RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy13289
         (106 letters)



>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 65.5 bits (160), Expect = 3e-14
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DDL  I +LGRGAYG+V+KMRHV TGT+MAVK
Sbjct: 1   DDLEVIEELGRGAYGVVDKMRHVPTGTIMAVK 32


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 7.  Protein kinases (PKs), MAP
           kinase kinase 7 (MKK7) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK7 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK7 is a dual-specificity PK that phosphorylates and
           activates its downstream target, c-Jun N-terminal kinase
           (JNK), on specific threonine and tyrosine residues.
           Although MKK7 is capable of dual phosphorylation, it
           prefers to phosphorylate the threonine residue of JNK.
           Thus, optimal activation of JNK requires both MKK4 (not
           included in this subfamily) and MKK7. MKK7 is primarily
           activated by cytokines. MKK7 is essential for liver
           formation during embryogenesis. It plays roles in G2/M
           cell cycle arrest and cell growth. In addition, it is
           involved in the control of programmed cell death, which
           is crucial in oncogenesis, cancer chemoresistance, and
           antagonism to TNFalpha-induced killing, through its
           inhibition by Gadd45beta and the subsequent suppression
           of the JNK cascade.
          Length = 296

 Score = 49.3 bits (118), Expect = 3e-08
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 58  TITIGDKTFVVEADDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
            +TI  + +  + +DL  + ++G G  G V KMR   TG +MAVK
Sbjct: 2   YLTIDGQKYPADLNDLENLGEIGSGTCGQVYKMRFKKTGHVMAVK 46


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 48.1 bits (115), Expect = 6e-08
 Identities = 18/34 (52%), Positives = 25/34 (73%)

Query: 69  EADDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
            A+DL  + ++GRGA+G V KM H  +GT+MAVK
Sbjct: 2   TAEDLKDLGEIGRGAFGTVNKMLHKPSGTIMAVK 35


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 46.5 bits (111), Expect = 2e-07
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           DDL  + +LG G  G+V K+ H  TG +MAVK 
Sbjct: 1   DDLEYLGELGAGNSGVVSKVLHRPTGKIMAVKT 33


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 41.4 bits (98), Expect = 1e-05
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            DL ++  LG+G+ G+V K+RH  TG + A+K+
Sbjct: 1   SDLERVKVLGQGSSGVVYKVRHKPTGKIYALKK 33


>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase.  Protein kinases (PKs), MAP/ERK
           kinase (MEK) subfamily, catalytic (c) domain. PKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine or tyrosine residues on protein
           substrates. The MEK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1
           and MEK2 are dual-specificity PKs that phosphorylate and
           activate the downstream targets, ERK(extracellular
           signal-regulated kinase) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1/2, and finally to ERK1/2. The ERK
           cascade plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. This cascade has also been
           implicated in synaptic plasticity, migration,
           morphological determination, and stress response
           immunological reactions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1/2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 308

 Score = 39.7 bits (93), Expect = 7e-05
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DD  K+ +LG G  G+V K+ H  +G +MA K
Sbjct: 1   DDFEKLGELGAGNGGVVTKVLHRPSGLIMARK 32


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 1 (CDKL1) and CDKL4 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL1 and CDKL4
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL1, also called
           p42 KKIALRE, is a glial protein that is upregulated in
           gliosis. It is present in neuroblastoma and A431 human
           carcinoma cells, and may be implicated in neoplastic
           transformation. The function of CDKL4 is unknown.
          Length = 286

 Score = 39.3 bits (92), Expect = 9e-05
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           K+  +G G+YG+V K R+  TG ++A+K
Sbjct: 5   KLSKIGEGSYGVVFKCRNRETGQIVAIK 32


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 38.7 bits (90), Expect = 1e-04
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           D++  + +LG+G YG V K+ H  TG  MA+KE
Sbjct: 1   DEIEVLDELGKGNYGSVYKVLHRPTGVTMAMKE 33


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 38.5 bits (90), Expect = 2e-04
 Identities = 13/29 (44%), Positives = 21/29 (72%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            +  +G GAYG+V K R+ ATG ++A+K+
Sbjct: 5   VLGVVGEGAYGVVLKCRNKATGEIVAIKK 33


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 37.5 bits (88), Expect = 3e-04
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG G++G V   R   TG ++A+K 
Sbjct: 7   LGEGSFGKVYLARDKKTGKLVAIKV 31


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score = 37.1 bits (86), Expect = 6e-04
 Identities = 17/35 (48%), Positives = 23/35 (65%)

Query: 68  VEADDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +  +DL  I DLG G  G V K++H+ TGT+MA K
Sbjct: 2   LRNEDLETISDLGAGNGGSVSKVKHIPTGTVMAKK 36


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
           protein kinase kinase kinase kinase-like Protein
           Serine/Threonine Kinases.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily includes MAP4K3, MAP4K1,
           MAP4K2, MAP4K5, and related proteins. Vertebrate members
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain, similar to
           MAP4K4/6. MAP4Ks are involved in some MAPK signaling
           pathways that are important in mediating cellular
           responses to extracellular signals by activating a MAPK
           kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAP3K to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. MAP4K1, also called haematopoietic
           progenitor kinase 1 (HPK1), is a hematopoietic-specific
           STK involved in many cellular signaling cascades
           including MAPK, antigen receptor, apoptosis, growth
           factor, and cytokine signaling. It participates in the
           regulation of T cell receptor signaling and T
           cell-mediated immune responses. MAP4K2 was referred to
           as germinal center (GC) kinase because of its preferred
           location in GC B cells. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. It is required in the activation
           of S6 kinase by amino acids and for the phosphorylation
           of the mTOR-regulated inhibitor of eukaryotic initiation
           factor 4E. MAP4K5, also called germinal center
           kinase-related enzyme (GCKR), has been shown to activate
           the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 35.7 bits (83), Expect = 0.002
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G G YG V K R +ATG ++A+K
Sbjct: 11  IGSGTYGDVYKARDIATGELVAIK 34


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 35.6 bits (83), Expect = 0.002
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           + L KI   G+G +G V K RH  TG  +A+K
Sbjct: 3   EILEKI---GKGGFGEVYKARHKRTGKEVAIK 31


