNVQLVS   37 (84)
Q Consensus        24 ~vHYyEdGNVqL~s   37 (84)
                      ...||++|+++-..
T Consensus         5 ~~~yy~nG~l~~~~   18 (22)
T PF07661_consen    5 WKFYYENGKLKSEG   18 (22)
T ss_pred             EEEEeCCCCEEEEE
Confidence            45799999987654


No 4  
>PF09911 DUF2140:  Uncharacterized protein conserved in bacteria (DUF2140);  InterPro: IPR018672  This family of conserved hypothetical proteins has no known function. 
Probab=75.71  E-value=18  Score=25.70  Aligned_cols=35  Identities=34%  Similarity=0.413  Sum_probs=22.2

Q ss_pred             CCCceEEEEEEE---eeEe--------eecccEEEEeccceeccee
Q psy13237         12 GNNVEVKGNLKV---QVHY--------YEDGNVQLVSSKDIKETVV   46 (84)
Q Consensus        12 ~~~~~l~G~I~V---~vHY--------yEdGNVqL~s~k~~~~~~~   46 (84)
                      +....+.|++++   +|.|        -|+|||+|+...----+++
T Consensus        79 ~~~v~l~g~~~vlg~~v~~~~~f~P~V~~nGnv~L~~~s~svG~L~  124 (187)
T PF09911_consen   79 DDQVYLYGTIKVLGQDVPLYMYFDPEVLENGNVQLKAKSLSVGTLP  124 (187)
T ss_pred             CCEEEEEEEEEECcEEEEEEEEEEEEEecCCcEEEEeceeEecCcc
Confidence            445677777654   3333        3999999998765433333


No 5  
>PF09906 DUF2135:  Uncharacterized protein conserved in bacteria (DUF2135);  InterPro: IPR019220  This entry, found in various hypothetical prokaryotic proteins, has no known function. 
Probab=71.04  E-value=2.6  Score=24.06  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=15.9

Q ss_pred             EEEEEEEeeEeeecccEE
Q psy13237         17 VKGNLKVQVHYYEDGNVQ   34 (84)
Q Consensus        17 l~G~I~V~vHYyEdGNVq   34 (84)
                      +.|.=+|.||||-+++-.
T Consensus         2 ~~G~Y~VyVnYyg~~~~~   19 (50)
T PF09906_consen    2 PPGTYLVYVNYYGNRSQS   19 (50)
T ss_pred             CCceEEEEEEeccCCCcC
Confidence            468899999999999877


No 6  
>PF08863 YolD:  YolD-like protein;  InterPro: IPR014962 These proteins are functionally uncharacterised. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from Gram-negative bacteria []. 
Probab=54.27  E-value=11  Score=22.78  Aligned_cols=22  Identities=41%  Similarity=0.644  Sum_probs=16.4

Q ss_pred             EEEEEEeeEeeecccEEEEecc
Q psy13237         18 KGNLKVQVHYYEDGNVQLVSSK   39 (84)
Q Consensus        18 ~G~I~V~vHYyEdGNVqL~s~k   39 (84)
                      .....|.+.||++|+.+=.+.+
T Consensus        40 ~~~~~v~ity~~~g~~~~~~G~   61 (92)
T PF08863_consen   40 QENQPVTITYYEDGYYQSVTGT   61 (92)
T ss_pred             cCCCEEEEEEEECCeeEEEEEE
Confidence            3456788999999998765544


No 7  
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein. The members in this cd are named after the Human C21orf25 which contains a single C2 domain.  Several other members contain a C1 domain downstream of the C2 domain.  No other information on this protein is currently known. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a 
Probab=51.36  E-value=14  Score=23.55  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=15.8

Q ss_pred             ceEEEEEEEeeEeeeccc
Q psy13237         15 VEVKGNLKVQVHYYEDGN   32 (84)
Q Consensus        15 ~~l~G~I~V~vHYyEdGN   32 (84)
                      ....|.|.++++|++..+
T Consensus       107 ~~~~G~l~l~~~~~~~~~  124 (126)
T cd08678         107 DSVSGSITVEFLFMEPAE  124 (126)
T ss_pred             CCcceEEEEEEEEecccc
Confidence            568999999999999874


No 8  
>COG3177 Fic family protein [Function unknown]
Probab=50.13  E-value=5.4  Score=30.65  Aligned_cols=12  Identities=42%  Similarity=0.678  Sum_probs=10.0

Q ss_pred             EeeEeeecccEE
Q psy13237         23 VQVHYYEDGNVQ   34 (84)
Q Consensus        23 V~vHYyEdGNVq   34 (84)
                      +-+|.|+|||=+
T Consensus       190 e~IHPF~DGNGR  201 (348)
T COG3177         190 EYIHPFEDGNGR  201 (348)
T ss_pred             HhccccccCccH
Confidence            458999999965


No 9  
>KOG0024|consensus
Probab=49.32  E-value=5.1  Score=31.66  Aligned_cols=18  Identities=33%  Similarity=0.584  Sum_probs=13.8

Q ss_pred             EEEEEeeEeeecccEEEE
Q psy13237         19 GNLKVQVHYYEDGNVQLV   36 (84)
Q Consensus        19 G~I~V~vHYyEdGNVqL~   36 (84)
                      |.---+||||++|+.-.-
T Consensus        40 GICGSDvHy~~~G~ig~~   57 (354)
T KOG0024|consen   40 GICGSDVHYYTHGRIGDF   57 (354)
T ss_pred             EecCccchhhccCCcCcc
Confidence            444568999999998654


