Query         psy13283
Match_columns 124
No_of_seqs    168 out of 969
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 15:30:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13283.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13283hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04281 ZnMc_BMP1_TLD Zinc-dep 100.0 1.9E-40 4.2E-45  250.6   7.9   95    1-95    102-200 (200)
  2 cd04283 ZnMc_hatching_enzyme Z 100.0 3.9E-40 8.5E-45  245.8   7.5   91    1-94     92-182 (182)
  3 cd04282 ZnMc_meprin Zinc-depen 100.0 3.5E-39 7.6E-44  248.1   8.1   94    1-94    135-230 (230)
  4 KOG3714|consensus              100.0   3E-38 6.6E-43  259.8   7.3   99    1-99    174-274 (411)
  5 cd04280 ZnMc_astacin_like Zinc 100.0 5.1E-37 1.1E-41  228.0   7.2   92    1-92     89-180 (180)
  6 PF01400 Astacin:  Astacin (Pep 100.0 1.1E-36 2.4E-41  228.1   6.8   96    1-96     94-191 (191)
  7 cd04327 ZnMc_MMP_like_3 Zinc-d  99.9 2.4E-23 5.3E-28  156.3   4.0   76    1-93    107-198 (198)
  8 cd04268 ZnMc_MMP_like Zinc-dep  99.3 1.8E-12 3.9E-17   93.3   4.7   57    1-92    109-165 (165)
  9 cd00203 ZnMc Zinc-dependent me  98.6   6E-08 1.3E-12   69.6   4.6   57    1-92    111-167 (167)
 10 cd04278 ZnMc_MMP Zinc-dependen  71.4     6.8 0.00015   27.8   3.8   17   77-93    141-157 (157)
 11 PF12388 Peptidase_M57:  Dual-a  60.7     9.1  0.0002   29.5   2.8   17   76-92    195-211 (211)
 12 cd04277 ZnMc_serralysin_like Z  51.1      16 0.00036   26.5   2.8   19   75-93    168-186 (186)
 13 cd04276 ZnMc_MMP_like_2 Zinc-d  41.7      37 0.00081   25.6   3.5   40   45-93    157-196 (197)
 14 PF00413 Peptidase_M10:  Matrix  28.3      39 0.00085   23.2   1.6   15   79-93    140-154 (154)
 15 PF12999 PRKCSH-like:  Glucosid  26.7      31 0.00066   25.9   0.8   30   83-112    48-78  (176)
 16 KOG2397|consensus               24.3      47   0.001   28.6   1.6   28   85-112    56-84  (480)
 17 smart00235 ZnMc Zinc-dependent  21.2      49  0.0011   22.6   1.0   18   27-47    123-140 (140)

No 1  
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=100.00  E-value=1.9e-40  Score=250.62  Aligned_cols=95  Identities=32%  Similarity=0.522  Sum_probs=89.8

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCC-CCeEEecCCC---CccCCc
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNG-KDTIVAKKDP---KAILGQ   76 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g-~~Ti~~~~~~---~~~iGq   76 (124)
                      +|||+|||||+||.|+|+||.++.++||+|++...+.++|+||||+|||||++++||+++ .|||+|+.+.   ..+|||
T Consensus       102 ~HEhsRpDRD~yV~I~~~nI~~~~~~nF~k~~~~~~~~~g~pYDy~SiMHY~~~aFs~~~~~~Ti~p~~~~~~~~~~iGq  181 (200)
T cd04281         102 WHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPEEVDSLGEPYDFDSIMHYARNTFSRGMFLDTILPKRDPNGVRPEIGQ  181 (200)
T ss_pred             cchhccccccceEEEeecccCcchhhhhhhcCccccccCCCccCCCccccCCCCccccCCCCCceEECCCcccccccccc
Confidence            799999999999999999999999999999998888899999999999999999999987 8999997654   367999


Q ss_pred             CCCCCHHHHHHHHhhCCCC
Q psy13283         77 RRGATEGDLEKVRQMYCKK   95 (124)
Q Consensus        77 r~~lS~~Di~~IN~lY~C~   95 (124)
                      |.+||+.|+++||+||.|+
T Consensus       182 r~~lS~~Di~~iN~~Y~C~  200 (200)
T cd04281         182 RTRLSEGDIIQANKLYKCP  200 (200)
T ss_pred             cCCCCHHHHHHHHHhcCCC
Confidence            9999999999999999996


