Query         psy13264
Match_columns 112
No_of_seqs    106 out of 220
Neff          5.3 
Searched_HMMs 46136
Date          Sat Aug 17 00:19:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13264.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13264hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03045 DAN:  DAN domain;  Int  99.8 1.7E-19 3.7E-24  128.5   9.2   77   28-104    23-102 (121)
  2 smart00041 CT C-terminal cysti  99.8 1.5E-19 3.3E-24  120.4   7.2   71   38-111     2-72  (82)
  3 PF00007 Cys_knot:  Cystine-kno  99.4 8.3E-14 1.8E-18   96.2   3.1   78   34-112     3-81  (105)
  4 PF05463 Sclerostin:  Sclerosti  97.1  0.0013 2.7E-08   50.9   5.9   81   31-111    64-150 (198)
  5 smart00068 GHB Glycoprotein ho  92.4     1.2 2.5E-05   31.6   7.6   74   33-109     3-79  (107)
  6 cd00069 GHB Glycoprotein hormo  92.3    0.83 1.8E-05   32.0   6.7   72   35-109     1-75  (102)
  7 PF00019 TGF_beta:  Transformin  71.7     2.7 5.9E-05   28.3   1.7   52   51-102    25-88  (105)
  8 smart00204 TGFB Transforming g  48.3      28 0.00061   23.6   3.4   53   51-103    22-86  (102)
  9 PF10956 DUF2756:  Protein of u  44.4     9.8 0.00021   26.8   0.6   18    8-25      4-21  (104)
 10 PF02495 7kD_coat:  7kD viral c  39.5      30 0.00064   21.3   2.2   20   31-50     23-42  (59)
 11 PHA02661 vascular endothelial   38.6      56  0.0012   24.2   3.9   56   27-96     40-102 (146)
 12 PF07172 GRP:  Glycine rich pro  31.5      19  0.0004   24.7   0.4   18    8-25      6-23  (95)
 13 PLN00213 predicted protein; Pr  30.7      12 0.00026   27.0  -0.7   22    1-22      1-22  (118)
 14 PRK13240 pbsY photosystem II p  27.9      31 0.00067   20.4   0.8   14    8-21      3-16  (40)
 15 PF10645 Carb_bind:  Carbohydra  27.6      19 0.00041   22.4  -0.1   20   51-70     24-43  (52)
 16 CHL00196 psbY photosystem II p  25.6      39 0.00084   19.5   0.9   14    8-21      3-16  (36)
 17 KOG3900|consensus               24.1      45 0.00098   27.6   1.4   75   33-108   311-402 (413)
 18 PF15240 Pro-rich:  Proline-ric  21.7      46   0.001   25.5   1.0   15   11-25      2-16  (179)
 19 PF07754 DUF1610:  Domain of un  21.2      61  0.0013   17.0   1.1   16   85-100     6-21  (24)
 20 PTZ00459 mucin-associated surf  21.1      44 0.00095   27.0   0.8   14    9-23      8-21  (291)
 21 PF15117 UPF0697:  Uncharacteri  20.8      65  0.0014   22.3   1.5   22    4-25     18-39  (99)
 22 PF06298 PsbY:  Photosystem II   20.7      56  0.0012   18.9   1.0   14    8-21      3-16  (36)

No 1  
>PF03045 DAN:  DAN domain;  InterPro: IPR004133 This domain contains 9 conserved cysteines and is extracellular. Therefore the cysteines may form disulphide bridges. This family of proteins has been termed the DAN family [] after the first member to be reported. This family includes DAN, Cerberus and Gremlin. The gremlin protein is an antagonist of bone morphogenetic protein signalling. It is postulated that all members of this family antagonize different TGF beta TGF-beta ligands [].
Probab=99.81  E-value=1.7e-19  Score=128.50  Aligned_cols=77  Identities=32%  Similarity=0.556  Sum_probs=68.3

