Query         psy13267
Match_columns 101
No_of_seqs    20 out of 22
Neff          1.7 
Searched_HMMs 46136
Date          Sat Aug 17 00:23:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13267.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13267hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09026 CENP-B_dimeris:  Centr  93.7   0.018   4E-07   41.4   0.0    7   59-65     60-66  (101)
  2 PF09026 CENP-B_dimeris:  Centr  92.2   0.041   9E-07   39.6   0.0   13   45-57     36-48  (101)
  3 PF04931 DNA_pol_phi:  DNA poly  85.9   0.099 2.1E-06   45.2  -2.2    8   54-61    703-710 (784)
  4 TIGR00927 2A1904 K+-dependent   73.7    0.63 1.4E-05   44.0  -1.4    6   67-72    921-926 (1096)
  5 PF03344 Daxx:  Daxx Family;  I  56.9     3.6 7.7E-05   36.8   0.0   10   89-98    557-566 (713)
  6 PF04931 DNA_pol_phi:  DNA poly  53.5     3.1 6.7E-05   36.2  -0.9   10   52-61    705-714 (784)
  7 KOG1834|consensus               37.5       7 0.00015   36.7  -1.2    8   13-20    891-898 (952)
  8 PRK13456 DNA protection protei  34.4      23  0.0005   27.4   1.3   21   79-100   147-173 (186)
  9 PF04712 Radial_spoke:  Radial   29.3      11 0.00025   31.9  -1.2   26   52-78    384-409 (491)
 10 PF13462 Thioredoxin_4:  Thiore  25.9     8.1 0.00018   25.0  -2.1   30   67-98     23-52  (162)
 11 PTZ00415 transmission-blocking  24.7      16 0.00034   37.9  -1.3    6   65-70    207-212 (2849)
 12 KOG3046|consensus               24.5      34 0.00074   26.2   0.7   14   78-91     70-83  (147)
 13 PF08421 Methyltransf_13:  Puta  21.4      16 0.00034   22.7  -1.4   25   68-100     1-27  (62)
 14 KOG0299|consensus               20.3      45 0.00097   29.6   0.7   18   39-56     60-77  (479)

No 1  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=93.71  E-value=0.018  Score=41.44  Aligned_cols=7  Identities=43%  Similarity=0.866  Sum_probs=2.1

Q ss_pred             hhcCCcc
Q psy13267         59 ITKAPLD   65 (101)
Q Consensus        59 ltkAPLe   65 (101)
                      ||-.||+
T Consensus        60 ltSf~id   66 (101)
T PF09026_consen   60 LTSFPID   66 (101)
T ss_dssp             HCTS---
T ss_pred             hhccchh
Confidence            5555554


No 2  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=92.19  E-value=0.041  Score=39.64  Aligned_cols=13  Identities=46%  Similarity=0.544  Sum_probs=1.7

Q ss_pred             HHHHHHHHHHHhh
Q psy13267         45 EEEEEVEMVKEAE   57 (101)
Q Consensus        45 EEEEevEEkK~rk   57 (101)
                      ++++++--++++.
T Consensus        36 ee~de~p~p~fge   48 (101)
T PF09026_consen   36 EEEDEVPVPEFGE   48 (101)
T ss_dssp             ----------HHH
T ss_pred             cccccccchhHHH
Confidence            3334555566654


No 3  
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=85.93  E-value=0.099  Score=45.15  Aligned_cols=8  Identities=13%  Similarity=0.152  Sum_probs=3.5

Q ss_pred             HHhhhhhc
Q psy13267         54 KEAEVITK   61 (101)
Q Consensus        54 K~rkvltk   61 (101)
                      +++..|.+
T Consensus       703 ~~~~~l~~  710 (784)
T PF04931_consen  703 EFRSALAK  710 (784)
T ss_pred             HHHHHHHH
Confidence            44444443


No 4  
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=73.74  E-value=0.63  Score=44.02  Aligned_cols=6  Identities=0%  Similarity=-0.130  Sum_probs=2.7

Q ss_pred             ccccCC
Q psy13267         67 MCRPCT   72 (101)
Q Consensus        67 MCRPCT   72 (101)
                      -|..|.
T Consensus       921 TIPDcr  926 (1096)
T TIGR00927       921 TVPDVR  926 (1096)
T ss_pred             ecCCCC
Confidence            344454