No 2  
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=100.00  E-value=3.9e-40  Score=245.79  Aligned_cols=91  Identities=34%  Similarity=0.581  Sum_probs=86.0

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCCCCeEEecCCCCccCCcCCCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNGKDTIVAKKDPKAILGQRRGA   80 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~l   80 (124)
                      +|||+|||||+||.|+|+||.|+.+.||+|.+.   .++|+||||+|||||++++||++|+|||+|+.++..+||||.+|
T Consensus        92 ~HEhsRpDRD~yV~I~~~nI~~~~~~nF~~~~~---~~~~~pYDy~SiMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~l  168 (182)
T cd04283          92 YHEQTRSDRDKYVRINWENIIPDQLYNFDKQDT---NNLGTPYDYSSVMHYGRYAFSINGKPTIVPIPDPNVPIGQRQGM  168 (182)
T ss_pred             cccccccccCceEEEehhhcCchHHhhhhhccc---cccCCcccceeeeccCCcccccCCCCeEEECCcccccccCCCCC
Confidence            799999999999999999999999999999864   46789999999999999999999999999976666789999999


Q ss_pred             CHHHHHHHHhhCCC
Q psy13283         81 TEGDLEKVRQMYCK   94 (124)
Q Consensus        81 S~~Di~~IN~lY~C   94 (124)
                      |+.|+++||+||+|
T Consensus       169 S~~Di~~iN~~Y~C  182 (182)
T cd04283         169 SNLDILRINKLYNC  182 (182)
T ss_pred             CHHHHHHHHHhcCC
Confidence            99999999999999


No 3  
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=100.00  E-value=3.5e-39  Score=248.07  Aligned_cols=94  Identities=30%  Similarity=0.439  Sum_probs=88.8

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCC-CCCeEEecCCC-CccCCcCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKN-GKDTIVAKKDP-KAILGQRR   78 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~-g~~Ti~~~~~~-~~~iGqr~   78 (124)
                      ||||+|||||+||+|+|+||.++..+||+|++...+.++|+||||+|||||++++||++ ++|||+|+... ..+||||.
T Consensus       135 ~HEqsRpDRD~yV~I~~~nI~~~~~~nF~k~~~~~~~~~g~pYDy~SIMHY~~~aFs~~~~~pTi~~~~~~~~~~iGqr~  214 (230)
T cd04282         135 YHEQSRSDRDDYVKIWWDQILSGREHNFNKYDDSFSTDLNTPYDYESVMHYSPFSFNKGASEPTITTKIPEFNDIIGQRL  214 (230)
T ss_pred             cccccccccccceEEeecccCchHHHHhhhcCccccccCCCCCCcccccccCCCccccCCCCceeeecCCcccccccccC
Confidence            79999999999999999999999999999999888889999999999999999999999 69999996543 57899999


Q ss_pred             CCCHHHHHHHHhhCCC
Q psy13283         79 GATEGDLEKVRQMYCK   94 (124)
Q Consensus        79 ~lS~~Di~~IN~lY~C   94 (124)
                      +||+.|+++||+||+|
T Consensus       215 ~lS~~Di~~iN~~Y~C  230 (230)
T cd04282         215 DFSDIDLERLNRMYNC  230 (230)
T ss_pred             CCCHHHHHHHHHhcCC
Confidence            9999999999999999


No 4  
>KOG3714|consensus
Probab=100.00  E-value=3e-38  Score=259.81  Aligned_cols=99  Identities=35%  Similarity=0.560  Sum_probs=92.8