No 10 
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.97  E-value=13  Score=31.10  Aligned_cols=18  Identities=33%  Similarity=0.552  Sum_probs=15.0

Q ss_pred             eeEeeecccEEEEeccce
Q psy13237         24 QVHYYEDGNVQLVSSKDI   41 (84)
Q Consensus        24 ~vHYyEdGNVqL~s~k~~   41 (84)
                      .++|||||++.|.+.--+
T Consensus       334 ~l~y~~~G~~vl~~rvVV  351 (561)
T COG2989         334 SLEYYENGREVLRSRVVV  351 (561)
T ss_pred             eeeeEeCCcEEEEEEEEe
Confidence            579999999999886544


No 11 
>smart00676 DM10 Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases.
Probab=48.32  E-value=29  Score=22.37  Aligned_cols=34  Identities=18%  Similarity=0.276  Sum_probs=23.1

Q ss_pred             ccceeEeeCCCceEEEEE-EEeeEee-ecccEEEEecc
Q psy13237          4 RSLADFIEGNNVEVKGNL-KVQVHYY-EDGNVQLVSSK   39 (84)
Q Consensus         4 ~w~~~~~~~~~~~l~G~I-~V~vHYy-EdGNVqL~s~k   39 (84)
                      |+.+.|.++....  |.+ ++.++|| |||-|.+...+
T Consensus         6 rF~a~~~d~~~~~--~~~R~~~i~yyl~D~Tvei~E~~   41 (104)
T smart00676        6 RFDAYWEDPVAMF--YLIRRFKIYYYLEDDTIEVFEPD   41 (104)
T ss_pred             EEEEEEecCCCCc--CcEEEEEEEEECCCCeEEEEEcc
Confidence            5677888754322  555 6778877 79999998543


No 12 
>PRK08404 V-type ATP synthase subunit H; Validated
Probab=46.90  E-value=32  Score=22.19  Aligned_cols=21  Identities=19%  Similarity=0.374  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy13237         55 REIVKLIEESETAYQQAISEN   75 (84)
Q Consensus        55 ~~iv~~I~~~E~~~q~~L~e~   75 (84)
                      .++++.|+++|.+|+..|.+.
T Consensus         2 ~e~i~~ik~aE~~~e~~L~~A   22 (103)
T PRK08404          2 EDVIKEIVKAEKEAEERIEKA   22 (103)
T ss_pred             hHHHHHHHHHHHHHHHHHHHH
Confidence            367999999999999988765


No 13 
>PF13068 DUF3932:  Protein of unknown function (DUF3932)
Probab=45.94  E-value=3.1  Score=25.96  Aligned_cols=17  Identities=24%  Similarity=0.628  Sum_probs=14.0

Q ss_pred             CcccceeEeeCCCceEE
Q psy13237          2 FDRSLADFIEGNNVEVK   18 (84)
Q Consensus         2 ~~~w~~~~~~~~~~~l~   18 (84)
                      |+||-+.|+++...+|.
T Consensus        15 fdrwvssfvsdhpaql~   31 (81)
T PF13068_consen   15 FDRWVSSFVSDHPAQLE   31 (81)
T ss_pred             HHHHHHHHhcCCccccc
Confidence            78999999987776664


No 14 
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1). RasA1 is a GAP1 (GTPase activating protein 1), a Ras-specific GAP member, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA1 contains a C2 domain,  a Ras-GAP domain, a pleckstrin homology (PH)-like domain, a SH3 domain, and 2 SH2 domains. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficki
Probab=44.69  E-value=18  Score=23.29  Aligned_cols=16  Identities=19%  Similarity=0.397  Sum_probs=13.8

Q ss_pred             ceEEEEEEEeeEeeec
Q psy13237         15 VEVKGNLKVQVHYYED   30 (84)
Q Consensus        15 ~~l~G~I~V~vHYyEd   30 (84)
                      ....|.|.+.++|+||
T Consensus       110 ~~~~G~i~l~l~~~~~  125 (126)
T cd08400         110 GGEWGSLRIRARYSHE  125 (126)
T ss_pred             CCcCcEEEEEEEEEcc
Confidence            3566999999999997


No 15 
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain. Phospholipase D (PLD) pleckstrin homology (PH) domain.  PLD hydrolyzes phosphatidylcholine to phosphatidic acid (PtdOH), which can bind target proteins. PLD contains a PH domain, a PX domain and four conserved PLD signature domains. The PLD PH domain is specific for bisphosphorylated inositides. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=43.92  E-value=25  Score=22.92  Aligned_cols=27  Identities=15%  Similarity=0.257  Sum_probs=20.0

Q ss_pred             CCcccceeEee-----------CCCceEEEEEEEeeEe
Q psy13237          1 MFDRSLADFIE-----------GNNVEVKGNLKVQVHY   27 (84)
Q Consensus         1 ~~~~w~~~~~~-----------~~~~~l~G~I~V~vHY   27 (84)
                      |..+|..+|+.           |....+.|.|.++..|
T Consensus        29 ~~~~w~kRWFvlr~s~L~Y~~~~~~~~~~~vil~D~~f   66 (121)
T cd01254          29 MCDRWQKRWFIVKESFLAYMDDPSSAQILDVILFDVDF   66 (121)
T ss_pred             cccCCcceeEEEeCCEEEEEcCCCCCceeeEEEEcCCc
Confidence            34689999982           3356899999987665