No 5  
>PF03344 Daxx:  Daxx Family;  InterPro: IPR005012  Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins. Human Daxx contains four structural domains commonly found in transcriptional regulatory proteins: two predicted paired amphipathic helices, an acid-rich domain and a Ser/Pro/Thr (SPT)-rich domain. The post-translational modification status of the SPT-domain of hDaxx regulates its association with transcription factors such as Pax3 and ETS-1, effectively bringing hDaxx to sites of active transcription. Through its presence at the site of active transcription, hDaxx could then be able to associate with acetylated histones present in the nucleosomes and Dek that is associated with chromatin. Through its association with the SPT-domain of hDaxx, histone deacetylases may also be brought to the site of active transcription. As a consequence, nucleosomes in the vicinity of the site of active transcription will have the histone tails deacetylated, allowing the deactylated tail to bind to DNA, thereby leading to an inactive chromatin structure and transcriptional repression [].  The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis as a component of nuclear promyelocytic leukemia protein (PML) oncogenic domains (PODS). Daxx associates with PODs through a direct interaction with PML, a critical component of PODs. The interaction is a dynamic, cell cycle regulated event and is dependent on the post-translational modification of PML by the small ubiquitin-related modifier SUMO-1. ; PDB: 2KZS_A 2KZU_A.
Probab=56.87  E-value=3.6  Score=36.85  Aligned_cols=10  Identities=40%  Similarity=0.803  Sum_probs=0.0

Q ss_pred             ccCCcccccc
Q psy13267         89 DEAPISGHFA   98 (101)
Q Consensus        89 degpls~~F~   98 (101)
                      .+.|++.+|.
T Consensus       557 eesP~Sql~e  566 (713)
T PF03344_consen  557 EESPLSQLFE  566 (713)
T ss_dssp             ----------
T ss_pred             cccccccccc
Confidence            4556666663


No 6  
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=53.46  E-value=3.1  Score=36.16  Aligned_cols=10  Identities=10%  Similarity=0.003  Sum_probs=5.0

Q ss_pred             HHHHhhhhhc
Q psy13267         52 MVKEAEVITK   61 (101)
Q Consensus        52 EkK~rkvltk   61 (101)
                      ..+-++++..
T Consensus       705 ~~~l~~aL~~  714 (784)
T PF04931_consen  705 RSALAKALGD  714 (784)
T ss_pred             HHHHHHHhcc
Confidence            3344666654


No 7  
>KOG1834|consensus
Probab=37.50  E-value=7  Score=36.66  Aligned_cols=8  Identities=25%  Similarity=0.289  Sum_probs=3.1

Q ss_pred             CCCCccch
Q psy13267         13 RSSDDEGV   20 (101)
Q Consensus        13 ~~~~~~g~   20 (101)
                      .+.+++.+
T Consensus       891 gs~ee~~e  898 (952)
T KOG1834|consen  891 GSIEEESE  898 (952)
T ss_pred             Cccccccc
Confidence            34444333


No 8  
>PRK13456 DNA protection protein DPS; Provisional
Probab=34.40  E-value=23  Score=27.36  Aligned_cols=21  Identities=29%  Similarity=0.673  Sum_probs=15.0

Q ss_pred             chhHH------HhhhcccCCccccccCC
Q psy13267         79 VIPQE------IVNYADEAPISGHFAKP  100 (101)
Q Consensus        79 viPQE------ia~fadegpls~~F~k~  100 (101)
                      ||.+|      +.+|...|| |+||+|+
T Consensus       147 IL~dE~eH~~dl~~lL~~~~-~~~~~~~  173 (186)
T PRK13456        147 ILQEEIEHEAWFSELLGGGP-SGHFRRS  173 (186)
T ss_pred             HHHHHHHHHHHHHHHHhcCC-CcceecC
Confidence            56555      567777666 8999885


No 9  
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=29.33  E-value=11  Score=31.88  Aligned_cols=26  Identities=12%  Similarity=0.063  Sum_probs=16.8

Q ss_pred             HHHHhhhhhcCCcccccccCCCccccc
Q psy13267         52 MVKEAEVITKAPLDCMCRPCTSIEESA   78 (101)
Q Consensus        52 EkK~rkvltkAPLeCMCRPCT~iEes~   78 (101)
                      -+-.+.+..-+++..++ ||.++--++
T Consensus       384 p~~L~~iseD~~~~~~~-~~Ws~r~~s  409 (491)
T PF04712_consen  384 PPLLTPISEDKEIPGID-PAWSVRTSS  409 (491)
T ss_pred             cccccchhhcccccCcC-CCceEEecC
Confidence            33445677778888876 777665544