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCC-CCeEEecCCC-CccCCcCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNG-KDTIVAKKDP-KAILGQRR   78 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g-~~Ti~~~~~~-~~~iGqr~   78 (124)
                      ||||+|||||+||+|+|+||.++.+.||+|++...+.++|+||||+|||||++++||+++ .|||+|+... ..+||||.
T Consensus       174 ~HehsR~DRD~yV~I~~~ni~~~~~~nF~k~~~~~~~~~~~pYDygSvMHY~~~afs~~~~~~ti~~~~~~~~~~mGqr~  253 (411)
T KOG3714|consen  174 WHEHSRPDRDNYVSINWDNIDPGQEYNFEKYSPDEVTTYGVPYDYGSVMHYAPYAFSKNGSLPTIVPKDNGFQNTMGQRE  253 (411)
T ss_pred             hhccCcccccCceEEeeccCChhhhhhhhhcChhhhhccCCcccCCcccccCCcccCcCCCCCceecccccccccccccC
Confidence            899999999999999999999999999999999888999999999999999999999999 7799997653 45799999


Q ss_pred             CCCHHHHHHHHhhCCCCCCCC
Q psy13283         79 GATEGDLEKVRQMYCKKNANT   99 (124)
Q Consensus        79 ~lS~~Di~~IN~lY~C~~~~~   99 (124)
                      +||+.|+.+||+||+|+..+.
T Consensus       254 ~~S~~Di~~iN~~Y~C~~~~~  274 (411)
T KOG3714|consen  254 RLSFYDIRKINKLYCCPECCE  274 (411)
T ss_pred             cCCHHHHHHHHhhcCCCccCc
Confidence            999999999999999988754


No 5  
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=100.00  E-value=5.1e-37  Score=228.02  Aligned_cols=92  Identities=42%  Similarity=0.672  Sum_probs=86.9

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCCCCeEEecCCCCccCCcCCCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNGKDTIVAKKDPKAILGQRRGA   80 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~l   80 (124)
                      +|||+|||||+||.|+|+||.++.+.||+|.+...+.++|+||||+|||||++++||++|.|||+|+......+|||.+|
T Consensus        89 ~HEh~R~DRD~yv~i~~~ni~~~~~~nf~~~~~~~~~~~~~~YDy~SiMhY~~~~fs~~~~~ti~~~~~~~~~~g~~~~~  168 (180)
T cd04280          89 YHEQSRPDRDDYVTINWENIQPGYEHNFDKYSPDTVTTYGVPYDYGSVMHYGPTAFSKNGKPTIVPKDPGYQIIGQREGL  168 (180)
T ss_pred             cchhcccccCCeEEEeecccChhHHHHhhhcCcccccccCCcCCcceEeccCCcccccCCCceEEECCchhhcccCCCCC
Confidence            69999999999999999999999999999999988888999999999999999999999999999976555558999999


Q ss_pred             CHHHHHHHHhhC
Q psy13283         81 TEGDLEKVRQMY   92 (124)
Q Consensus        81 S~~Di~~IN~lY   92 (124)
                      |+.|+++||+||
T Consensus       169 S~~D~~~in~~Y  180 (180)
T cd04280         169 SFLDIKKINKMY  180 (180)
T ss_pred             CHHHHHHHHHhC
Confidence            999999999998


No 6  
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=100.00  E-value=1.1e-36  Score=228.08  Aligned_cols=96  Identities=31%  Similarity=0.551  Sum_probs=69.2

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCC-CCeEEecCC-CCccCCcCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNG-KDTIVAKKD-PKAILGQRR   78 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g-~~Ti~~~~~-~~~~iGqr~   78 (124)
                      +|||+|||||+||+|+|+||.++.+.||.+.+...+..+++||||+|||||++.+|++++ .|||+|+.. ...+||++.
T Consensus        94 ~HEh~RpDRd~yi~i~~~~i~~~~~~~f~~~~~~~~~~~~~pYD~~SIMHY~~~~~s~~~~~~ti~~~~~~~~~~iG~~~  173 (191)
T PF01400_consen   94 WHEHQRPDRDNYITINWDNIQPGYKHNFDKYPPSEWSTYGSPYDYGSIMHYSSYAFSKNGSQPTITPKDPKYQETIGQRN  173 (191)
T ss_dssp             --GGGSTTGGGTEEE-GGGB-TTSGGGG---SGGGBE-TTS---TT-TT---TTTTBSSTTS-SEEESSTTCTS-GGG-S
T ss_pred             hhhhhccccccEEEEehhcchhhhhhhhhccccccccccCCCcCccCeecccCcccccCCCCCeEEecCCCCcccccccC
Confidence            699999999999999999999999999999998888899999999999999999999998 999999754 479999999


Q ss_pred             CCCHHHHHHHHhhCCCCC
Q psy13283         79 GATEGDLEKVRQMYCKKN   96 (124)
Q Consensus        79 ~lS~~Di~~IN~lY~C~~   96 (124)
                      +||+.|+++||.+|+|+.
T Consensus       174 ~lS~~D~~~in~~Y~C~~  191 (191)
T PF01400_consen  174 RLSFTDIKQINKMYNCPE  191 (191)
T ss_dssp             S--HHHHHHHHHHTT---
T ss_pred             CCCHHHHHHHHHhcCCCC
Confidence            999999999999999973


No 7  
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.88  E-value=2.4e-23  Score=156.27  Aligned_cols=76  Identities=24%  Similarity=0.357  Sum_probs=62.8

Q ss_pred             CcccCCcCCCCceEEecc--Cccc-----------chh--hhhccccCCCccCCCcccccccCCCCC-CCcccCCCCCeE
Q psy13283          1 MHLKKNLAWRTAVRLDIK--FLVS-----------AYW--NDFGKASPKDVSDYGVPYDFQSVMHYP-AKAFSKNGKDTI   64 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~--NI~~-----------~~~--~nF~k~~~~~~~~~g~pYDy~SVMHY~-~~afs~~g~~Ti   64 (124)
                      +|||+|||||    |.|+  +|.+           +..  .+|.|+...  ..+|+||||+|||||+ +.+|+++|.+| 
T Consensus       107 ~HEh~rpdrd----i~w~~~~i~~~~~~~~~~~~~~~~~~~~f~~~~~~--~~~~~~yD~~SIMHY~~~~~~t~~g~~t-  179 (198)
T cd04327         107 IHEHQSPAAN----IPWDKEAVYAYFSGPPNWDRETVINHNVFAKLDDG--DVAYSPYDPDSIMHYPFPGSLTLDGEEV-  179 (198)
T ss_pred             cccccCCCCC----CCcCHHHHHHHHhcCCCCcHHHHHHhhhhhccccc--cccCCCCCcHHHHcCCCcHHhhcCCccc-
Confidence            6999999999    6776  4432           223  789998753  5689999999999999 79999988765 


Q ss_pred             EecCCCCccCCcCCCCCHHHHHHHHhhCC
Q psy13283         65 VAKKDPKAILGQRRGATEGDLEKVRQMYC   93 (124)
Q Consensus        65 ~~~~~~~~~iGqr~~lS~~Di~~IN~lY~   93 (124)
                                |++.+||..|+++||+||.
T Consensus       180 ----------~~~~~lS~~D~~~i~~~Yp  198 (198)
T cd04327         180 ----------PPNRTLSDKDKAFMRLLYP  198 (198)
T ss_pred             ----------CCCCCCCHHHHHHHHHhCc
Confidence                      6788999999999999994


No 8  
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=99.32  E-value=1.8e-12  Score=93.34  Aligned_cols=57  Identities=23%  Similarity=0.198  Sum_probs=50.3

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCCCCeEEecCCCCccCCcCCCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNGKDTIVAKKDPKAILGQRRGA   80 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~l   80 (124)
                      .|||+|+|||.||                       ..++.|||+.|||||....|+.+            ..+|++..|
T Consensus       109 ~H~~~~~~~~~~~-----------------------~~~~~~~~~~SvM~y~~~~~~~~------------~~~~~~~~~  153 (165)
T cd04268         109 RHNFAASDRDDNV-----------------------DLLAEKGDTSSVMDYAPSNFSIQ------------LGDGQKYTI  153 (165)
T ss_pred             cccCcCCccCCcc-----------------------hhhccCCCCcccCCCCccccccc------------cccccCCCC
Confidence            5999999999988                       45788999999999999988764            346788899


Q ss_pred             CHHHHHHHHhhC
Q psy13283         81 TEGDLEKVRQMY   92 (124)
Q Consensus        81 S~~Di~~IN~lY   92 (124)
                      |..||++|+.||
T Consensus       154 ~~~Di~ai~~lY  165 (165)
T cd04268         154 GPYDIAAIKKLY  165 (165)
T ss_pred             CHHHHHHHHhcC
Confidence            999999999998