>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 1 from higher
           eukaryotes-like.  Serine/Threonine Kinases (STKs),
           Cyclin-Dependent protein Kinase 1 (CDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes. CDK1 is also called Cell division control
           protein 2 (Cdc2) or p34 protein kinase, and is regulated
           by cyclins A, B, and E. The CDK1/cyclin A complex
           controls G2 phase entry and progression. CDK1/cyclin A2
           has also been implicated as an important regulator of S
           phase events. The CDK1/cyclin B complex is critical for
           G2 to M phase transition. It induces mitosis by
           activating nuclear enzymes that regulate chromatin
           condensation, nuclear membrane degradation,
           mitosis-specific microtubule and cytoskeletal
           reorganization. CDK1 also associates with cyclin E and
           plays a role in the entry into S phase. CDK1
           transcription is stable throughout the cell cycle but is
           modulated in some pathological conditions. It may play a
           role in regulating apoptosis under these conditions. In
           breast cancer cells, HER2 can mediate apoptosis by
           inactivating CDK1. Activation of CDK1 may contribute to
           HIV-1 induced apoptosis and neuronal apoptosis in
           neurodegenerative diseases.
          Length = 285

 Score = 35.1 bits (81), Expect = 0.003
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 72  DLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           D  KI  +G G YG+V K R+  TG ++A+K+
Sbjct: 1   DYTKIEKIGEGTYGVVYKGRNKKTGQIVAMKK 32


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 4 and 6-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) and CDK6-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK4/6-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDK4 and CDK6
           partner with D-type cyclins to regulate the early G1
           phase of the cell cycle. They are the first kinase
           activated by mitogenic signals to release cells from the
           G0 arrested state. CDK4 and CDK6 are both expressed
           ubiquitously, associate with all three D cyclins (D1, D2
           and D3), and phosphorylate the retinoblastoma (pRb)
           protein. They are also regulated by the INK4 family of
           inhibitors which associate with either the CDK alone or
           the CDK/cyclin complex. CDK4 and CDK6 show differences
           in subcellular localization, sensitivity to some
           inhibitors, timing in activation, tumor selectivity, and
           possibly substrate profiles. Although CDK4 and CDK6 seem
           to show some redundancy, they also have discrete,
           nonoverlapping functions. CDK6 plays an important role
           in cell differentiation.
          Length = 287

 Score = 34.5 bits (80), Expect = 0.004
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +G GAYG V K R + TG  +A+K+
Sbjct: 7   IGEGAYGTVYKARDLNTGRFVALKK 31


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 34.4 bits (80), Expect = 0.005
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVK 102
           I  LG G +G V   R+  TG ++A+K
Sbjct: 4   IKQLGDGTFGSVYLARNKETGELVAIK 30


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 33.8 bits (78), Expect = 0.008
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG G++G V K +H  TG ++AVK 
Sbjct: 7   LGSGSFGTVYKAKHKGTGKIVAVKI 31


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score = 33.5 bits (76), Expect = 0.011
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DD  +I +LG G  G+V K++H  +G +MA K
Sbjct: 5   DDFERISELGAGNGGVVTKVQHKPSGLIMARK 36


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 33.3 bits (77), Expect = 0.012
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LGRG++G V       TG +MAVK 
Sbjct: 8   LGRGSFGSVYLALDKDTGELMAVKS 32


>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 1.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK1 is preferentially expressed in the liver,
           lung, spleen, testes, and kidney. It mediates signaling
           from Rho to the actin cytoskeleton. It is implicated in
           the development of cardiac fibrosis, cardiomyocyte
           apoptosis, and hyperglycemia. Mice deficient with ROCK1
           display eyelids open at birth (EOB) and omphalocele
           phenotypes due to the disorganization of actin filaments
           in the eyelids and the umbilical ring.
          Length = 371

 Score = 33.1 bits (75), Expect = 0.013
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 34  GLSLQVSAVESPAVSIPSNLD------KKTTITIGDKTFVVEADDLVKICDLGRGAYGIV 87
           GL   V  ++ PA+    N+D      K T   I D     E  ++VK+  +GRGA+G V
Sbjct: 2   GLDALVYDLDFPALRKNKNIDNFLNRYKDTINKIRDLRMKAEDYEVVKV--IGRGAFGEV 59

Query: 88  EKMRHVATGTMMAVK 102
           + +RH +T  + A+K
Sbjct: 60  QLVRHKSTRKVYAMK 74


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 32.9 bits (76), Expect = 0.015
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           LG+G++G V  +R   TG + A+K
Sbjct: 1   LGKGSFGKVLLVRKKDTGKLYAMK 24


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 7.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK7 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK7
           plays essential roles in the cell cycle and in
           transcription. It associates with cyclin H and MAT1 and
           acts as a CDK-Activating Kinase (CAK) by phosphorylating
           and activating cell cycle CDKs (CDK1/2/4/6). In the
           brain, it activates CDK5. CDK7 is also a component of
           the general transcription factor TFIIH, which
           phosphorylates the C-terminal domain (CTD) of RNA
           polymerase II when it is bound with unphosphorylated
           DNA, as present in the pre-initiation complex. Following
           phosphorylation, the CTD dissociates from the DNA which
           allows transcription initiation.
          Length = 298

 Score = 32.9 bits (76), Expect = 0.015
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 74  VKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            K   LG G Y +V K R   TG ++A+K+
Sbjct: 3   EKGKKLGEGTYAVVYKARDKETGRIVAIKK 32


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score = 32.7 bits (75), Expect = 0.018
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           K+  +G G YG+V K R   TG ++A+K
Sbjct: 3   KLGKIGEGTYGVVYKARDKLTGEIVAIK 30


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 1-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes, plants, and yeasts, as well as CDK2 and
           CDK3. CDK1 is also called Cell division control protein
           2 (Cdc2) or p34 protein kinase, and is regulated by
           cyclins A, B, and E. The CDK1/cyclin A complex controls
           G2 phase entry and progression while the CDK1/cyclin B
           complex is critical for G2 to M phase transition. CDK2
           is regulated by cyclin E or cyclin A. Upon activation by
           cyclin E, it phosphorylates the retinoblastoma (pRb)
           protein which activates E2F mediated transcription and
           allows cells to move into S phase. The CDK2/cyclin A
           complex plays a role in regulating DNA replication.
           Studies in knockout mice revealed that CDK1 can
           compensate for the loss of the cdk2 gene as it can also
           bind cyclin E and drive G1 to S phase transition. CDK3
           is regulated by cyclin C and it phosphorylates pRB
           specifically during the G0/G1 transition. This
           phosphorylation is required for cells to exit G0
           efficiently and enter the G1 phase.
          Length = 283

 Score = 32.7 bits (75), Expect = 0.020
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           K+  +G G YG+V K R   TG ++A+K
Sbjct: 3   KVEKIGEGTYGVVYKARDKLTGEIVALK 30