No 16 
>PF13708 Methyltransf_27:  Methyltransferase domain
Probab=42.88  E-value=23  Score=25.08  Aligned_cols=20  Identities=20%  Similarity=0.554  Sum_probs=16.5

Q ss_pred             EEeeEeeecccEEEEe-ccce
Q psy13237         22 KVQVHYYEDGNVQLVS-SKDI   41 (84)
Q Consensus        22 ~V~vHYyEdGNVqL~s-~k~~   41 (84)
                      -+.|-||..||++|.. +.++
T Consensus       158 ~f~vR~fkkGt~Hi~fk~~dl  178 (194)
T PF13708_consen  158 YFRVRYFKKGTAHITFKRPDL  178 (194)
T ss_pred             cEEEEEecCCcEEEEECCHHH
Confidence            4789999999999998 4444


No 17 
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=37.23  E-value=39  Score=21.38  Aligned_cols=22  Identities=18%  Similarity=0.345  Sum_probs=18.1

Q ss_pred             EEEEEEeeEeeecccEEEEecc
Q psy13237         18 KGNLKVQVHYYEDGNVQLVSSK   39 (84)
Q Consensus        18 ~G~I~V~vHYyEdGNVqL~s~k   39 (84)
                      ++.+.|.+|+|+.|-|....=+
T Consensus        17 S~~v~i~f~~~~~g~v~~rv~~   38 (98)
T PF13695_consen   17 SAKVWILFHMYRGGQVNMRVFG   38 (98)
T ss_pred             cCEEEEEEEEcCCCeEEEEEEC
Confidence            5788999999999988876543


No 18 
>PF02661 Fic:  Fic/DOC family;  InterPro: IPR003812 This entry contains the Fic (filamentation induced by cAMP) protein and doc (death on curing) protein. The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism []. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation []. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1 []. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family.; PDB: 3SHG_A 3N3V_A 3N3U_A 2F6S_B 2JK8_B 2VZA_D 2VY3_A 3LET_B 3EQX_A 3SE5_D ....
Probab=33.61  E-value=8.1  Score=22.98  Aligned_cols=9  Identities=44%  Similarity=0.921  Sum_probs=7.1

Q ss_pred             eeEeeeccc
Q psy13237         24 QVHYYEDGN   32 (84)
Q Consensus        24 ~vHYyEdGN   32 (84)
                      .+|-|.|||
T Consensus        77 ~iHPF~dGN   85 (97)
T PF02661_consen   77 YIHPFRDGN   85 (97)
T ss_dssp             HHCSSSSHH
T ss_pred             hcCcccCCC
Confidence            468888888


No 19 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=33.04  E-value=27  Score=22.28  Aligned_cols=11  Identities=36%  Similarity=0.730  Sum_probs=8.7

Q ss_pred             EEEEeeEeeec
Q psy13237         20 NLKVQVHYYED   30 (84)
Q Consensus        20 ~I~V~vHYyEd   30 (84)
                      +|+|.|||-+|
T Consensus         2 ~ikVKv~~~~D   12 (86)
T cd06408           2 KIRVKVHAQDD   12 (86)
T ss_pred             cEEEEEEecCc
Confidence            68999998555


No 20 
>PF14332 DUF4388:  Domain of unknown function (DUF4388)
Probab=32.44  E-value=49  Score=20.08  Aligned_cols=24  Identities=38%  Similarity=0.547  Sum_probs=16.7

Q ss_pred             eEEEEEEEee------EeeecccEEEEecc
Q psy13237         16 EVKGNLKVQV------HYYEDGNVQLVSSK   39 (84)
Q Consensus        16 ~l~G~I~V~v------HYyEdGNVqL~s~k   39 (84)
                      +-+|.+.|+.      =||+||.|---+..
T Consensus        20 ~ktG~L~v~~~~~~~~i~f~~G~iv~A~~~   49 (103)
T PF14332_consen   20 RKTGVLEVQSGGGEGRIYFRDGRIVHASSG   49 (103)
T ss_pred             CCeEEEEEEeCCcEEEEEEECCEEEEEEeC
Confidence            5567766633      49999998766655


No 21 
>PF07166 DUF1398:  Protein of unknown function (DUF1398);  InterPro: IPR009833 This entry is represented by Bacteriophage DE3, Orf: ECD_10033. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Enterobacterial proteins of around 130 residues in length. Members of this family seem to be found exclusively in Escherichia coli and Salmonella species. The function of this family is unknown.; PDB: 2HH8_A.
Probab=31.61  E-value=1.2e+02  Score=20.50  Aligned_cols=17  Identities=12%  Similarity=0.110  Sum_probs=7.4