Q ss_pred             cccCCCCceEeeeEEEEecCCCeeccEecceeeCccCceeeeccc--c-ccccCccccCCCCCceEEEEEEEeCCCCCCc
Q psy13264         28 TAASSDDCQVTPVIHVLQYPGCVPKPIPSFACTGRCSSYLQVSGS--K-IWTMERSCLCCQESGEREASVSLFCPKAKEG  104 (112)
Q Consensus        28 ~~~~~~~Ck~~~~~~~I~~~GC~~~~V~~~~C~G~C~S~S~YS~~--~-~~~~~~sCsCCqe~~t~~~~V~L~CpdGs~~  104 (112)
                      ....++||++++++|+|+++||.+++|.|++|+|+|+||++.+..  + ....+++|+||+|.++++..|+|+||++...
T Consensus        23 ~~~~~~~Ck~~p~~Q~I~~~GC~s~~I~N~~C~GqC~S~~iP~~~~~~~~~~~~~~C~~C~P~~~~~~~V~L~C~~~~~~  102 (121)
T PF03045_consen   23 QPLKRDWCKTVPFTQVISHPGCESVTIQNNFCFGQCSSFYIPSSVPSDPGSQPFQSCSCCQPSRFRWVTVTLRCPGGSPP  102 (121)
T ss_pred             cccccCccEEEeeEEEECcCCceEEEEEeeeeEEEcceEEeeCCcccccccccCcccCccCCCeeEEEEEEEECcCCCCC
Confidence            456789999999999999999999999999999999999998731  2 2224899999999999999999999999966


No 2  
>smart00041 CT C-terminal cystine knot-like domain (CTCK). The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.
Probab=99.80  E-value=1.5e-19  Score=120.35  Aligned_cols=71  Identities=28%  Similarity=0.624  Sum_probs=65.5

Q ss_pred             eeeEEEEecCCCeeccEecceeeCccCceeeeccccccccCccccCCCCCceEEEEEEEeCCCCCCcceeEEEc
Q psy13264         38 TPVIHVLQYPGCVPKPIPSFACTGRCSSYLQVSGSKIWTMERSCLCCQESGEREASVSLFCPKAKEGEKKFRKV  111 (112)
Q Consensus        38 ~~~~~~I~~~GC~~~~V~~~~C~G~C~S~S~YS~~~~~~~~~sCsCCqe~~t~~~~V~L~CpdGs~~~~~Y~~V  111 (112)
                      +++.|+|+++||++..|.+++|+|+|+|+++|+ .  +.++++|+||+|.+++++.|+|+||||+...++|..|
T Consensus         2 ~~~~q~i~~~gC~s~~v~~~~C~G~C~s~~~~~-~--~~~~~~c~CC~p~~~~~~~v~l~C~dg~~~~~~v~~i   72 (82)
T smart00041        2 SPVRQTITYNGCTSVTVKNAFCEGKCGSASSYS-I--QDVQHSCSCCQPHKTKTRQVRLRCPDGSTVKKTVMHI   72 (82)
T ss_pred             cceEEEEEeCCceEeEEEcCcEEeECCCeeEcC-c--cccccCCCccCCceeEEEEEEEECCCCCEEEEEEEEE
Confidence            578999999999966699999999999999999 5  5788999999999999999999999999888888876


No 3  
>PF00007 Cys_knot:  Cystine-knot domain;  InterPro: IPR006208 This domain is found at the C-terminal of glycoprotein hormones and various extracellular proteins. It is believed to be involved in disulphide-linked dimerisation. ; PDB: 1QFW_B 1HRP_B 1HCN_B 1XWD_B 1FL7_B.
Probab=99.42  E-value=8.3e-14  Score=96.16  Aligned_cols=78  Identities=24%  Similarity=0.484  Sum_probs=66.6

