Diaphorina citri psyllid: psy13242


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MTLLGSRLSITLDSSLGENEQDANSALAELEKGLRSSKIGEQCEAIVRFPTLFEKYPFPILINSSFLKLADVFRGG
ccccccHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
************************SALAELEKGLRSSKIGEQCEAIVRFPTLFEKYPFPILINSSFLKLADVFRGG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLLGSRLSITLDSSLGENEQDANSALAELEKGLRSSKIGEQCEAIVRFPTLFEKYPFPILINSSFLKLADVFRGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Integrator complex subunit 7 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Plays a role in DNA damage response (DDR) signaling during the S phase.confidentQ1RMS6
Integrator complex subunit 7 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Plays a role in DNA damage response (DDR) signaling during the S phase.confidentQ9NVH2
Integrator complex subunit 7 Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. May play a role in DNA damage response (DDR) signaling during the S phase.confidentQ5ZL91

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071479 [BP]cellular response to ionizing radiationprobableGO:0009628, GO:0051716, GO:0071478, GO:0010212, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0071214, GO:0044699
GO:0005694 [CC]chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0032039 [CC]integrator complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0034472 [BP]snRNA 3'-end processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0016180, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0034470, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0043628, GO:0046483, GO:0016070, GO:0044238, GO:0016073, GO:0044237, GO:0043170, GO:0006396
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000077 [BP]DNA damage checkpointprobableGO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted