Query psy13267
Match_columns 101
No_of_seqs 20 out of 22
Neff 1.7
Searched_HMMs 46136
Date Sat Aug 17 00:23:35 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy13267.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13267hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF09026 CENP-B_dimeris: Centr 93.7 0.018 4E-07 41.4 0.0 7 59-65 60-66 (101)
2 PF09026 CENP-B_dimeris: Centr 92.2 0.041 9E-07 39.6 0.0 13 45-57 36-48 (101)
3 PF04931 DNA_pol_phi: DNA poly 85.9 0.099 2.1E-06 45.2 -2.2 8 54-61 703-710 (784)
4 TIGR00927 2A1904 K+-dependent 73.7 0.63 1.4E-05 44.0 -1.4 6 67-72 921-926 (1096)
5 PF03344 Daxx: Daxx Family; I 56.9 3.6 7.7E-05 36.8 0.0 10 89-98 557-566 (713)
6 PF04931 DNA_pol_phi: DNA poly 53.5 3.1 6.7E-05 36.2 -0.9 10 52-61 705-714 (784)
7 KOG1834|consensus 37.5 7 0.00015 36.7 -1.2 8 13-20 891-898 (952)
8 PRK13456 DNA protection protei 34.4 23 0.0005 27.4 1.3 21 79-100 147-173 (186)
9 PF04712 Radial_spoke: Radial 29.3 11 0.00025 31.9 -1.2 26 52-78 384-409 (491)
10 PF13462 Thioredoxin_4: Thiore 25.9 8.1 0.00018 25.0 -2.1 30 67-98 23-52 (162)
11 PTZ00415 transmission-blocking 24.7 16 0.00034 37.9 -1.3 6 65-70 207-212 (2849)
12 KOG3046|consensus 24.5 34 0.00074 26.2 0.7 14 78-91 70-83 (147)
13 PF08421 Methyltransf_13: Puta 21.4 16 0.00034 22.7 -1.4 25 68-100 1-27 (62)
14 KOG0299|consensus 20.3 45 0.00097 29.6 0.7 18 39-56 60-77 (479)
No 1
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=93.71 E-value=0.018 Score=41.44 Aligned_cols=7 Identities=43% Similarity=0.866 Sum_probs=2.1
Q ss_pred hhcCCcc
Q psy13267 59 ITKAPLD 65 (101)
Q Consensus 59 ltkAPLe 65 (101)
||-.||+
T Consensus 60 ltSf~id 66 (101)
T PF09026_consen 60 LTSFPID 66 (101)
T ss_dssp HCTS---
T ss_pred hhccchh
Confidence 5555554
No 2
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=92.19 E-value=0.041 Score=39.64 Aligned_cols=13 Identities=46% Similarity=0.544 Sum_probs=1.7
Q ss_pred HHHHHHHHHHHhh
Q psy13267 45 EEEEEVEMVKEAE 57 (101)
Q Consensus 45 EEEEevEEkK~rk 57 (101)
++++++--++++.
T Consensus 36 ee~de~p~p~fge 48 (101)
T PF09026_consen 36 EEEDEVPVPEFGE 48 (101)
T ss_dssp ----------HHH
T ss_pred cccccccchhHHH
Confidence 3334555566654
No 3
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=85.93 E-value=0.099 Score=45.15 Aligned_cols=8 Identities=13% Similarity=0.152 Sum_probs=3.5
Q ss_pred HHhhhhhc
Q psy13267 54 KEAEVITK 61 (101)
Q Consensus 54 K~rkvltk 61 (101)
+++..|.+
T Consensus 703 ~~~~~l~~ 710 (784)
T PF04931_consen 703 EFRSALAK 710 (784)
T ss_pred HHHHHHHH
Confidence 44444443
No 4
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=73.74 E-value=0.63 Score=44.02 Aligned_cols=6 Identities=0% Similarity=-0.130 Sum_probs=2.7
Q ss_pred ccccCC
Q psy13267 67 MCRPCT 72 (101)
Q Consensus 67 MCRPCT 72 (101)
-|..|.