Q ss_pred             CceEeeeEEEEecCCCe-eccEecceeeCccCceeeeccccccccCccccCCCCCceEEEEEEEeCCCCCCcceeEEEcC
Q psy13264         34 DCQVTPVIHVLQYPGCV-PKPIPSFACTGRCSSYLQVSGSKIWTMERSCLCCQESGEREASVSLFCPKAKEGEKKFRKVM  112 (112)
Q Consensus        34 ~Ck~~~~~~~I~~~GC~-~~~V~~~~C~G~C~S~S~YS~~~~~~~~~sCsCCqe~~t~~~~V~L~CpdGs~~~~~Y~~V~  112 (112)
                      .|+.+..+..+.++||. ..+|++++|+|.|.|++.|+ ...+.+.++|.||++..+.++.|.+.||+|..+.++|..++
T Consensus         3 ~C~~~~~ti~ve~~gC~s~~~v~~~~C~G~C~s~~~~~-~~~~~~~~~~~Cc~~~~~~~~~v~~~C~~G~~~~~~y~~a~   81 (105)
T PF00007_consen    3 GCHLTNVTIKVEKSGCRSCKTVNTTYCSGYCESSEPYS-KDPRKFQSQCVCCYPERTYETVVLLGCPDGVDPTFTYPVAT   81 (105)
T ss_dssp             BSEEEEEEEEEEECCCTEEEEEEEEEEEEEEEEE--SC-TTTTT----EEEEEEEEEEEEEEETTBTTCS-EEEEEEEEE
T ss_pred             CCeEeeeEEEEEeCCCCCceEEEEEEEEEEecCCeEec-ccCCcCcccCcCCCcceEEEEEECCCCccCCcceEEeeEee
Confidence            58999999999999999 48999999999999999998 78889999999999999999999999999999999998863


No 4  
>PF05463 Sclerostin:  Sclerostin (SOST);  InterPro: IPR008835 This family contains several mammalian sclerostin (SOST) proteins. SOST is thought to suppress bone formation. Mutations of the SOST gene lead to sclerosteosis, a progressive sclerosing bone dysplasia with an autosomal recessive mode of inheritance. Radiologically, it is characterised by a generalised hyperostosis and sclerosis leading to a markedly thickened and sclerotic skull, with mandible, ribs, clavicles and all long bones also being affected. Due to narrowing of the foramina of the cranial nerves, facial nerve palsy, hearing loss and atrophy of the optic nerves can occur. Sclerosteosis is clinically and radiologically very similar to van Buchem disease, mainly differentiated by hand malformations and a large stature in sclerosteosis patients [].; GO: 0005615 extracellular space; PDB: 2KD3_A 3SOV_Z 2K8P_A.
Probab=97.14  E-value=0.0013  Score=50.88  Aligned_cols=81  Identities=23%  Similarity=0.354  Sum_probs=48.1

Q ss_pred             CCCCceEeeeEEEEecCCCe-eccEecceeeCccCceeeec-cccccc-cCcccc---CCCCCceEEEEEEEeCCCCCCc
Q psy13264         31 SSDDCQVTPVIHVLQYPGCV-PKPIPSFACTGRCSSYLQVS-GSKIWT-MERSCL---CCQESGEREASVSLFCPKAKEG  104 (112)
Q Consensus        31 ~~~~Ck~~~~~~~I~~~GC~-~~~V~~~~C~G~C~S~S~YS-~~~~~~-~~~sCs---CCqe~~t~~~~V~L~CpdGs~~  104 (112)
                      ..-.|.-...+.+|+..-|+ .+||.-..|.|+|....++- -..... +-+...   =|-+.++....|.|.||||++.
T Consensus        64 ~~~~CrELrstrYisdG~C~S~kPikelvCsGqClP~~llPn~Ig~~k~W~R~~~~e~RCv~d~~RtqrVqL~C~dG~tR  143 (198)
T PF05463_consen   64 SQVGCRELRSTRYISDGQCRSAKPIKELVCSGQCLPAHLLPNWIGRGKYWWRRSAQEWRCVPDHTRTQRVQLQCPDGTTR  143 (198)
T ss_dssp             TTTSS-CEEEEE--EETTEEESS-EEEEEE----S-----TTSTTSSS-SSSSS------EEEEEEEEEEEEE-TTTSSE
T ss_pred             ccCccceeeeeeeeecCcccccCchhhheeeccccccccCcccccccceecccCCCcccccCCcceeEEEEEECCCCCee
Confidence            44569999999999999999 79999999999998776631 011111 223332   3889999999999999999987


Q ss_pred             ceeEEEc
Q psy13264        105 EKKFRKV  111 (112)
Q Consensus       105 ~~~Y~~V  111 (112)
                      .|+-+-|
T Consensus       144 TyKI~vV  150 (198)
T PF05463_consen  144 TYKIRVV  150 (198)
T ss_dssp             EEEEEEE
T ss_pred             EEEEEEE
Confidence            7766554


No 5  
>smart00068 GHB Glycoprotein hormone beta chain homologues. Also called gonadotropins. Glycoprotein hormones consist of two glycosylated chains (alpha and beta) of similar topology.
Probab=92.43  E-value=1.2  Score=31.56  Aligned_cols=74  Identities=19%  Similarity=0.279  Sum_probs=52.0