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score = 32.3 bits (74), Expect = 0.027
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G GA+GIV K +   TG  +A+K
Sbjct: 8   IGEGAHGIVFKAKDRETGETVALK 31


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 32.1 bits (74), Expect = 0.029
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           K+  LG G YG+V K R   TG ++A+K+
Sbjct: 3   KLEKLGEGTYGVVYKARDKKTGEIVALKK 31


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 32.0 bits (73), Expect = 0.030
 Identities = 13/24 (54%), Positives = 19/24 (79%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +GRGAYG V + +HV TG ++A+K
Sbjct: 9   IGRGAYGAVYRGKHVPTGRVVALK 32


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 31.9 bits (73), Expect = 0.035
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           +  LG G+YG V K  H  TG ++A+K 
Sbjct: 8   LEKLGEGSYGSVYKAIHKETGQVVAIKV 35


>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase.  Serine/Threonine Kinases
           (STKs), Rho-associated coiled-coil containing protein
           kinase (ROCK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The ROCK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. ROCK is also referred to as Rho-associated
           kinase or simply as Rho kinase. It contains an
           N-terminal extension, a catalytic kinase domain, and a
           long C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain. It is activated via interaction with Rho GTPases
           and is involved in many cellular functions including
           contraction, adhesion, migration, motility,
           proliferation, and apoptosis. The ROCK subfamily
           consists of two isoforms, ROCK1 and ROCK2, which may be
           functionally redundant in some systems, but exhibit
           different tissue distributions. Both isoforms are
           ubiquitously expressed in most tissues, but ROCK2 is
           more prominent in brain and skeletal muscle while ROCK1
           is more pronounced in the liver, testes, and kidney.
           Studies in knockout mice result in different phenotypes,
           suggesting that the two isoforms do not compensate for
           each other during embryonic development.
          Length = 370

 Score = 32.1 bits (73), Expect = 0.036
 Identities = 13/35 (37%), Positives = 24/35 (68%)

Query: 68  VEADDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           ++A+D   I  +GRGA+G V+ +RH ++  + A+K
Sbjct: 40  MKAEDFDVIKVIGRGAFGEVQLVRHKSSKQVYAMK 74


>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 9.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK9 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK9
           together with a cyclin partner (cyclin T1, T2a, T2b, or
           K) is the main component of distinct positive
           transcription elongation factors (P-TEFb), which
           function as Ser2 C-terminal domain kinases of RNA
           polymerase II. P-TEFb participates in multiple steps of
           gene expression including transcription elongation, mRNA
           synthesis, processing, export, and translation. It also
           plays a role in mediating cytokine induced transcription
           networks such as IL6-induced STAT3 signaling. In
           addition, the CDK9/cyclin T2a complex promotes muscle
           differentiation and enhances the function of some
           myogenic regulatory factors.
          Length = 310

 Score = 31.6 bits (72), Expect = 0.049
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 66  FVVEADDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           F  E     K+  +G+G +G V K RH  T  ++A+K+
Sbjct: 7   FCDEVSKYEKLAKIGQGTFGEVFKARHKKTKQIVALKK 44


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 31.1 bits (71), Expect = 0.076
 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 72  DLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +LV++  +G G YG V K RH  TG ++A+K
Sbjct: 9   ELVEV--IGEGTYGKVYKARHKKTGQLVAIK 37


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 30.7 bits (70), Expect = 0.086
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DD   I  +GRGA+G V  +R   TG + A+K
Sbjct: 1   DDFEVIKVIGRGAFGEVWLVRDKDTGQVYAMK 32


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 30.9 bits (70), Expect = 0.093
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           + +V++  LG GA G V K R   TG + A+K
Sbjct: 1   EKIVELSRLGEGAGGSVTKCRLKNTGMIFALK 32


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mitogen-Activated Protein
           Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
           (or MAP4K6) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAP4K4/MAP4K6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Members of this subfamily
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain. MAP4Ks (or
           MAPKKKKs) are involved in MAPK signaling pathways that
           are important in mediating cellular responses to
           extracellular signals by activating a MAPK kinase kinase
           (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAP4K4 is also called Nck Interacting kinase
           (NIK). It facilitates the activation of the MAPKs,
           extracellular signal-regulated kinase (ERK) 1, ERK2, and
           c-Jun N-terminal kinase (JNK), by phosphorylating and
           activating MEKK1. MAP4K4 plays a role in tumor necrosis
           factor (TNF) alpha-induced insulin resistance. MAP4K4
           silencing in skeletal muscle cells from type II diabetic
           patients restores insulin-mediated glucose uptake.
           MAP4K4, through JNK, also plays a broad role in cell
           motility, which impacts inflammation, homeostasis, as
           well as the invasion and spread of cancer. MAP4K4 is
           found to be highly expressed in most tumor cell lines
           relative to normal tissue. MAP4K6 (also called MINK for
           Misshapen/NIKs-related kinase) is activated after Ras
           induction and mediates activation of p38 MAPK. MAP4K6
           plays a role in cell cycle arrest, cytoskeleton
           organization, cell adhesion, and cell motility.
          Length = 282

 Score = 30.7 bits (69), Expect = 0.094
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 72  DLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +LV++  +G G YG V K RHV TG + A+K
Sbjct: 19  ELVEV--VGNGTYGQVYKGRHVKTGQLAAIK 47


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 30.6 bits (69), Expect = 0.10
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG GA+    + R V TGT+MAVK+
Sbjct: 8   LGTGAFSSCYQARDVKTGTLMAVKQ 32


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 30.5 bits (70), Expect = 0.11
 Identities = 8/25 (32%), Positives = 16/25 (64%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +G+G++G V  +R  + G +  +KE
Sbjct: 8   IGKGSFGKVYLVRRKSDGKLYVLKE 32


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 30.3 bits (69), Expect = 0.12
 Identities = 11/25 (44%), Positives = 19/25 (76%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +GRGA+G+V K  ++ TG  +A+K+
Sbjct: 8   IGRGAFGVVYKGLNLETGDFVAIKQ 32


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase 15.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK15 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. Human MAPK15 is also called
           Extracellular signal Regulated Kinase 8 (ERK8) while the
           rat protein is called ERK7. ERK7 and ERK8 display both
           similar and different biochemical properties. They
           autophosphorylate and activate themselves and do not
           require upstream activating kinases. ERK7 is
           constitutively active and is not affected by
           extracellular stimuli whereas ERK8 shows low basal
           activity and is activated by DNA-damaging agents. ERK7
           and ERK8 also have different substrate profiles. Genome
           analysis shows that they are orthologs with similar gene
           structures. ERK7 and ERK 8 may be involved in the
           signaling of some nuclear receptor transcription
           factors. ERK7 regulates hormone-dependent degradation of
           estrogen receptor alpha while ERK8 down-regulates the
           transcriptional co-activation androgen and
           glucocorticoid receptors.
          Length = 337