T Consensus 921 TIPDcr 926 (1096)
T TIGR00927 921 TVPDVR 926 (1096)
T ss_pred ecCCCC
Confidence 344454
No 5
>PF03344 Daxx: Daxx Family; InterPro: IPR005012 Daxx is a ubiquitously expressed protein that functions, in part, as a transcriptional co-repressor through its interaction with a growing number of nuclear, DNA-associated proteins. Human Daxx contains four structural domains commonly found in transcriptional regulatory proteins: two predicted paired amphipathic helices, an acid-rich domain and a Ser/Pro/Thr (SPT)-rich domain. The post-translational modification status of the SPT-domain of hDaxx regulates its association with transcription factors such as Pax3 and ETS-1, effectively bringing hDaxx to sites of active transcription. Through its presence at the site of active transcription, hDaxx could then be able to associate with acetylated histones present in the nucleosomes and Dek that is associated with chromatin. Through its association with the SPT-domain of hDaxx, histone deacetylases may also be brought to the site of active transcription. As a consequence, nucleosomes in the vicinity of the site of active transcription will have the histone tails deacetylated, allowing the deactylated tail to bind to DNA, thereby leading to an inactive chromatin structure and transcriptional repression []. The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis as a component of nuclear promyelocytic leukemia protein (PML) oncogenic domains (PODS). Daxx associates with PODs through a direct interaction with PML, a critical component of PODs. The interaction is a dynamic, cell cycle regulated event and is dependent on the post-translational modification of PML by the small ubiquitin-related modifier SUMO-1. ; PDB: 2KZS_A 2KZU_A.
Probab=56.87 E-value=3.6 Score=36.85 Aligned_cols=10 Identities=40% Similarity=0.803 Sum_probs=0.0
Q ss_pred ccCCcccccc
Q psy13267 89 DEAPISGHFA 98 (101)
Q Consensus 89 degpls~~F~ 98 (101)
.+.|++.+|.
T Consensus 557 eesP~Sql~e 566 (713)
T PF03344_consen 557 EESPLSQLFE 566 (713)
T ss_dssp ----------
T ss_pred cccccccccc
Confidence 4556666663
No 6
>PF04931 DNA_pol_phi: DNA polymerase phi; InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=53.46 E-value=3.1 Score=36.16 Aligned_cols=10 Identities=10% Similarity=0.003 Sum_probs=5.0
Q ss_pred HHHHhhhhhc
Q psy13267 52 MVKEAEVITK 61 (101)
Q Consensus 52 EkK~rkvltk 61 (101)
..+-++++..
T Consensus 705 ~~~l~~aL~~ 714 (784)
T PF04931_consen 705 RSALAKALGD 714 (784)
T ss_pred HHHHHHHhcc
Confidence 3344666654
No 7
>KOG1834|consensus
Probab=37.50 E-value=7 Score=36.66 Aligned_cols=8 Identities=25% Similarity=0.289 Sum_probs=3.1
Q ss_pred CCCCccch
Q psy13267 13 RSSDDEGV 20 (101)
Q Consensus 13 ~~~~~~g~ 20 (101)
.+.+++.+
T Consensus 891 gs~ee~~e 898 (952)
T KOG1834|consen 891 GSIEEESE 898 (952)
T ss_pred Cccccccc
Confidence 34444333
No 8
>PRK13456 DNA protection protein DPS; Provisional
Probab=34.40 E-value=23 Score=27.36 Aligned_cols=21 Identities=29% Similarity=0.673 Sum_probs=15.0
Q ss_pred chhHH------HhhhcccCCccccccCC
Q psy13267 79 VIPQE------IVNYADEAPISGHFAKP 100 (101)
Q Consensus 79 viPQE------ia~fadegpls~~F~k~ 100 (101)
||.+| +.+|...|| |+||+|+