Q ss_pred             CCceEeeeEEEEecCCCe-eccEecceeeCccCceee-eccccccccCccccCCCCCceEEEEEEEe-CCCCCCcceeEE
Q psy13264         33 DDCQVTPVIHVLQYPGCV-PKPIPSFACTGRCSSYLQ-VSGSKIWTMERSCLCCQESGEREASVSLF-CPKAKEGEKKFR  109 (112)
Q Consensus        33 ~~Ck~~~~~~~I~~~GC~-~~~V~~~~C~G~C~S~S~-YS~~~~~~~~~sCsCCqe~~t~~~~V~L~-CpdGs~~~~~Y~  109 (112)
                      ..|....++-.+..+||- -..|+.+.|.|.|.+.-. |-+......++-|+-   .+.+-++|.|+ ||-|--+.++|-
T Consensus         3 ~~C~~~n~ti~vEk~~C~~c~~i~TTiC~G~C~T~dpv~~~~~~~~~Q~vCtY---~d~~Y~tv~lpgCp~gvdp~~tYP   79 (107)
T smart00068        3 PGCRPTNATIAVEKEECPVCITINTTICAGYCYTRDPVYKSPLPPLPQRVCTY---RELRYETVRLPGCPPGVDPVVTYP   79 (107)
T ss_pred             CCceeEeEEEEEeeCCCCceeEEEeEeECccccccCccccCCCCCcccCCccC---CceEEEEEECCCccCCCCCcEEee
Confidence            459999999899999999 479999999999987522 321223344555543   45566666664 888877777773


No 6  
>cd00069 GHB Glycoprotein hormone beta chain homologues. Gonadotropins; reproductive hormones consisting of two glycosylated chains (alpha and beta) of similar topology with Cysteine-knot motifs.
Probab=92.34  E-value=0.83  Score=32.04  Aligned_cols=72  Identities=18%  Similarity=0.274  Sum_probs=50.0

Q ss_pred             ceEeeeEEEEecCCCe-eccEecceeeCccCcee-eeccccccccCccccCCCCCceEEEEEEEe-CCCCCCcceeEE
Q psy13264         35 CQVTPVIHVLQYPGCV-PKPIPSFACTGRCSSYL-QVSGSKIWTMERSCLCCQESGEREASVSLF-CPKAKEGEKKFR  109 (112)
Q Consensus        35 Ck~~~~~~~I~~~GC~-~~~V~~~~C~G~C~S~S-~YS~~~~~~~~~sCsCCqe~~t~~~~V~L~-CpdGs~~~~~Y~  109 (112)
                      |+...++-.+..+||- -..|+.+.|.|.|.+.- .|-+......++-|+   =.+.+-++|.|+ ||-|--+.++|-
T Consensus         1 C~~~n~ti~vEk~~C~~c~~i~TTiC~G~C~T~dpv~~~~~~~~~Q~vCt---Y~~~~Y~tv~lpgCp~gvdp~~tYP   75 (102)
T cd00069           1 CRPTNITIAVEKEECPVCVTINTTICAGYCYTKDPVYKSPLSPLPQRVCT---YRELSYETVRLPGCPPGVDPGVTYP   75 (102)
T ss_pred             CcceeEEEEEeeCCCCceEEEEeeeEccCcccccccccccCCCcccCccc---CCcEEEEEEECCCCcCCCCCCEEee
Confidence            5666777778888998 47899999999998863 232123344555554   355666677774 888887778874


No 7  
>PF00019 TGF_beta:  Transforming growth factor beta like domain;  InterPro: IPR001839 Transforming growth factor-beta (TGF-beta) is a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types. TGF-beta-1 is a peptide of 112 amino acid residues derived by proteolytic cleavage from the C-terminal of a precursor protein []. A number of proteins are known to be related to TGF-beta-1 [, ]. Proteins from the TGF-beta family are only active as homo- or heterodimer; the two chains being linked by a single disulphide bond. From X-ray studies of TGF-beta-2 [], it is known that all the other cysteines are involved in intrachain disulphide bonds. There are four disulphide bonds in the TGF-beta's and in inhibin beta chains, while the other members of this family lack the first bond. The regulatory cytokine TGFbeta exerts tumour-suppressive effects, but also modulates cell invasion and immune regulation []. Misregulation of the TGF-beta signalling pathway can result in tumour development. ; GO: 0008083 growth factor activity; PDB: 2QCQ_B 2QCW_B 2R53_A 2R52_A 1M4U_L 1BMP_A 1LX5_A 1LXI_A 3FUB_B 2V5E_B ....
Probab=71.74  E-value=2.7  Score=28.34  Aligned_cols=52  Identities=17%  Similarity=0.289  Sum_probs=33.6