No 9  
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=98.60  E-value=6e-08  Score=69.59  Aligned_cols=57  Identities=23%  Similarity=0.351  Sum_probs=47.4

Q ss_pred             CcccCCcCCCCceEEeccCcccchhhhhccccCCCccCCCcccccccCCCCCCCcccCCCCCeEEecCCCCccCCcCCCC
Q psy13283          1 MHLKKNLAWRTAVRLDIKFLVSAYWNDFGKASPKDVSDYGVPYDFQSVMHYPAKAFSKNGKDTIVAKKDPKAILGQRRGA   80 (124)
Q Consensus         1 ~HEh~RpDRD~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SVMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~l   80 (124)
                      .|++.|+|||.+|.|                .   ....+.+|++.|||||....|+                ++++..+
T Consensus       111 ~H~~~~~~~~~~~~~----------------~---~~~~~~~~~~~siM~y~~~~~~----------------~~~~~~f  155 (167)
T cd00203         111 YHDHDRKDRDDYPTI----------------D---DTLNAEDDDYYSVMSYTKGSFS----------------DGQRKDF  155 (167)
T ss_pred             CccCcCCCCCCCccc----------------c---ccccCCCCCCCeEeccCccccC----------------cccCCCc
Confidence            599999999999887                1   1335679999999999866553                5778889


Q ss_pred             CHHHHHHHHhhC
Q psy13283         81 TEGDLEKVRQMY   92 (124)
Q Consensus        81 S~~Di~~IN~lY   92 (124)
                      |..|+.+|+++|
T Consensus       156 S~~d~~~i~~~Y  167 (167)
T cd00203         156 SQCDIDQINKLY  167 (167)
T ss_pred             CHHHHHHHHhhC
Confidence            999999999998


No 10 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=71.42  E-value=6.8  Score=27.76  Aligned_cols=17  Identities=12%  Similarity=0.399  Sum_probs=15.0

Q ss_pred             CCCCCHHHHHHHHhhCC
Q psy13283         77 RRGATEGDLEKVRQMYC   93 (124)
Q Consensus        77 r~~lS~~Di~~IN~lY~   93 (124)
                      ...||..|+..|+.||.
T Consensus       141 ~~~l~~~D~~~~~~lYg  157 (157)
T cd04278         141 KFKLSQDDIRGIQALYG  157 (157)
T ss_pred             CCCCCHHHHHHHHHhcC
Confidence            46799999999999994


No 11 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=60.74  E-value=9.1  Score=29.46  Aligned_cols=17  Identities=18%  Similarity=0.362  Sum_probs=14.6

Q ss_pred             cCCCCCHHHHHHHHhhC
Q psy13283         76 QRRGATEGDLEKVRQMY   92 (124)
Q Consensus        76 qr~~lS~~Di~~IN~lY   92 (124)
                      ....+|..|+..|+.||
T Consensus       195 ~~~~f~~~Di~Al~~lY  211 (211)
T PF12388_consen  195 EDGEFTSNDITALNYLY  211 (211)
T ss_pred             CCCCcChhhHHHHHhhC
Confidence            34569999999999998


No 12 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=51.11  E-value=16  Score=26.47  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=15.5

Q ss_pred             CcCCCCCHHHHHHHHhhCC
Q psy13283         75 GQRRGATEGDLEKVRQMYC   93 (124)
Q Consensus        75 Gqr~~lS~~Di~~IN~lY~   93 (124)
                      +.-..+...||+.|..||.
T Consensus       168 ~~~~~~~~~DI~AlQ~lYG  186 (186)
T cd04277         168 GYPQTPMLLDIAALQYLYG  186 (186)
T ss_pred             cccCCccHHHHHHHHHhhC
Confidence            3446788999999999994


No 13 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=41.74  E-value=37  Score=25.58  Aligned_cols=40  Identities=23%  Similarity=0.171  Sum_probs=24.8