No 10 
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=25.88  E-value=8.1  Score=24.96  Aligned_cols=30  Identities=20%  Similarity=0.471  Sum_probs=22.5

Q ss_pred             ccccCCCcccccchhHHHhhhcccCCcccccc
Q psy13267         67 MCRPCTSIEESAVIPQEIVNYADEAPISGHFA   98 (101)
Q Consensus        67 MCRPCT~iEes~viPQEia~fadegpls~~F~   98 (101)
                      .|.+|......  |.+-+..|++.|.+...|+
T Consensus        23 ~Cp~C~~~~~~--~~~~~~~~i~~~~v~~~~~   52 (162)
T PF13462_consen   23 QCPHCAKFHEE--LEKLLKKYIDPGKVKFVFR   52 (162)
T ss_dssp             TSHHHHHHHHH--HHHHHHHHTTTTTEEEEEE
T ss_pred             CCHhHHHHHHH--HhhhhhhccCCCceEEEEE
Confidence            69999987654  4488888999998755543


No 11 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=24.67  E-value=16  Score=37.85  Aligned_cols=6  Identities=33%  Similarity=0.512  Sum_probs=2.5

Q ss_pred             cccccc
Q psy13267         65 DCMCRP   70 (101)
Q Consensus        65 eCMCRP   70 (101)
                      +|.-.+
T Consensus       207 d~f~~~  212 (2849)
T PTZ00415        207 DCFKFI  212 (2849)
T ss_pred             ceeeec
Confidence            344433


No 12 
>KOG3046|consensus
Probab=24.48  E-value=34  Score=26.17  Aligned_cols=14  Identities=36%  Similarity=0.762  Sum_probs=12.7

Q ss_pred             cchhHHHhhhcccC
Q psy13267         78 AVIPQEIVNYADEA   91 (101)
Q Consensus        78 ~viPQEia~fadeg   91 (101)
                      .-||+|+..|+|+|
T Consensus        70 i~IPleVl~yIddG   83 (147)
T KOG3046|consen   70 IQIPLEVLEYIDDG   83 (147)
T ss_pred             ccCcHHHHHHHhcC
Confidence            35999999999999


No 13 
>PF08421 Methyltransf_13:  Putative zinc binding domain;  InterPro: IPR013630 This domain is found at the N terminus of bacterial methyltransferases. ; PDB: 4E2X_A 3NDJ_A 3NDI_A 4E32_A 4E33_A 4E31_A 4E2Y_A 4E2W_A 4E2Z_A 4E30_A.
Probab=21.37  E-value=16  Score=22.70  Aligned_cols=25  Identities=36%  Similarity=0.743  Sum_probs=11.0

Q ss_pred             cccCCCcccccchhHHHhhhcccC--CccccccCC
Q psy13267         68 CRPCTSIEESAVIPQEIVNYADEA--PISGHFAKP  100 (101)
Q Consensus        68 CRPCT~iEes~viPQEia~fadeg--pls~~F~k~  100 (101)
                      ||-|.+-.        +..|+|=|  |+++.|.+.
T Consensus         1 CR~Cgs~~--------l~~vldLG~~Pl~~~f~~~   27 (62)
T PF08421_consen    1 CRICGSSD--------LKPVLDLGDQPLANSFLKP   27 (62)
T ss_dssp             -TTTS-E---------EEEEEEEEEEE-TT--B-T
T ss_pred             CCCCCCCc--------cceEeecCCCCccccccCh
Confidence            78887753        33455555  667777654


No 14 
>KOG0299|consensus
Probab=20.34  E-value=45  Score=29.56  Aligned_cols=18  Identities=44%  Similarity=0.416  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q psy13267         39 EEEEEEEEEEEVEMVKEA   56 (101)
Q Consensus        39 eeeeEEEEEEevEEkK~r   56 (101)
                      ++++.|.++|...+|+.|
T Consensus        60 ~e~e~e~~~Eta~ekr~R   77 (479)
T KOG0299|consen   60 EEEEDEFEEETAGEKRLR   77 (479)
T ss_pred             hhhcccchhcchhHHHHH
Confidence            344444455555555544


Done!