 Score = 30.2 bits (69), Expect = 0.13
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +  LG+GAYGIV K     T  ++A+K
Sbjct: 12  LQKLGKGAYGIVWKAIDRRTKEVVALK 38


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 9-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK9-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK9 and CDK12 from higher eukaryotes, yeast
           BUR1, C-type plant CDKs (CdkC), and similar proteins.
           CDK9, BUR1, and CdkC are functionally equivalent. They
           act as a kinase for the C-terminal domain of RNA
           polymerase II and participate in regulating mutliple
           steps of gene expression including transcription
           elongation and RNA processing. CDK9 and CdkC associate
           with T-type cyclins while BUR1 associates with the
           cyclin BUR2. CDK12 is a unique CDK that contains an
           arginine/serine-rich (RS) domain, which is predominantly
           found in splicing factors. CDK12 interacts with cyclins
           L1 and L2, and participates in regulating transcription
           and alternative splicing.
          Length = 287

 Score = 30.2 bits (69), Expect = 0.13
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           KI  +G G YG V K R+  TG ++A+K
Sbjct: 3   KIAQIGEGTYGQVYKARNKKTGELVALK 30


>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 2.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK2 was the first identified target of
           activated RhoA, and was found to play a role in stress
           fiber and focal adhesion formation. It is prominently
           expressed in the brain, heart, and skeletal muscles. It
           is implicated in vascular and neurological disorders,
           such as hypertension and vasospasm of the coronary and
           cerebral arteries. ROCK2 is also activated by caspase-2
           cleavage, resulting in thrombin-induced microparticle
           generation in response to cell activation. Mice
           deficient in ROCK2 show intrauterine growth retardation
           and embryonic lethality because of placental
           dysfunction.
          Length = 370

 Score = 30.4 bits (68), Expect = 0.13
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 34  GLSLQVSAVESPAVSIPSNLD------KKTTITIGDKTFVVEADDLVKICDLGRGAYGIV 87
           GL+  V  ++ PA+    N+D      +K    I       E  D+VK+  +GRGA+G V
Sbjct: 2   GLNSLVLDLDFPALRKNKNIDNFLNRYEKIVRKIRKLQMKAEDYDVVKV--IGRGAFGEV 59

Query: 88  EKMRHVATGTMMAVK 102
           + +RH ++  + A+K
Sbjct: 60  QLVRHKSSQKVYAMK 74


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase Like 5.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 5 (CDKL5) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. Mutations in the gene encoding CDKL5,
           previously called STK9, are associated with early onset
           epilepsy and severe mental retardation [X-linked
           infantile spasm syndrome (ISSX) or West syndrome]. In
           addition, CDKL5 mutations also sometimes cause a
           phenotype similar to Rett syndrome (RTT), a progressive
           neurodevelopmental disorder. These pathogenic mutations
           are located in the N-terminal portion of the protein
           within the kinase domain.
          Length = 287

 Score = 30.0 bits (67), Expect = 0.16
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +G GAYG+V K RH  T  ++A+K+
Sbjct: 9   VGEGAYGVVLKCRHKETKEIVAIKK 33


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 1.  Protein kinases (PKs),
           MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK1 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients. MEK1 also plays a role in cell
           cycle control.
          Length = 333

 Score = 30.0 bits (67), Expect = 0.16
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DD  KI +LG G  G+V K+ H  +G +MA K
Sbjct: 5   DDFEKISELGAGNGGVVFKVSHKPSGLIMARK 36


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Traf2- and Nck-interacting
           kinase.  Serine/threonine kinases (STKs), Traf2- and
           Nck-interacting kinase (TNIK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The TNIK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to mitogen-activated protein kinase (MAPK),
           kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
           participate in some MAPK signaling pathways by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). TNIK is an effector of Rap2, a small GTP-binding
           protein from the Ras family. TNIK specifically activates
           the c-Jun N-terminal kinase (JNK) pathway and plays a
           role in regulating the actin cytoskeleton.
          Length = 272

 Score = 30.1 bits (67), Expect = 0.17
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G G YG V K RHV TG + A+K
Sbjct: 14  VGNGTYGQVYKGRHVKTGQLAAIK 37


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 29.5 bits (67), Expect = 0.22
 Identities = 9/25 (36%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +G+G++G V K+R  + G ++  KE
Sbjct: 8   IGKGSFGTVRKVRRKSDGKILVWKE 32


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK2/3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK2 is regulated by cyclin E or cyclin A.
           Upon activation by cyclin E, it phosphorylates the
           retinoblastoma (pRb) protein which activates E2F
           mediated transcription and allows cells to move into S
           phase. The CDK2/cyclin A complex plays a role in
           regulating DNA replication. CDK2, together with CDK4,
           also regulates embryonic cell proliferation. Despite
           these important roles, mice deleted for the cdk2 gene
           are viable and normal except for being sterile. This may
           be due to compensation provided by CDK1 (also called
           Cdc2), which can also bind cyclin E and drive the G1 to
           S phase transition. CDK3 is regulated by cyclin C and it
           phosphorylates pRB specifically during the G0/G1
           transition. This phosphorylation is required for cells
           to exit G0 efficiently and enter the G1 phase.
          Length = 284

 Score = 29.8 bits (67), Expect = 0.23
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           K+  +G G YG+V K R+  TG ++A+K+
Sbjct: 4   KVEKIGEGTYGVVYKARNKLTGEVVALKK 32


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine
           Kinase, Plant B-type Cyclin-Dependent protein Kinase.
           Serine/Threonine Kinases (STKs), Plant B-type
           Cyclin-Dependent protein Kinase (CdkB) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CdkB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. The plant-specific B-type CDKs are expressed
           from the late S to the M phase of the cell cycle. They
           are characterized by the cyclin binding motif
           PPT[A/T]LRE. They play a role in controlling mitosis and
           integrating developmental pathways, such as stomata and
           leaf development. CdkB has been shown to associate with
           both cyclin B, which controls G2/M transition, and
           cyclin D, which acts as a mediator in linking
           extracellular signals to the cell cycle.
          Length = 295

 Score = 29.4 bits (66), Expect = 0.25
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           D   K+  +G G YG V K R   TG ++A+K+
Sbjct: 1   DAYEKLEKIGEGTYGKVYKARDKNTGKLVALKK 33