Q ss_pred             eeEee-ecccEEEEeccc
Q psy13237         24 QVHYY-EDGNVQLVSSKD   40 (84)
Q Consensus        24 ~vHYy-EdGNVqL~s~k~   40 (84)
                      ++||| ++|+.=...++.
T Consensus        41 ~~~y~~~~d~~V~~~~~~   58 (125)
T PF07166_consen   41 NTTYVGENDYTVSSKGNY   58 (125)
T ss_dssp             EEEEE-SSS-EEEEE-ST
T ss_pred             cEEEEEcCCCEEEecccc
Confidence            35665 666544443333


No 22 
>PF02246 B1:  Protein L b1 domain;  InterPro: IPR003147 Protein L is a bacterial protein with immunoglobulin (Ig) light chain-binding properties. It contains a number of homologous b1 repeats towards the N terminus. These repeats have been found to be responsible for the interaction of protein L with Ig light chains [].; PDB: 1KH0_A 1K52_A 1JML_A 2PTL_A 1K50_B 1HZ6_C 1HZ5_B 1K53_B 2KAC_A 2JZP_A ....
Probab=31.37  E-value=52  Score=20.07  Aligned_cols=18  Identities=28%  Similarity=0.506  Sum_probs=12.2

Q ss_pred             EEEeeEeeecccEEEEecc
Q psy13237         21 LKVQVHYYEDGNVQLVSSK   39 (84)
Q Consensus        21 I~V~vHYyEdGNVqL~s~k   39 (84)
                      |+.++ ||+||-+|--.-|
T Consensus        10 ik~nl-ifadg~tqtaefk   27 (69)
T PF02246_consen   10 IKANL-IFADGSTQTAEFK   27 (69)
T ss_dssp             EEEEE-EETTSEEEEEEEE
T ss_pred             EEEEE-EEccCcEEEEEee
Confidence            44443 8999999965433


No 23 
>PF03544 TonB_C:  Gram-negative bacterial TonB protein C-terminal;  InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria []. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetitive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to span the periplasm.  Iron is essential for growth in both bacteria and mammals. Controlling the amount of free iron in solution is often used as a tactic by hosts to limit invasion of pathogenic microbes; binding iron tightly within protein molecules can accomplish this. Some bacteria express surface receptors to capture eukaryotic iron-binding compounds, while others have evolved siderophores to scavenge iron from iron-binding host proteins [].  The absence of free iron molecules in the surrounding environment triggers transcription of gene clusters that encode both siderophore-synthesis ezymes, and receptors that recognise iron-bound siderophores []. An example of the latter is Escherichia coli fepA, which resides in the outer envelope and captures iron-bound enterobactin [].  To complete transport of bound iron across the inner membrane, a second receptor complex is needed. The major component of this is tonB, a 27kDa protein that facilitates energy transfer from the proton motive force to outer receptors. B-12 and colicin receptors also make use of the tonB system to drive active transport at the outer membrane.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016020 membrane, 0030288 outer membrane-bounded periplasmic space; PDB: 1U07_B 1IHR_A 2GRX_C 2GSK_B 1QXX_A 1XX3_A 2K9K_A.
Probab=30.33  E-value=89  Score=17.74  Aligned_cols=21  Identities=24%  Similarity=0.332  Sum_probs=18.6

Q ss_pred             ceEEEEEEEeeEeeecccEEE
Q psy13237         15 VEVKGNLKVQVHYYEDGNVQL   35 (84)
Q Consensus        15 ~~l~G~I~V~vHYyEdGNVqL   35 (84)
                      ..++|.+.|.++-=+||+|.-
T Consensus        12 ~~~~G~v~v~~~I~~~G~v~~   32 (79)
T PF03544_consen   12 RGIEGTVVVEFTIDPDGRVSD   32 (79)
T ss_dssp             HTEEEEEEEEEEEETTTEEEE
T ss_pred             CCCeEEEEEEEEEeCCCCEEE
Confidence            467999999999999999974


No 24 
>TIGR02887 spore_ger_x_C germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc.
Probab=29.46  E-value=2e+02  Score=21.69  Aligned_cols=25  Identities=8%  Similarity=0.243  Sum_probs=15.0

Q ss_pred             EEEEEeeEeeecccEEEEeccceecc
Q psy13237         19 GNLKVQVHYYEDGNVQLVSSKDIKET   44 (84)
Q Consensus        19 G~I~V~vHYyEdGNVqL~s~k~~~~~   44 (84)
                      ++.++.+++ ++|.+++.-.=.++..
T Consensus       255 ~~~~i~~~~-~~~~~~~~i~i~~~~~  279 (371)
T TIGR02887       255 SKTKIKIKV-KGGKPHFKIHIKLEGR  279 (371)
T ss_pred             cccEEEEEE-ECCeEEEEEEEEEEEE
Confidence            456677775 7777666555444433


No 25 
>KOG3859|consensus
Probab=28.36  E-value=1.1e+02  Score=24.45  Aligned_cols=51  Identities=31%  Similarity=0.432  Sum_probs=33.6

