Diaphorina citri psyllid: psy1324


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MLFLHGFPESWYIWKHQMSEFSHEYWTVAVDIKTNFRTIADRYFLVDSLKVFLDHLGRNRCILIGRDFGGSLVWSFLDKYPELVVKSIIINVPHPAVFKQELKKMSQLIKTRSGK
cEEEccccccccccHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEEEccccccHHHHHHccHHHHHHHcccc
MLFLHGFPESWYIWKHQMSEFSHEYWTVAVDIKTNFRTIADRYFLVDSLKVFLDHLGRNRCILIGRDFGGSLVWSFLDKYPELVVKSIIINVPHPAVFKQELKK****IKTR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFLHGFPESWYIWKHQMSEFSHEYWTVAVDIKTNFRTIADRYFLVDSLKVFLDHLGRNRCILIGRDFGGSLVWSFLDKYPELVVKSIIINVPHPAVFKQELKKMSQLIKTRSGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0004301 [MF]epoxide hydrolase activityprobableGO:0016801, GO:0016787, GO:0016803, GO:0003674, GO:0003824
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044255 [BP]cellular lipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G9X, chain A
Confidence level:very confident
Coverage over the Query: 1-96
View the alignment between query and template
View the model in PyMOL