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 2 (CDKL2) and CDKL3 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL2 and CDKL3
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL2, also called
           p56 KKIAMRE, is expressed in testis, kidney, lung, and
           brain. It functions mainly in mature neurons and plays
           an important role in learning and memory. Inactivation
           of CDKL3, also called NKIAMRE (NKIATRE in rat), by
           translocation is associated with mild mental
           retardation. It has been reported that CDKL3 is lost in
           leukemic cells having a chromosome arm 5q deletion, and
           may contribute to the transformed phenotype.
          Length = 286

 Score = 29.7 bits (67), Expect = 0.25
 Identities = 11/24 (45%), Positives = 18/24 (75%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G G+YG+V K +H  TG ++A+K
Sbjct: 9   VGEGSYGMVMKCKHKETGQIVAIK 32


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 3.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. MAP4K3 is required in the
           activation of S6 kinase by amino acids and for the
           phosphorylation of the mTOR-regulated inhibitor of
           eukaryotic initiation factor 4E. mTOR regulates ribosome
           biogenesis and protein translation, and is frequently
           deregulated in cancer.
          Length = 267

 Score = 29.6 bits (66), Expect = 0.26
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +D   I  +G G YG V K R+V TG + A+K
Sbjct: 9   EDFELIQRIGSGTYGDVYKARNVNTGELAAIK 40


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinases, Janus kinases.  Protein Tyrosine
           Kinase (PTK) family; Janus kinase (Jak) subfamily;
           catalytic (c) domain (repeat 2). The Jak subfamily is
           composed of Jak1, Jak2, Jak3, TYK2, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Jak subfamily proteins are cytoplasmic (or nonreceptor)
           tyr kinases containing an N-terminal FERM domain,
           followed by a Src homology 2 (SH2) domain, a
           pseudokinase domain, and a C-terminal tyr kinase
           catalytic domain. Most Jaks are expressed in a wide
           variety of tissues, except for Jak3, which is expressed
           only in hematopoietic cells. Jaks are crucial for
           cytokine receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Jaks are also involved in regulating the surface
           expression of some cytokine receptors. The Jak-STAT
           pathway is involved in many biological processes
           including hematopoiesis, immunoregulation, host defense,
           fertility, lactation, growth, and embryogenesis.
          Length = 284

 Score = 29.3 bits (66), Expect = 0.27
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 4/39 (10%)

Query: 68  VEADDLVKICDLGRGAYGIVEKMRHV----ATGTMMAVK 102
            E   L  I  LG G +G VE  R+      TG  +AVK
Sbjct: 1   FEKRHLKFIKQLGEGHFGKVELCRYDPLGDNTGEQVAVK 39


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 29.1 bits (66), Expect = 0.35
 Identities = 10/25 (40%), Positives = 13/25 (52%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG G +G V   R   TG  +A+K 
Sbjct: 1   LGEGGFGTVYLARDKKTGKKVAIKI 25


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of the subfamily include SLK, STK10
           (also called LOK for lymphocyte-oriented kinase), SmSLK
           (Schistosoma mansoni SLK), and related proteins. SLK
           promotes apoptosis through apoptosis signal-regulating
           kinase 1 (ASK1) and the mitogen-activated protein kinase
           (MAPK) p38. It also plays a role in mediating actin
           reorganization. STK10 is responsible in regulating the
           CD28 responsive element in T cells, as well as leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. SmSLK is capable of activating the MAPK Jun
           N-terminal kinase (JNK) pathway in human embryonic
           kidney (HEK) cells as well as in Xenopus oocytes. It may
           participate in regulating MAPK cascades during
           host-parasite interactions.
          Length = 280

 Score = 28.9 bits (65), Expect = 0.36
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVK 102
           I +LG GA+G V K +H  TG   A K
Sbjct: 10  IGELGDGAFGKVYKAQHKETGLFAAAK 36


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
           UAS Requirement 1 and similar proteins.
           Serine/Threonine Kinases (STKs), Bypass UAS Requirement
           1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           BUR1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. BUR1, also called
           SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK)
           that is functionally equivalent to mammalian CDK9. It
           associates with the cyclin BUR2. BUR genes were
           orginally identified in a genetic screen as factors
           involved in general transcription. The BUR1/BUR2 complex
           phosphorylates the C-terminal domain of RNA polymerase
           II. In addition, this complex regulates histone
           modification by phosporylating Rad6 and mediating the
           association of the Paf1 complex with chromatin.
          Length = 311

 Score = 28.8 bits (65), Expect = 0.40
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           LG G +G V K R + TG ++A+K
Sbjct: 16  LGEGTFGEVYKARQIKTGRVVALK 39


>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional.
          Length = 335

 Score = 29.0 bits (65), Expect = 0.41
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           LG G YG VEK     TG ++A+K
Sbjct: 17  LGEGTYGKVEKAYDTLTGKIVAIK 40


>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), cAMP-dependent protein kinase (PKA) subfamily,
           PRKX-like kinases, catalytic (c) subunit. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include human PRKX (X
           chromosome-encoded protein kinase), Drosophila DC2, and
           similar proteins. PRKX is present in many tissues
           including fetal and adult brain, kidney, and lung. The
           PRKX gene is located in the Xp22.3 subregion and has a
           homolog called PRKY on the Y chromosome. An abnormal
           interchange between PRKX aand PRKY leads to the sex
           reversal disorder of XX males and XY females. PRKX is
           implicated in granulocyte/macrophage lineage
           differentiation, renal cell epithelial migration, and
           tubular morphogenesis in the developing kidney.
          Length = 291

 Score = 28.6 bits (64), Expect = 0.49
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DDL +I  +G G +G V  +R   +    A+K
Sbjct: 1   DDLERIKTVGTGTFGRVHLVRDRISEHYYALK 32


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
           Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Bck1-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
           pombe Mkh1, and related proteins. MAPKKKs phosphorylate
           and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
           which in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Budding
           yeast Bck1 is part of the cell integrity MAPK pathway,
           which is activated by stresses and aggressions to the
           cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
           the MAPK Slt2 make up the cascade that is important in
           the maintenance of cell wall homeostasis. Fission yeast
           Mkh1 is involved in MAPK cascades regulating cell
           morphology, cell wall integrity, salt resistance, and
           filamentous growth in response to stress.
          Length = 272

 Score = 28.6 bits (64), Expect = 0.50
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           +G+G YG V    +V TG MMAVK+
Sbjct: 9   IGKGTYGRVYLALNVTTGEMMAVKQ 33