T Consensus 147 IL~dE~eH~~dl~~lL~~~~-~~~~~~~ 173 (186)
T PRK13456 147 ILQEEIEHEAWFSELLGGGP-SGHFRRS 173 (186)
T ss_pred HHHHHHHHHHHHHHHHhcCC-CcceecC
Confidence 56555 567777666 8999885
No 9
>PF04712 Radial_spoke: Radial spokehead-like protein
Probab=29.33 E-value=11 Score=31.88 Aligned_cols=26 Identities=12% Similarity=0.063 Sum_probs=16.8
Q ss_pred HHHHhhhhhcCCcccccccCCCccccc
Q psy13267 52 MVKEAEVITKAPLDCMCRPCTSIEESA 78 (101)
Q Consensus 52 EkK~rkvltkAPLeCMCRPCT~iEes~ 78 (101)
-+-.+.+..-+++..++ ||.++--++
T Consensus 384 p~~L~~iseD~~~~~~~-~~Ws~r~~s 409 (491)
T PF04712_consen 384 PPLLTPISEDKEIPGID-PAWSVRTSS 409 (491)
T ss_pred cccccchhhcccccCcC-CCceEEecC
Confidence 33445677778888876 777665544
No 10
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=25.88 E-value=8.1 Score=24.96 Aligned_cols=30 Identities=20% Similarity=0.471 Sum_probs=22.5
Q ss_pred ccccCCCcccccchhHHHhhhcccCCcccccc
Q psy13267 67 MCRPCTSIEESAVIPQEIVNYADEAPISGHFA 98 (101)
Q Consensus 67 MCRPCT~iEes~viPQEia~fadegpls~~F~ 98 (101)
.|.+|...... |.+-+..|++.|.+...|+
T Consensus 23 ~Cp~C~~~~~~--~~~~~~~~i~~~~v~~~~~ 52 (162)
T PF13462_consen 23 QCPHCAKFHEE--LEKLLKKYIDPGKVKFVFR 52 (162)
T ss_dssp TSHHHHHHHHH--HHHHHHHHTTTTTEEEEEE
T ss_pred CCHhHHHHHHH--HhhhhhhccCCCceEEEEE
Confidence 69999987654 4488888999998755543
No 11
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=24.67 E-value=16 Score=37.85 Aligned_cols=6 Identities=33% Similarity=0.512 Sum_probs=2.5
Q ss_pred cccccc
Q psy13267 65 DCMCRP 70 (101)
Q Consensus 65 eCMCRP 70 (101)
+|.-.+
T Consensus 207 d~f~~~ 212 (2849)
T PTZ00415 207 DCFKFI 212 (2849)
T ss_pred ceeeec
Confidence 344433
No 12
>KOG3046|consensus
Probab=24.48 E-value=34 Score=26.17 Aligned_cols=14 Identities=36% Similarity=0.762 Sum_probs=12.7
Q ss_pred cchhHHHhhhcccC
Q psy13267 78 AVIPQEIVNYADEA 91 (101)
Q Consensus 78 ~viPQEia~fadeg 91 (101)
.-||+|+..|+|+|
T Consensus 70 i~IPleVl~yIddG 83 (147)
T KOG3046|consen 70 IQIPLEVLEYIDDG 83 (147)
T ss_pred ccCcHHHHHHHhcC
Confidence 35999999999999
No 13
>PF08421 Methyltransf_13: Putative zinc binding domain; InterPro: IPR013630 This domain is found at the N terminus of bacterial methyltransferases. ; PDB: 4E2X_A 3NDJ_A 3NDI_A 4E32_A 4E33_A 4E31_A 4E2Y_A 4E2W_A 4E2Z_A 4E30_A.
Probab=21.37 E-value=16 Score=22.70 Aligned_cols=25 Identities=36% Similarity=0.743 Sum_probs=11.0
Q ss_pred cccCCCcccccchhHHHhhhcccC--CccccccCC
Q psy13267 68 CRPCTSIEESAVIPQEIVNYADEA--PISGHFAKP 100 (101)
Q Consensus 68 CRPCT~iEes~viPQEia~fadeg--pls~~F~k~ 100 (101)
||-|.+-. +..|+|=| |+++.|.+.
T Consensus 1 CR~Cgs~~--------l~~vldLG~~Pl~~~f~~~ 27 (62)
T PF08421_consen 1 CRICGSSD--------LKPVLDLGDQPLANSFLKP 27 (62)
T ss_dssp -TTTS-E---------EEEEEEEEEEE-TT--B-T
T ss_pred CCCCCCCc--------cceEeecCCCCccccccCh
Confidence 78887753 33455555 667777654
No 14
>KOG0299|consensus
Probab=20.34 E-value=45 Score=29.56 Aligned_cols=18 Identities=44% Similarity=0.416 Sum_probs=9.0
Q ss_pred HHHHHHHHHHHHHHHHHh
Q psy13267 39 EEEEEEEEEEEVEMVKEA 56 (101)
Q Consensus 39 eeeeEEEEEEevEEkK~r 56 (101)
++++.|.++|...+|+.|
T Consensus 60 ~e~e~e~~~Eta~ekr~R 77 (479)
T KOG0299|consen 60 EEEEDEFEEETAGEKRLR 77 (479)
T ss_pred hhhcccchhcchhHHHHH
Confidence 344444455555555544
Done!