Q ss_pred             EEEEeeEeee--cccEEEEeccceecceeec---CchhhHHHHHHHHHH-HHHHHHHHH
Q psy13237         20 NLKVQVHYYE--DGNVQLVSSKDIKETVVVT---SEEQTAREIVKLIEE-SETAYQQAI   72 (84)
Q Consensus        20 ~I~V~vHYyE--dGNVqL~s~k~~~~~~~~s---~~~~~A~~iv~~I~~-~E~~~q~~L   72 (84)
                      .++++.+-||  .+||||+-+-.  +++-+.   +.+...+-||..|.+ +|+-.|..|
T Consensus        78 ~V~L~~~TyelqEsnvrlKLtiv--~tvGfGDQinK~~Syk~iVdyidaQFEaYLQEEL  134 (406)
T KOG3859|consen   78 NVKLQANTYELQESNVRLKLTIV--DTVGFGDQINKEDSYKPIVDYIDAQFEAYLQEEL  134 (406)
T ss_pred             CceeecchhhhhhcCeeEEEEEE--eecccccccCcccccchHHHHHHHHHHHHHHHHH
Confidence            4677777776  89999986532  233332   446678889998864 566666554


No 26 
>PF13216 DUF4024:  Protein of unknown function (DUF4024)
Probab=26.08  E-value=76  Score=16.88  Aligned_cols=23  Identities=17%  Similarity=0.368  Sum_probs=16.4

Q ss_pred             EEEEEeeEeeecccEEEEeccce
Q psy13237         19 GNLKVQVHYYEDGNVQLVSSKDI   41 (84)
Q Consensus        19 G~I~V~vHYyEdGNVqL~s~k~~   41 (84)
                      |---...|.|.|-||.|-.--++
T Consensus         3 glsvt~lhlfrde~vnflfcief   25 (35)
T PF13216_consen    3 GLSVTNLHLFRDEKVNFLFCIEF   25 (35)
T ss_pred             ceEEEEEEEeecCCccEEEEehh
Confidence            33345689999999998765443


No 27 
>PHA02762 hypothetical protein; Provisional
Probab=25.71  E-value=1.6e+02  Score=17.63  Aligned_cols=40  Identities=15%  Similarity=0.298  Sum_probs=32.6

Q ss_pred             CcccceeEeeCCCceEEEEEEEeeEeeecccEEEEeccce
Q psy13237          2 FDRSLADFIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDI   41 (84)
Q Consensus         2 ~~~w~~~~~~~~~~~l~G~I~V~vHYyEdGNVqL~s~k~~   41 (84)
                      ||.-.-.|..+......|...|.+--=|+||+..-+-.+.
T Consensus         9 fgnlii~~~rs~~ks~eg~afvtigide~g~iayisiep~   48 (62)
T PHA02762          9 FGNLIIEFKRNVEKSFEGEAFVTIGIDENDKISYISIEPL   48 (62)
T ss_pred             CccEEEEEecCccccccccEEEEEeECCCCcEEEEEeccc
Confidence            6666777776667788999999999999999998776654


No 28 
>PF12476 DUF3696:  Protein of unknown function (DUF3696);  InterPro: IPR022532  This domain is found in bacteria and archaea, and is approximately 50 amino acids in length. 
Probab=25.36  E-value=50  Score=18.46  Aligned_cols=8  Identities=25%  Similarity=0.783  Sum_probs=6.5

Q ss_pred             EEeeEeee
Q psy13237         22 KVQVHYYE   29 (84)
Q Consensus        22 ~V~vHYyE   29 (84)
                      +|.||||+
T Consensus         5 ~v~i~ff~   12 (52)
T PF12476_consen    5 DVSIYFFE   12 (52)
T ss_pred             HEEEEEEE
Confidence            48899994


No 29 
>PF14231 GXWXG:  GXWXG protein
Probab=24.95  E-value=24  Score=21.03  Aligned_cols=11  Identities=18%  Similarity=0.184  Sum_probs=8.4

Q ss_pred             CCcccceeEee
Q psy13237          1 MFDRSLADFIE   11 (84)
Q Consensus         1 ~~~~w~~~~~~   11 (84)
                      |+|||+..-+.
T Consensus        15 m~G~W~G~~f~   25 (60)
T PF14231_consen   15 MLGRWRGGEFD   25 (60)
T ss_pred             heEecccCccC
Confidence            78999877664


No 30 
>PHA02633 hypothetical protein; Provisional
Probab=24.79  E-value=76  Score=19.25  Aligned_cols=21  Identities=5%  Similarity=0.045  Sum_probs=17.2

Q ss_pred             CceEEEEEEEeeEeeecccEE
Q psy13237         14 NVEVKGNLKVQVHYYEDGNVQ   34 (84)
Q Consensus        14 ~~~l~G~I~V~vHYyEdGNVq   34 (84)
                      +.--.++|.++||=.+++||-
T Consensus        41 t~c~~~si~l~V~~~~~~~ip   61 (63)
T PHA02633         41 TYSDMMKFDLCICLRIESNID   61 (63)
T ss_pred             CeeEEEEEEEEEeeccccccc
Confidence            345678999999999999874


No 31 
>PF09266 VirDNA-topo-I_N:  Viral DNA topoisomerase I, N-terminal;  InterPro: IPR015346 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents a domain foundpredominantly found in viral DNA topoisomerase I, a type IB enzyme. This domain assumes a beta(2)-alpha-beta-alpha-beta(2) fold, with a left-handed crossover between strands beta2 and beta3 [].  More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change; PDB: 3IGC_A 2H7G_X 2H7F_X 1VCC_A.
Probab=24.34  E-value=92  Score=18.64  Aligned_cols=31  Identities=29%  Similarity=0.434  Sum_probs=16.3

Q ss_pred             eeecccEEEEeccceecceeecCchhhHHHHHHHHH
Q psy13237         27 YYEDGNVQLVSSKDIKETVVVTSEEQTAREIVKLIE   62 (84)
Q Consensus        27 YyEdGNVqL~s~k~~~~~~~~s~~~~~A~~iv~~I~   62 (84)
                      ||-||++  -..|++...++.   +.-+-+|++.|+
T Consensus         2 ~yk~gkl--f~dk~~~~~v~~---~n~~yeIlk~~K   32 (58)
T PF09266_consen    2 YYKDGKL--FFDKIYTNPVPD---DNPTYEILKKYK   32 (58)
T ss_dssp             EEETTEE--ESSTTS-SB--T---T-THHHHHHH--
T ss_pred             ccccceE--EechhhCCCCCC---ccHHHHHHHHcC
Confidence            7888875  455666655554   334677777664


No 32 
>PF14593 PH_3:  PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A.
Probab=24.33  E-value=2.1e+02  Score=18.55  Aligned_cols=57  Identities=21%  Similarity=0.311  Sum_probs=36.6

Q ss_pred             EeeCCCceEEEEEEEeeEeeecccEEEEeccceecc-----eeecCchhhHHHHHHHHHHHHHHHH
Q psy13237          9 FIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDIKET-----VVVTSEEQTAREIVKLIEESETAYQ   69 (84)
Q Consensus         9 ~~~~~~~~l~G~I~V~vHYyEdGNVqL~s~k~~~~~-----~~~s~~~~~A~~iv~~I~~~E~~~q   69 (84)
                      +++|....++|.|-+.    .+=.|++++.+.+...     ..+..++..|..=+++|++.=..|.
T Consensus        42 Yvdp~~~~~KGeI~~~----~~l~v~~k~~~~F~I~tp~RtY~l~d~~~~A~~W~~~I~~~~~~~~  103 (104)
T PF14593_consen   42 YVDPKKMVLKGEIPWS----KELSVEVKSFKTFFIHTPKRTYYLEDPEGNAQQWVEAIEEVKKQYY  103 (104)
T ss_dssp             EEETTTTEEEEEE--S----TT-EEEECSSSEEEEEETTEEEEEE-TTS-HHHHHHHHHHHHHHHH
T ss_pred             EEECCCCeECcEEecC----CceEEEEccCCEEEEECCCcEEEEECCCCCHHHHHHHHHHHHHHhc
Confidence            4577788999999887    5556777776665422     2334667789999999988765553


No 33 
>KOG4173|consensus
Probab=22.46  E-value=22  Score=26.75  Aligned_cols=19  Identities=11%  Similarity=0.335  Sum_probs=13.3

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy13237         52 QTAREIVKLIEESETAYQQ   70 (84)
Q Consensus        52 ~~A~~iv~~I~~~E~~~q~   70 (84)
                      .-+-.+.+.|...|.-|.+
T Consensus        85 agc~~~~d~lD~~E~hY~~  103 (253)
T KOG4173|consen   85 AGCCQVFDALDDYEHHYHT  103 (253)
T ss_pred             cchHHHHhhhhhHHHhhhh
Confidence            3456778888888877743


No 34 
>PF12637 TSCPD:  TSCPD domain;  InterPro: IPR024434 The domain is found in isolation in many proteins where it has a conserved C-terminal motif TSCPD, after which the domain is named. Most copies of the domain possess 4 conserved cysteines that may be part of an Iron-sulphur cluster. This domain is found at the C terminus of some ribonucleoside-diphosphate reductase enzymes.
Probab=22.23  E-value=1e+02  Score=19.32  Aligned_cols=24  Identities=38%  Similarity=0.451  Sum_probs=17.8

Q ss_pred             EEEEEEEeeEeeec-cc---EEEEeccc
Q psy13237         17 VKGNLKVQVHYYED-GN---VQLVSSKD   40 (84)
Q Consensus        17 l~G~I~V~vHYyEd-GN---VqL~s~k~   40 (84)
                      ..|++.|.|-|+|| |+   |=.+..|.
T Consensus         6 ~~g~~yvtv~~d~d~g~p~Evf~~~~~~   33 (95)
T PF12637_consen    6 GCGKLYVTVNFDEDNGRPFEVFINVGKA   33 (95)
T ss_pred             cccceEEEEEeeCCCCcceEEEEecCcC
Confidence            45789999999999 77   55555444


No 35 
>PLN03113 DNA ligase 1; Provisional
Probab=22.20  E-value=1.2e+02  Score=26.24  Aligned_cols=31  Identities=23%  Similarity=0.427  Sum_probs=23.3

Q ss_pred             ccceeEeeCCCceEEEEEEEeeEeeecccEEEEeccce
Q psy13237          4 RSLADFIEGNNVEVKGNLKVQVHYYEDGNVQLVSSKDI   41 (84)
Q Consensus         4 ~w~~~~~~~~~~~l~G~I~V~vHYyEdGNVqL~s~k~~   41 (84)
                      .|..+|+-++       .++|+||-++|.|+|-|..--
T Consensus       392 ~~~~E~KyDG-------eR~QiH~~~~g~v~lfSRn~e  422 (744)
T PLN03113        392 EFTCEYKYDG-------ERAQIHFLEDGSVEIYSRNAE  422 (744)
T ss_pred             CEEEEEeecc-------ceEEEEEecCCEEEEEeCCCC
Confidence            5666666543       489999999999999776543