Q ss_pred             eccEecceeeCccCceee-ecc-cc----------ccccCccccCCCCCceEEEEEEEeCCCCC
Q psy13264         51 PKPIPSFACTGRCSSYLQ-VSG-SK----------IWTMERSCLCCQESGEREASVSLFCPKAK  102 (112)
Q Consensus        51 ~~~V~~~~C~G~C~S~S~-YS~-~~----------~~~~~~sCsCCqe~~t~~~~V~L~CpdGs  102 (112)
                      ++..+..+|.|.|..... +.. ..          .......=.||.|++.+...+-..=.++.
T Consensus        25 P~~~~~~~C~G~C~~~~~~~~~~~~ha~~~~~~~~~~~~~~~~pCC~P~~~~~l~il~~~~~~~   88 (105)
T PF00019_consen   25 PEGYNANYCSGSCPFPLSNHNNHSNHAILQSLMHSLNPRSVPQPCCVPTKYSPLSILYLDEDGN   88 (105)
T ss_dssp             SSEEEEEEEESBSCSSSSCGCHHHHHHHHHHHHHHHSTTTSTS-EEEEEEEEEEEEEEEETTSE
T ss_pred             cCccccccccceecccccccccccccccccccccccccccccCCcEeeeeeceEEEEEEECCCc
Confidence            678999999999986432 110 00          01134677899999999998855544444


No 8  
>smart00204 TGFB Transforming growth  factor-beta (TGF-beta) family. Family members are active as disulphide-linked homo- or heterodimers. TGFB is a multifunctional peptide that controls proliferation,  differentiation, and other functions in many cell types.
Probab=48.31  E-value=28  Score=23.62  Aligned_cols=53  Identities=17%  Similarity=0.340  Sum_probs=35.2

Q ss_pred             eccEecceeeCccCceee--ecc-cc---------ccccCccccCCCCCceEEEEEEEeCCCCCC
Q psy13264         51 PKPIPSFACTGRCSSYLQ--VSG-SK---------IWTMERSCLCCQESGEREASVSLFCPKAKE  103 (112)
Q Consensus        51 ~~~V~~~~C~G~C~S~S~--YS~-~~---------~~~~~~sCsCCqe~~t~~~~V~L~CpdGs~  103 (112)
                      ++..+..+|.|.|+....  ++. ..         ...-...-.||.|++.+..++.-.=.+|+.
T Consensus        22 P~~y~a~yC~G~C~~~~~~~~~~~~Ha~i~~~~~~~~~~~~~~pCC~P~~~~~l~~ly~~~~~~i   86 (102)
T smart00204       22 PKGYNAYYCEGECPFPLSTSLNATNHAIVQTLVHLLGPNPVPKPCCVPTKLSPLSMLYYDDDGNV   86 (102)
T ss_pred             CCceeeeEEeeeCCCCcccccCCcchhhhhhhHHhcCCCCCCCCCccCceEecEEEEEEeCCCcE
Confidence            577889999999986532  110 00         011124568999999999988877666653


No 9  
>PF10956 DUF2756:  Protein of unknown function (DUF2756);  InterPro: IPR020158 This entry contains proteins with no known function.
Probab=44.39  E-value=9.8  Score=26.82  Aligned_cols=18  Identities=22%  Similarity=0.521  Sum_probs=14.9

Q ss_pred             eehhhhhhhhhhhhhcCC
Q psy13264          8 IRVVCVLLPLCVLIRSNS   25 (112)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~   25 (112)
                      |.+++.+|||+++|+..+
T Consensus         4 ll~laalLPl~~~Aqp~n   21 (104)
T PF10956_consen    4 LLILAALLPLAAMAQPLN   21 (104)
T ss_pred             HHHHHHHccHHHHHhHhh
Confidence            456888999999998865