Q ss_pred             cccCCCCCCCcccCCCCCeEEecCCCCccCCcCCCCCHHHHHHHHhhCC
Q psy13283         45 FQSVMHYPAKAFSKNGKDTIVAKKDPKAILGQRRGATEGDLEKVRQMYC   93 (124)
Q Consensus        45 y~SVMHY~~~afs~~g~~Ti~~~~~~~~~iGqr~~lS~~Di~~IN~lY~   93 (124)
                      ..|||-|.+......+       .+..  -.-...+-..|+..|..+|.
T Consensus       157 ~~SVMdY~~~~~~~~~-------~~~~--~~~~~~~g~yDi~Aiq~~Y~  196 (197)
T cd04276         157 TSSVMDYPPPNVAAQG-------EDQG--DYYPPTIGPYDKWAIEYGYT  196 (197)
T ss_pred             cceeecCccccccccC-------cccc--ccccCCCchHHHHHHHHHcC
Confidence            4699999865543322       0111  12234577789999999994


No 14 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=28.29  E-value=39  Score=23.22  Aligned_cols=15  Identities=20%  Similarity=0.523  Sum_probs=14.1

Q ss_pred             CCCHHHHHHHHhhCC
Q psy13283         79 GATEGDLEKVRQMYC   93 (124)
Q Consensus        79 ~lS~~Di~~IN~lY~   93 (124)
                      .||..|+..|++||+
T Consensus       140 ~l~~~Di~~i~~lYg  154 (154)
T PF00413_consen  140 TLSEDDIDGIQYLYG  154 (154)
T ss_dssp             STTHHHHHHHHHHHS
T ss_pred             CCCHHHHHHHHHHhC
Confidence            899999999999995


No 15 
>PF12999 PRKCSH-like:  Glucosidase II beta subunit-like
Probab=26.73  E-value=31  Score=25.87  Aligned_cols=30  Identities=10%  Similarity=0.386  Sum_probs=22.9

Q ss_pred             HHHHHHHhhCC-CCCCCCCCChhhhccCccc
Q psy13283         83 GDLEKVRQMYC-KKNANTDDGLDEVEDNRLL  112 (124)
Q Consensus        83 ~Di~~IN~lY~-C~~~~~~~g~~~~~~~~~~  112 (124)
                      ..+.+||-=|| |++.+.-+|..-|.||+|+
T Consensus        48 I~~~~iNDdyCDC~DGSDEPGTsAC~~~~Fy   78 (176)
T PF12999_consen   48 IPFSQINDDYCDCPDGSDEPGTSACSNGKFY   78 (176)
T ss_pred             ecHHHccCcceeCCCCCCccccccCcCceEe
Confidence            45667888886 8888777788888777765


No 16 
>KOG2397|consensus
Probab=24.32  E-value=47  Score=28.64  Aligned_cols=28  Identities=7%  Similarity=0.318  Sum_probs=24.4

Q ss_pred             HHHHHhhCC-CCCCCCCCChhhhccCccc
Q psy13283         85 LEKVRQMYC-KKNANTDDGLDEVEDNRLL  112 (124)
Q Consensus        85 i~~IN~lY~-C~~~~~~~g~~~~~~~~~~  112 (124)
                      +.+||..|| |.+...-+|..-|-||.|+
T Consensus        56 f~qlNDd~CDC~DGsDEPGtsACpngkF~   84 (480)
T KOG2397|consen   56 FSQLNDDSCDCLDGSDEPGTSACPNGKFY   84 (480)
T ss_pred             HHHhccccccCCCCCCCCccccCCCCcee
Confidence            578999996 8888888999999999886


No 17 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=21.18  E-value=49  Score=22.62  Aligned_cols=18  Identities=33%  Similarity=0.803  Sum_probs=12.4

Q ss_pred             hhccccCCCccCCCccccccc
Q psy13283         27 DFGKASPKDVSDYGVPYDFQS   47 (124)
Q Consensus        27 nF~k~~~~~~~~~g~pYDy~S   47 (124)
                      +|.+..   .+..|+||||+|
T Consensus       123 ~~~~~~---~~~~~~~~~yg~  140 (140)
T smart00235      123 NFDLSN---DDSLGIPYDYGS  140 (140)
T ss_pred             cccccc---ccCCCchhccCc
Confidence            555542   256789999987


Done!