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 5.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K5, also called germinal
           center kinase-related enzyme (GCKR), has been shown to
           activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
           also facilitates Wnt signaling in B cells, and may
           therefore be implicated in the control of cell fate,
           proliferation, and polarity.
          Length = 267

 Score = 28.5 bits (63), Expect = 0.57
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G G YG V K R++ TG + AVK
Sbjct: 17  VGSGTYGDVYKARNLHTGELAAVK 40


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase (MAPK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The MAPK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAPKs serve as important
           mediators of cellular responses to extracellular
           signals. They control critical cellular functions
           including differentiation, proliferation, migration, and
           apoptosis. They are also implicated in the pathogenesis
           of many diseases including multiple types of cancer,
           stroke, diabetes, and chronic inflammation. Typical MAPK
           pathways involve a triple kinase core cascade comprising
           of the MAPK, which is phosphorylated and activated by a
           MAPK kinase (MAP2K or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAP3K or MKKK). Each cascade is activated either by a
           small GTP-binding protein or by an adaptor protein,
           which transmits the signal either directly to a MAP3K to
           start the triple kinase core cascade or indirectly
           through a mediator kinase, a MAP4K. There are three main
           typical MAPK subfamilies: Extracellular signal-Regulated
           Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
           Some MAPKs are atypical in that they are not regulated
           by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 28.3 bits (64), Expect = 0.62
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G GAYG+V       TG  +A+K
Sbjct: 8   IGSGAYGVVCSAVDKRTGRKVAIK 31


>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), PCTAIRE-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The PCTAIRE-like subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily share sequence similarity with
           Cyclin-Dependent Kinases (CDKs), which belong to a large
           family of STKs that are regulated by their cognate
           cyclins. Together, CDKs and cyclins are involved in the
           control of cell-cycle progression, transcription, and
           neuronal function. The association of PCTAIRE-like
           proteins with cyclins has not been widely studied,
           although PFTAIRE-1 has been shown to function as a CDK
           which is regulated by cyclin D3 as well as the
           membrane-associated cyclin Y. PCTAIRE-like proteins show
           unusual expression patterns with high levels in
           post-mitotic tissues, suggesting that they may be
           involved in regulating post-mitotic cellular events.
          Length = 291

 Score = 28.1 bits (63), Expect = 0.66
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 70  ADDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            +   K+  LG G+Y  V K R   TG ++A+KE
Sbjct: 4   LETYKKLDKLGEGSYATVYKGRSKLTGQLVALKE 37


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 28.3 bits (63), Expect = 0.69
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 31  RRPGLSLQVS------AVESP--AVSIPSNLDKKTTITIGDKTFVVEADDLVKICDLGRG 82
           RRP L+L +       AV  P    S  S+    ++ +    +      +L ++  +G G
Sbjct: 26  RRPDLTLPLPQRDPSLAVPLPLPPPSSSSSSSSSSSASGSAPSAAKSLSELERVNRIGSG 85

Query: 83  AYGIVEKMRHVATGTMMAVK 102
           A G V K+ H  TG + A+K
Sbjct: 86  AGGTVYKVIHRPTGRLYALK 105


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
           signal-Regulated Kinase 1 and 2-like Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), Extracellular
           signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. This
           ERK1/2-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           the mitogen-activated protein kinases (MAPKs) ERK1,
           ERK2, baker's yeast Fus3, and similar proteins. MAPK
           pathways are important mediators of cellular responses
           to extracellular signals. ERK1/2 activation is
           preferentially by mitogenic factors, differentiation
           stimuli, and cytokines, through a kinase cascade
           involving the MAPK kinases MEK1/2 and a MAPK kinase
           kinase from the Raf family. ERK1/2 have numerous
           substrates, many of which are nuclear and participate in
           transcriptional regulation of many cellular processes.
           They regulate cell growth, cell proliferation, and cell
           cycle progression from G1 to S phase. Although the
           distinct roles of ERK1 and ERK2 have not been fully
           determined, it is known that ERK2 can maintain most
           functions in the absence of ERK1, and that the deletion
           of ERK2 is embryonically lethal. The MAPK, Fus3,
           regulates yeast mating processes including
           mating-specific gene expression, G1 arrest, mating
           projection, and cell fusion.
          Length = 336

 Score = 28.4 bits (64), Expect = 0.70
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G GAYG+V    H  TG  +A+K
Sbjct: 13  IGEGAYGMVCSATHKPTGVKVAIK 36


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 27.9 bits (62), Expect = 0.80
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG+G YGIV   R ++T   +A+KE
Sbjct: 16  LGKGTYGIVYAARDLSTQVRIAIKE 40


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TEY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TEY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TEY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. There are two subtypes
           of plant MAPKs based on the conserved phosphorylation
           motif present in the activation loop, TEY and TDY. This
           subfamily represents the TEY subtype and is further
           subdivided into three groups (A, B, and C). Group A is
           represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
           (NtNTF4), among others. They are mostly involved in
           environmental and hormonal responses. AtMPK3 and  AtMPK6
           are also key regulators for stomatal development and
           patterning. Group B is represented by AtMPK4, AtMPK13,
           and NtNTF6, among others. They may be involved in both
           cell division and environmental stress response. AtMPK4
           also participates in regulating innate immunity. Group C
           is represented by AtMPK1, AtMPK2, NtNTF3, Oryza sativa
           MAPK4 (OsMAPK4), among others. They may also be involved
           in stress responses. AtMPK1 and AtMPK2 are activated
           following mechanical injury and in the presence of
           stress chemicals such as jasmonic acid, hydrogen
           peroxide and abscisic acid. OsMAPK4 is also called
           OsMSRMK3 for Multiple Stress-Responsive MAPK3.
          Length = 337

 Score = 27.7 bits (62), Expect = 1.1
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +GRGAYGIV   ++  T   +A+K
Sbjct: 13  IGRGAYGIVCSAKNSETNEKVAIK 36


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 27.3 bits (61), Expect = 1.7
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 80  GRGAYGIVEKMRHVATGTMMAVKEKN 105
           G+GA+G V  ++   T  M A+K  N
Sbjct: 9   GKGAFGKVCIVQKRDTKKMFAMKYMN 34


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 27.2 bits (61), Expect = 1.7
 Identities = 8/25 (32%), Positives = 13/25 (52%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKE 103
           LG G +G VE ++  +     A+K 
Sbjct: 1   LGVGGFGRVELVKVKSKNRTFALKC 25


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 27.2 bits (61), Expect = 1.8
 Identities = 6/24 (25%), Positives = 11/24 (45%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +G G++  V   +   T    A+K
Sbjct: 9   IGEGSFSTVVLAKEKETNKEYAIK 32