No 10 
>PF02495 7kD_coat:  7kD viral coat protein;  InterPro: IPR003411 This family consists of a 7 kDa coat protein from Carlavirus and Potexvirus [].
Probab=39.49  E-value=30  Score=21.34  Aligned_cols=20  Identities=25%  Similarity=0.456  Sum_probs=16.2

Q ss_pred             CCCCceEeeeEEEEecCCCe
Q psy13264         31 SSDDCQVTPVIHVLQYPGCV   50 (112)
Q Consensus        31 ~~~~Ck~~~~~~~I~~~GC~   50 (112)
                      .++.|.+.-.-.-++..||.
T Consensus        23 ~~~~C~I~ItGeSv~I~gC~   42 (59)
T PF02495_consen   23 SSPSCVIVITGESVTISGCE   42 (59)
T ss_pred             CCCCcEEEEeCcEEEEECCC
Confidence            36779988888888888996


No 11 
>PHA02661 vascular endothelial growth factor like protein; Provisional
Probab=38.65  E-value=56  Score=24.21  Aligned_cols=56  Identities=18%  Similarity=0.350  Sum_probs=33.7

Q ss_pred             ccccCCCCceEeeeEEEEecCC-----Ce--eccEecceeeCccCceeeeccccccccCccccCCCCCceEEEEEEE
Q psy13264         27 VTAASSDDCQVTPVIHVLQYPG-----CV--PKPIPSFACTGRCSSYLQVSGSKIWTMERSCLCCQESGEREASVSL   96 (112)
Q Consensus        27 ~~~~~~~~Ck~~~~~~~I~~~G-----C~--~~~V~~~~C~G~C~S~S~YS~~~~~~~~~sCsCCqe~~t~~~~V~L   96 (112)
                      +++..++.|+.+.....|..+-     =.  +.=|.+.+|.|=|++-..              =|+|++++.+++.+
T Consensus        40 ~ev~~~s~CkPRetvV~I~~E~p~~~n~~y~PsCV~V~RCgGCCnde~l--------------~C~PT~t~nVtm~v  102 (146)
T PHA02661         40 LDTSDKSSCQPRDTVVQLSDEYPGNTNDRYNPRCVTVRRCGGCCNDESQ--------------ICTPTETSNVTVTV  102 (146)
T ss_pred             HHHhhccCceeeeEEEECccccCccccceEccCcEEeccccCCCCCCCC--------------eEEeeeEEEEEEEE
Confidence            4677888898776665444310     00  122567889999975332              15666666666665


No 12 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=31.52  E-value=19  Score=24.67  Aligned_cols=18  Identities=28%  Similarity=0.362  Sum_probs=9.6

Q ss_pred             eehhhhhhhhhhhhhcCC
Q psy13264          8 IRVVCVLLPLCVLIRSNS   25 (112)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~   25 (112)
                      ++||+++|-.+||+.|..
T Consensus         6 ~llL~l~LA~lLlisSev   23 (95)
T PF07172_consen    6 FLLLGLLLAALLLISSEV   23 (95)
T ss_pred             HHHHHHHHHHHHHHHhhh
Confidence            344555555555665544


No 13 
>PLN00213 predicted protein; Provisional
Probab=30.73  E-value=12  Score=26.98  Aligned_cols=22  Identities=23%  Similarity=0.431  Sum_probs=18.9

Q ss_pred             Cceeceeeehhhhhhhhhhhhh
Q psy13264          1 MSIENLYIRVVCVLLPLCVLIR   22 (112)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~   22 (112)
                      |||.|++..|..+|..+.|=||
T Consensus         1 m~iknV~~ll~v~cIvvsVna~   22 (118)
T PLN00213          1 MSIKNVFLLLAVLCIIVSVNAQ   22 (118)
T ss_pred             CchHHHHHHHHHHHHHheeccC
Confidence            8999999888888888888777


No 14 
>PRK13240 pbsY photosystem II protein Y; Reviewed
Probab=27.94  E-value=31  Score=20.36  Aligned_cols=14  Identities=29%  Similarity=0.553  Sum_probs=11.4