No 36 
>PF11080 DUF2622:  Protein of unknown function (DUF2622);  InterPro: IPR022597  This family is conserved in the Enterobacteriaceae family. The function is not known. 
Probab=21.60  E-value=55  Score=21.33  Aligned_cols=10  Identities=40%  Similarity=0.607  Sum_probs=7.9

Q ss_pred             EEeeEeeecc
Q psy13237         22 KVQVHYYEDG   31 (84)
Q Consensus        22 ~V~vHYyEdG   31 (84)
                      -|.|||+|+|
T Consensus        10 VVt~~~~e~~   19 (96)
T PF11080_consen   10 VVTFEYQEAG   19 (96)
T ss_pred             EEEEEeccCC
Confidence            4788888877


No 37 
>PF07104 DUF1366:  Protein of unknown function (DUF1366);  InterPro: IPR009796 This entry is represented by Streptococcus phage 7201, Orf40. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 130 residues in length. One of the sequences in this family, from phage Sfi11 (O80186 from SWISSPROT) is known as Gp149. The function of this family is unknown. 
Probab=21.12  E-value=2.3e+02  Score=18.94  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHhhhh
Q psy13237         65 ETAYQQAISENYMIIR   80 (84)
Q Consensus        65 E~~~q~~L~e~y~~Ls   80 (84)
                      |+--+.+.+|.|+.+.
T Consensus        59 e~~p~rA~~Ekf~kvd   74 (116)
T PF07104_consen   59 ENFPQRAENEKFQKVD   74 (116)
T ss_pred             HhchhHHHHHHHHHHH
Confidence            3444678888888776


No 38 
>cd07900 Adenylation_DNA_ligase_I_Euk Adenylation domain of eukaryotic DNA Ligase I. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriophages, eukarya, archaea and bacteria. Some organisms express a variety of different ligases which appear to be targeted to specific functions. There are three classes of ATP-dependent DNA ligases in eukaryotic cells (I, III and IV). DNA ligase I is required for the ligation of Okazaki fragments during lagging-strand DNA synthesis and for base excision repair (BER). DNA ligases have a highly modular architecture consisting of a unique arrangement of two or more discrete domains. The adenylation and C-terminal oligonucleotide/oligo
Probab=21.02  E-value=96  Score=22.12  Aligned_cols=21  Identities=33%  Similarity=0.499  Sum_probs=17.2

Q ss_pred             EEEeeEeeecccEEEEeccce
Q psy13237         21 LKVQVHYYEDGNVQLVSSKDI   41 (84)
Q Consensus        21 I~V~vHYyEdGNVqL~s~k~~   41 (84)
                      +++++|+-.+|.|+|-|..--
T Consensus        42 ~R~~~h~~~~~~v~l~SR~g~   62 (219)
T cd07900          42 ERAQIHLLEDGKVKIFSRNLE   62 (219)
T ss_pred             eEEEEEEcCCCeEEEECCCCc
Confidence            478899987899999887654


No 39 
>PF10106 DUF2345:  Uncharacterized protein conserved in bacteria (DUF2345);  InterPro: IPR018769 This entry represents the C-terminal domain of a subset of the Rhs element Vgr protein family found only in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often encoded far from the type VI secretion locus.
Probab=20.98  E-value=74  Score=21.73  Aligned_cols=37  Identities=19%  Similarity=0.513  Sum_probs=25.2

Q ss_pred             cccceeEeeCCCceE---EEEEEEeeEeeecccEEEEecccee
Q psy13237          3 DRSLADFIEGNNVEV---KGNLKVQVHYYEDGNVQLVSSKDIK   42 (84)
Q Consensus         3 ~~w~~~~~~~~~~~l---~G~I~V~vHYyEdGNVqL~s~k~~~   42 (84)
                      |+..+-|.......+   .|.|.+|.|   +|++.|.+.|++.
T Consensus        62 ~~~islfa~~~Gi~liA~~G~v~iqAq---~~~~~l~A~k~i~  101 (155)
T PF10106_consen   62 GEGISLFAQKGGIKLIAAQGKVEIQAQ---SDDMELTAKKDIT  101 (155)
T ss_pred             hceEEEEEcccceeEEEcCCcEEEEEc---CCchhhhccCcEE
Confidence            344555662222233   689999998   7888888888875


No 40 
>PF03714 PUD:  Bacterial pullanase-associated domain;  InterPro: IPR005323 Domain is found in pullanase - carbohydrate de-branching - proteins. It is found both to the N or the C-termini of of the alpha-amylase active site region. This domain contains several conserved aromatic residues that are suggestive of a carbohydrate binding function.; GO: 0030246 carbohydrate binding, 0005975 carbohydrate metabolic process; PDB: 2J43_A 2J44_A 2YA1_A 2FHC_A 2FHB_A 2FHF_A 2J73_B 2J72_A 2J71_A.
Probab=20.90  E-value=69  Score=20.10  Aligned_cols=8  Identities=50%  Similarity=0.849  Sum_probs=5.8