>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-3 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-3 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-3 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-3 shows a
           restricted pattern of expression and is present in
           brain, kidney, and intestine. It is elevated in
           Alzheimer's disease (AD) and has been shown to associate
           with paired helical filaments (PHFs) and stimulate Tau
           phosphorylation. As AD progresses, phosphorylated Tau
           aggregates and forms PHFs, which leads to the formation
           of neurofibrillary tangles (NFTs). In human glioma
           cells, PCTAIRE-3 induces cell cycle arrest and cell
           death.
          Length = 288

 Score = 26.9 bits (59), Expect = 1.9
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 74  VKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           VK+  LG G Y  V K R   T  ++A+KE
Sbjct: 8   VKLDKLGEGTYATVFKGRSKLTENLVALKE 37


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
           Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MPK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of the MAPKs MPK1 from Saccharomyces
           cerevisiae, Pmk1 from Schizosaccharomyces pombe, and
           similar proteins. MAPKs are important mediators of
           cellular responses to extracellular signals. MPK1 (also
           called Slt2) and Pmk1 (also called Spm1) are
           stress-activated MAPKs that regulate the cell wall
           integrity (CWI) pathway, and are therefore important in
           the maintainance of cell shape, cell wall construction,
           morphogenesis, and ion homeostasis. MPK1 is activated in
           response to cell wall stress including heat stimulation,
           osmotic shock, UV irradiation, and any agents that
           interfere with cell wall biogenesis such as chitin
           antagonists, caffeine, or zymolase. MPK1 is regulated by
           the MAP2Ks Mkk1/2, which are regulated by the MAP3K
           Bck1. Pmk1 is also activated by multiple stresses
           including elevated temperatures, hyper- or hypotonic
           stress, glucose deprivation, exposure to cell-wall
           damaging compounds, and oxidative stress. It is
           regulated by the MAP2K Pek1, which is regulated by the
           MAP3K Mkh1.
          Length = 332

 Score = 27.0 bits (60), Expect = 2.0
 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 79  LGRGAYGIVEKMRHVAT--GTMMAVK 102
           LG+GAYGIV   R+  T     +A+K
Sbjct: 8   LGQGAYGIVCSARNAETSEEETVAIK 33


>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 10.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein Kinase 10 (CDK10) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK10 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK10, also called PISSLRE, is essential for
           cell growth and proliferation, and acts through the G2/M
           phase of the cell cycle. CDK10 has also been identified
           as an important factor in endocrine therapy resistance
           in breast cancer. CDK10 silencing increases the
           transcription of c-RAF and the activation of the p42/p44
           MAPK pathway, which leads to antiestrogen resistance.
           Patients who express low levels of CDK10 relapse early
           on tamoxifen.
          Length = 309

 Score = 26.9 bits (60), Expect = 2.0
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           K+  +G G YGIV + R   +G ++A+K
Sbjct: 11  KLNRIGEGTYGIVYRARDTTSGEIVALK 38


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 5.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK5 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK5
           is unusual in that it is regulated by non-cyclin
           proteins, p35 and p39. It is highly expressed in the
           nervous system and is critical in normal neural
           development and function. It plays a role in neuronal
           migration and differentiation, and is also important in
           synaptic plasticity and learning. CDK5 also participates
           in protecting against cell death and promoting
           angiogenesis. Impaired CDK5 activity is implicated in
           Alzheimer's disease, amyotrophic lateral sclerosis,
           Parkinson's disease, Huntington's disease and acute
           neuronal injury.
          Length = 284

 Score = 26.6 bits (59), Expect = 2.6
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVK 102
           K+  +G G YG V K ++  T  ++A+K
Sbjct: 4   KLEKIGEGTYGTVFKAKNRETHEIVALK 31


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 26.4 bits (59), Expect = 3.0
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            +L KI   G GA G V K    ATG  +A+K+
Sbjct: 22  KNLEKI---GEGASGEVYKATDRATGKEVAIKK 51


>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3.
          Length = 168

 Score = 26.1 bits (58), Expect = 3.0
 Identities = 8/14 (57%), Positives = 11/14 (78%)

Query: 63 DKTFVVEADDLVKI 76
          DKTF + AD L++I
Sbjct: 12 DKTFTIVADILLRI 25


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 26.3 bits (58), Expect = 3.1
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKEKN 105
           LG+G+YG V K++ ++     A+KE +
Sbjct: 8   LGKGSYGSVYKVKRLSDNQFYALKEVD 34


>gnl|CDD|188523 TIGR04008, WcaF, colanic acid biosynthesis acetyltransferase WcaF. 
           This gene is one of the glycosyl transferases involved
           in the biosynthesis of colanic acid, an
           exopolysaccharide expressed in Enterobacteraceae
           species. This acetyltransferase is believed to catalyze
           the addition of the acetyl group that is attached
           through an O linkage to the first fucosyl residue of the
           colanic acid repetitive unit (E unit).
          Length = 180

 Score = 26.1 bits (57), Expect = 3.2
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 29  LLRRPGLSLQVSAVESPAVSI--PSNLDKKTTITIGDKTFVVEADDLVKICDLGRGAYGI 86
           LLR  G  +  + V  P+V I  P  L      T+GD  +V +   L  + ++  GA+ +
Sbjct: 46  LLRLFGAKIGKNVVIRPSVKITYPWKL------TLGDYAWVGDDAVLYTLGEITIGAHSV 99

Query: 87  VEKMRHVATGT 97
           + +  ++ TG+
Sbjct: 100 ISQKSYLCTGS 110


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
           Phosphotransferases. Tyrosine-specific kinase subfamily.
          Length = 257

 Score = 26.3 bits (59), Expect = 3.4
 Identities = 11/34 (32%), Positives = 14/34 (41%), Gaps = 4/34 (11%)

Query: 73  LVKICDLGRGAYGIVEK----MRHVATGTMMAVK 102
           L     LG GA+G V K     +       +AVK
Sbjct: 1   LTLGKKLGEGAFGEVYKGKLKGKGGKKKVEVAVK 34


>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase.
          Length = 398

 Score = 26.0 bits (57), Expect = 4.5
 Identities = 8/19 (42%), Positives = 16/19 (84%)