Q ss_pred             eehhhhhhhhhhhh
Q psy13264          8 IRVVCVLLPLCVLI   21 (112)
Q Consensus         8 ~~~~~~~~~~~~~~   21 (112)
                      +|++.|++|+++-+
T Consensus         3 ~RlliVl~Pil~A~   16 (40)
T PRK13240          3 LRLLIVLAPILAAA   16 (40)
T ss_pred             hhHHHHHHHHHHHH
Confidence            68999999987654


No 15 
>PF10645 Carb_bind:  Carbohydrate binding;  InterPro: IPR018909  This is a carbohydrate binding domain which has been shown in Schizosaccharomyces pombe (Fission yeast) to be required for septum localisation []. 
Probab=27.64  E-value=19  Score=22.43  Aligned_cols=20  Identities=35%  Similarity=0.496  Sum_probs=17.3

Q ss_pred             eccEecceeeCccCceeeec
Q psy13264         51 PKPIPSFACTGRCSSYLQVS   70 (112)
Q Consensus        51 ~~~V~~~~C~G~C~S~S~YS   70 (112)
                      ...+....|-|.|.+.++|+
T Consensus        24 ~~g~~l~~C~gaCY~~~~Y~   43 (52)
T PF10645_consen   24 TNGVPLSYCGGACYSPSQYS   43 (52)
T ss_pred             ECCccccccccccCCHHHce
Confidence            45677889999999999997


No 16 
>CHL00196 psbY photosystem II protein Y; Provisional
Probab=25.56  E-value=39  Score=19.55  Aligned_cols=14  Identities=14%  Similarity=0.344  Sum_probs=11.2

Q ss_pred             eehhhhhhhhhhhh
Q psy13264          8 IRVVCVLLPLCVLI   21 (112)
Q Consensus         8 ~~~~~~~~~~~~~~   21 (112)
                      .|++.|++|++.-+
T Consensus         3 ~RlliVl~Pil~A~   16 (36)
T CHL00196          3 TRLLVIAAPVLAAA   16 (36)
T ss_pred             hhHHHHHHHHHHHH
Confidence            58899999987654


No 17 
>KOG3900|consensus
Probab=24.13  E-value=45  Score=27.59  Aligned_cols=75  Identities=20%  Similarity=0.336  Sum_probs=46.9

Q ss_pred             CCceEeeeEEE---EecCCCe--eccEecceeeCccCcee-----eecccc----ccccC---ccccCCCCCceEEEEEE
Q psy13264         33 DDCQVTPVIHV---LQYPGCV--PKPIPSFACTGRCSSYL-----QVSGSK----IWTME---RSCLCCQESGEREASVS   95 (112)
Q Consensus        33 ~~Ck~~~~~~~---I~~~GC~--~~~V~~~~C~G~C~S~S-----~YS~~~----~~~~~---~sCsCCqe~~t~~~~V~   95 (112)
                      ..|..+++.--   |.=++-.  ++.....||.|.|...-     ... +.    .+++.   -.=.||-|++.+..+|=
T Consensus       311 ~~Ccr~~lyV~F~~lGW~dWIIaP~gy~A~yC~G~C~~p~~~~~~tnH-a~vq~l~~~~~p~~~p~pCCvPtklsplsvL  389 (413)
T KOG3900|consen  311 NRCCRRPLYVDFRDLGWDDWIIAPKGYDANYCSGTCPFPLADHAATNH-AIVQTLVHAVNPEPVPKPCCVPTKLSPLSVL  389 (413)
T ss_pred             CceeccceEeehhhcCCcceEeCCCcccCceecCcCCCchhhcCCcch-HHHHHHHHhhCCCCCCCCccccCccCceEEE
Confidence            34887765522   4445576  78899999999998731     111 00    11111   12269999999998887


Q ss_pred             EeCCCCCCcceeE
Q psy13264         96 LFCPKAKEGEKKF  108 (112)
Q Consensus        96 L~CpdGs~~~~~Y  108 (112)
                      -.=.+++..-.+|
T Consensus       390 y~d~~~~vv~k~y  402 (413)
T KOG3900|consen  390 YFDDNGNVVLKTY  402 (413)
T ss_pred             EEeCCCcEEEEEe
Confidence            7766666444444


No 18 
>PF15240 Pro-rich:  Proline-rich
Probab=21.65  E-value=46  Score=25.54  Aligned_cols=15  Identities=33%  Similarity=0.476  Sum_probs=10.8

