Diaphorina citri psyllid: psy13254


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
NEYAHSGFPEISYGKFAQTLVEKGYKVARVEQTESAEQMDIRTKRDKVPQKQRVVRREICKITCRGAQTFSIMDVDANYVDNKFLLGVTKEGDRLGVCFIDTTIGEFHVGEFEDDKQFSRLSTLMSHYPPCR
ccccccccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccccccccEEEEcEEEEEccccccccccccccccccccEEEEEECcccEEEEEEEEcccccEEEEEEcccHHHHHHHHHHccccccc
NEYAHSGFPEISYGKFAQTLVEKGYKVARVEQTES******************VVRREICKITCRGAQTFSIMDVDANYVDNKFLLGVTKEGDRLGVCFIDTTIGEFHVGEFEDDKQFSRLSTLMSHYPPC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NEYAHSGFPEISYGKFAQTLVEKGYKVARVEQTESAEQMDIRTKRDKVPQKQRVVRREICKITCRGAQTFSIMDVDANYVDNKFLLGVTKEGDRLGVCFIDTTIGEFHVGEFEDDKQFSRLSTLMSHYPPCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable DNA mismatch repair protein Msh6 Involved in post-replicative DNA-mismatch repair.confidentQ9VUM0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032137 [MF]guanine/thymine mispair bindingprobableGO:0043566, GO:0097159, GO:0030983, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003690, GO:1901363
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0000400 [MF]four-way junction DNA bindingprobableGO:0043566, GO:0097159, GO:0000217, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003684 [MF]damaged DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O8B, chain B
Confidence level:very confident
Coverage over the Query: 2-132
View the alignment between query and template
View the model in PyMOL