Q ss_pred             EEeeEeee
Q psy13237         22 KVQVHYYE   29 (84)
Q Consensus        22 ~V~vHYyE   29 (84)
                      .|.|||+.
T Consensus         3 ~v~vhY~r   10 (103)
T PF03714_consen    3 TVRVHYHR   10 (103)
T ss_dssp             EEEEEEES
T ss_pred             EEEEEEEC
Confidence            57788873


No 41 
>PF09346 SMI1_KNR4:  SMI1 / KNR4 family (SUKH-1);  InterPro: IPR018958  Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation [, ].  Yeast members of this family are involved in the regulation of cell wall assembly. Saccharomyces cerevisiae (Baker's yeast) protein KNR4 (SMI1) has a regulatory role in chitin deposition and in cell wall assembly []. It was originally identified as a regulator of chitin synthase expression (acting as a repressor) [] and of 1,3-beta-glucan synthase levels []. It was shown to localise in patches at presumptive bud sites in unbudded cells and at the incipient bud site during bud emergence []. KNR4 is believed to connect the PKC1-SLT2 MAPK pathway with cell proliferation. It has been shown to interact with BCK2, a gene involved in cell cycle progression in S. cerevisiae (forming a complex) to allow PKC1 to coordinate the cell cycle (cell proliferation) with cell wall integrity [, ]. PKC1 plays an essential role in cell wall integrity and cell proliferation through a bifurcated PKC1/mitogen-activated protein (MAP) kinase pathway. KNR4 also interacts with the tyrosine-tRNA synthetase protein encoded by TYS1 and is involved in sporulation process [].  Note: previously reported evidence that KNR4 may interact with nuclear matrix-association region [] may be due to an artefact [].; PDB: 3D5P_A 2ICG_A.
Probab=20.88  E-value=70  Score=19.24  Aligned_cols=21  Identities=19%  Similarity=0.294  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q psy13237         59 KLIEESETAYQQAISENYMII   79 (84)
Q Consensus        59 ~~I~~~E~~~q~~L~e~y~~L   79 (84)
                      +.|+++|.+++..|-+.|..+
T Consensus         5 ~~I~~~E~~lg~~LP~~yk~f   25 (130)
T PF09346_consen    5 EEIQELEEKLGVRLPDDYKEF   25 (130)
T ss_dssp             HHHHHHHHHHTS---HHHHHH
T ss_pred             HHHHHHHHHhCCCCcHHHHHH
Confidence            568999999999998888765


No 42 
>PF07270 DUF1438:  Protein of unknown function (DUF1438);  InterPro: IPR009895 This family consists of several hypothetical proteins of around 170 residues in length, which appear to be mouse specific. The function of this family is unknown.
Probab=20.79  E-value=33  Score=24.03  Aligned_cols=10  Identities=40%  Similarity=0.561  Sum_probs=8.7

Q ss_pred             eeEeeecccE
Q psy13237         24 QVHYYEDGNV   33 (84)
Q Consensus        24 ~vHYyEdGNV   33 (84)
                      +-||||||=+
T Consensus        45 ~SHc~edgWi   54 (151)
T PF07270_consen   45 PSHCSEDGWI   54 (151)
T ss_pred             CcccccCCce
Confidence            6799999976


No 43 
>PF14977 FAM194:  FAM194 protein
Probab=20.74  E-value=62  Score=23.68  Aligned_cols=19  Identities=26%  Similarity=0.363  Sum_probs=15.1

Q ss_pred             eeEeeecccEEEEecccee
Q psy13237         24 QVHYYEDGNVQLVSSKDIK   42 (84)
Q Consensus        24 ~vHYyEdGNVqL~s~k~~~   42 (84)
                      -.=||+.||++|+-+..-.
T Consensus        70 g~~y~~~g~~~l~l~~~gG   88 (208)
T PF14977_consen   70 GTCYHPNGNIWLVLNQEGG   88 (208)
T ss_pred             EEEEcCCCCEEEEEECCCC
Confidence            3459999999999887643


No 44 
>PF15121 TMEM71:  TMEM71 protein family
Probab=20.26  E-value=47  Score=23.27  Aligned_cols=12  Identities=50%  Similarity=0.803  Sum_probs=10.1

Q ss_pred             ecccEEEEeccc
Q psy13237         29 EDGNVQLVSSKD   40 (84)
Q Consensus        29 EdGNVqL~s~k~   40 (84)
                      |||||.|+-+..
T Consensus        81 ~dGNITLsPsqT   92 (149)
T PF15121_consen   81 EDGNITLSPSQT   92 (149)
T ss_pred             CCCCEeecCccc
Confidence            899999987764


No 45 
>KOG0967|consensus
Probab=20.07  E-value=84  Score=27.17  Aligned_cols=19  Identities=37%  Similarity=0.688  Sum_probs=16.3

Q ss_pred             EEeeEeeecccEEEEeccc
Q psy13237         22 KVQVHYYEDGNVQLVSSKD   40 (84)
Q Consensus        22 ~V~vHYyEdGNVqL~s~k~   40 (84)
                      +.|||+-|||+|..-+...
T Consensus       377 RAQIH~~edG~v~IfSRN~  395 (714)
T KOG0967|consen  377 RAQIHKLEDGTVEIFSRNS  395 (714)
T ss_pred             eeeeEEccCCcEEEEeccc
Confidence            6799999999999877654


Done!