Q ss_pred             hhhhhhhhhhhhcCC
Q psy13264         11 VCVLLPLCVLIRSNS   25 (112)
Q Consensus        11 ~~~~~~~~~~~~~~~   25 (112)
                      |+|||-.+|||-|-+
T Consensus         2 LlVLLSvALLALSSA   16 (179)
T PF15240_consen    2 LLVLLSVALLALSSA   16 (179)
T ss_pred             hhHHHHHHHHHhhhc
Confidence            667777778877665


No 19 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=21.16  E-value=61  Score=17.00  Aligned_cols=16  Identities=31%  Similarity=0.632  Sum_probs=10.3

Q ss_pred             CCCceEEEEEEEeCCC
Q psy13264         85 QESGEREASVSLFCPK  100 (112)
Q Consensus        85 qe~~t~~~~V~L~Cpd  100 (112)
                      .+..-.++.|...||+
T Consensus         6 ~~i~~r~~~v~f~CPn   21 (24)
T PF07754_consen    6 RPIAPREQAVPFPCPN   21 (24)
T ss_pred             CcccCcccCceEeCCC
Confidence            3444445578888887


No 20 
>PTZ00459 mucin-associated surface protein (MASP); Provisional
Probab=21.08  E-value=44  Score=27.01  Aligned_cols=14  Identities=50%  Similarity=0.712  Sum_probs=10.6

Q ss_pred             ehhhhhhhhhhhhhc
Q psy13264          9 RVVCVLLPLCVLIRS   23 (112)
Q Consensus         9 ~~~~~~~~~~~~~~~   23 (112)
                      ||||| |-||||-=-
T Consensus         8 RVLLV-CALCVLWCg   21 (291)
T PTZ00459          8 RVLLV-CALCVLWCG   21 (291)
T ss_pred             hHHHH-HHHHHHhcC
Confidence            77887 678998654


No 21 
>PF15117 UPF0697:  Uncharacterised protein family UPF0697   
Probab=20.83  E-value=65  Score=22.33  Aligned_cols=22  Identities=32%  Similarity=0.498  Sum_probs=19.2

Q ss_pred             eceeeehhhhhhhhhhhhhcCC
Q psy13264          4 ENLYIRVVCVLLPLCVLIRSNS   25 (112)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~   25 (112)
                      .|.|+++++|-+-|++-|+-|.
T Consensus        18 TNVYlivilvS~~l~~YarrNK   39 (99)
T PF15117_consen   18 TNVYLIVILVSFGLFMYARRNK   39 (99)
T ss_pred             ccEEeehhHHhhHHHHhhhhcC
Confidence            4899999999999999988664


No 22 
>PF06298 PsbY:  Photosystem II protein Y (PsbY);  InterPro: IPR009388 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbY found in PSII. In higher plants, two related PsbY proteins exist, PsbY-1 and PsbY-2, which appear to function as a heterodimer. In spinach and Arabidopsis, these two proteins arise from a single-copy nuclear gene that is processed in the chloroplast. By contrast, prokaryotic and organellar chromosomes encode a single PsbY protein, as found in cyanobacteria and red algae, indicating a duplication event in the evolution of higher plants []. PsbY has two low manganese-dependent activities: a catalase-like activity and an L-arginine metabolising activity that converts L-arginine into ornithine and urea []. In addition, a redox-active group is thought to be present in the protein. In cyanobacteria, PsbY deletion mutants have a slightly impaired PSII that is less capable of coping with low levels of calcium ions than the wild-type.; GO: 0030145 manganese ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0016021 integral to membrane
Probab=20.70  E-value=56  Score=18.86  Aligned_cols=14  Identities=36%  Similarity=0.522  Sum_probs=10.9

Q ss_pred             eehhhhhhhhhhhh
Q psy13264          8 IRVVCVLLPLCVLI   21 (112)
Q Consensus         8 ~~~~~~~~~~~~~~   21 (112)
                      .|++.|++|++.-+
T Consensus         3 ~R~liVl~Pil~A~   16 (36)
T PF06298_consen    3 WRLLIVLLPILPAA   16 (36)
T ss_pred             chhHHHHHHHHHHH
Confidence            58899999987644


Done!