Query: 54 DKKTTITIGDKTFVVEADD 72
          +++T++TIGDKT+V+  + 
Sbjct: 26 NRETSVTIGDKTYVIGGNH 44


>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK4 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK4
           partners with all three D-type cyclins (D1, D2, and D3)
           and is also regulated by INK4 inhibitors. It is active
           towards the retinoblastoma (pRb) protein and plays a
           role in regulating the early G1 phase of the cell cycle.
           It is expressed ubiquitously and is localized in the
           nucleus. CDK4 also shows kinase activity towards Smad3,
           a signal transducer of transforming growth factor
           (TGF)-beta signaling which modulates transcription and
           plays a role in cell proliferation and apoptosis. CDK4
           is inhibited by the p21 inhibitor and is specifically
           mutated in human melanoma.
          Length = 288

 Score = 25.7 bits (56), Expect = 4.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVK 102
           + ++G GAYG V K R   +G  +A+K
Sbjct: 5   VAEIGVGAYGTVYKARDPHSGHFVALK 31


>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine
           Kinase, Muscle-specific kinase.  Protein Tyrosine Kinase
           (PTK) family; Muscle-specific kinase (Musk); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Musk is a receptor tyr kinase (RTK) containing an
           extracellular region with four immunoglobulin-like
           domains and a cysteine-rich cluster, a transmembrane
           segment, and an intracellular catalytic domain. Musk is
           expressed and concentrated in the postsynaptic membrane
           in skeletal muscle. It is essential for the
           establishment of the neuromuscular junction (NMJ), a
           peripheral synapse that conveys signals from motor
           neurons to muscle cells. Agrin, a large proteoglycan
           released from motor neurons, stimulates Musk
           autophosphorylation and activation, leading to the
           clustering of acetylcholine receptors (AChRs). To date,
           there is no evidence to suggest that agrin binds
           directly to Musk. Mutations in AChR, Musk and other
           partners are responsible for diseases of the NMJ, such
           as the autoimmune syndrome myasthenia gravis.
          Length = 288

 Score = 25.6 bits (56), Expect = 5.7
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 9/39 (23%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATG-------TMMAVK 102
           +++  + D+G+GA+G V + R  A G       TM+AVK
Sbjct: 5   NNIEYVRDIGQGAFGRVFQAR--APGLLPYEPFTMVAVK 41


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 25.5 bits (56), Expect = 5.7
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKEKN 105
           LG+G +G V   +  ATG M A K+ +
Sbjct: 1   LGKGGFGEVCACQVKATGKMYACKKLD 27


>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 10.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 10 (Nek10)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek10 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. No function has yet been ascribed to Nek10.
           The gene encoding Nek10 is a putative causative gene for
           breast cancer; it is located within a breast cancer
           susceptibility loci on chromosome 3p24.
          Length = 269

 Score = 25.5 bits (56), Expect = 6.2
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 79  LGRGAYGIVEKMRHVATG-TMMAVKEKN 105
           LG GA+G V K+R    G  ++A+KE N
Sbjct: 8   LGSGAFGCVYKVRKKNNGQNLLALKEIN 35


>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 1.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK1
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK1, also called rhodopsin kinase,
           belongs to the visual group of GRKs and is expressed in
           retinal cells. It phosphorylates rhodopsin in rod cells,
           which leads to termination of the phototransduction
           cascade. Mutations in GRK1 are associated to a
           recessively inherited form of stationary nightblindness
           called Oguchi disease.
          Length = 280

 Score = 25.6 bits (56), Expect = 6.6
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVKEKN 105
           LG+G +G V   +  ATG + A K+ N
Sbjct: 1   LGKGGFGEVSACQMRATGKLYACKKLN 27


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 1.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           Inactivation of LATS1 in mice results in the development
           of various tumors, including sarcomas and ovarian
           cancer. Promoter methylation, loss of heterozygosity,
           and missense mutations targeting the LATS1 gene have
           also been found in human sarcomas and ovarian cancers.
           In addition, decreased expression of LATS1 is associated
           with an aggressive phenotype and poor prognosis. LATS1
           induces G2 arrest and promotes cytokinesis. It may be a
           component of the mitotic exit network in higher
           eukaryotes.
          Length = 382

 Score = 25.3 bits (55), Expect = 6.6
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 73  LVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
            VKI  LG GA+G V   R V T  + A+K
Sbjct: 3   FVKIKTLGIGAFGEVCLARKVDTKALYAMK 32


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
           Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
           Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDC2L1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDC2L1, also
           called PITSLRE, exists in different isoforms which are
           named using the alias CDK11(p). The CDC2L1 gene produces
           two protein products, CDK11(p110) and CDK11(p58). CDC2L1
           is also represented by the caspase-processed CDK11(p46).
           CDK11(p110), the major isoform, associates with cyclin L
           and is expressed throughout the cell cycle. It is
           involved in RNA processing and the regulation of
           transcription. CDK11(p58) associates with cyclin D3 and
           is expressed during the G2/M phase of the cell cycle. It
           plays roles in spindle morphogenesis, centrosome
           maturation, sister chromatid cohesion, and the
           completion of mitosis. CDK11(p46) is formed from the
           larger isoforms by caspases during TNFalpha- and
           Fas-induced apoptosis. It functions as a downstream
           effector kinase in apoptotic signaling pathways and
           interacts with eukaryotic initiation factor 3f (eIF3f), 
           p21-activated kinase (PAK1), and Ran-binding protein
           (RanBPM).
          Length = 293

 Score = 25.3 bits (56), Expect = 7.3
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 82  GAYGIVEKMRHVATGTMMAVK 102
           G YG+V + R   TG ++A+K
Sbjct: 16  GTYGVVYRARDKKTGEIVALK 36


>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase,
           MAPK/MAK/MRK Overlapping Kinase.  Serine/Threonine
           Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MOK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MOK, also called Renal tumor antigen 1
           (RAGE-1), is widely expressed and is enriched in testis,
           kidney, lung, and brain. It is expressed in
           approximately 50% of renal cell carcinomas (RCC) and is
           a potential target for immunotherapy. MOK is stabilized
           by its association with the HSP90 molecular chaperone.
           It is induced by the transcription factor Cdx2 and may
           be involved in regulating intestinal epithelial
           development and differentiation.
          Length = 282

 Score = 25.3 bits (56), Expect = 7.3
 Identities = 8/27 (29%), Positives = 13/27 (48%)

Query: 76  ICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +  +G G +  V K +   TG   A+K
Sbjct: 4   LGKIGEGTFSEVLKAQSRKTGKYYAIK 30


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
           Serine/Threonine Kinases (STKs), Pho85 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Pho85 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Pho85 is a
           multifunctional Cyclin-Dependent protein Kinase (CDK) in
           yeast. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. Pho85 is regulated
           by 10 different cyclins (Pcls) and plays a role in G1
           progression, cell polarity, phosphate and glycogen
           metabolism, gene expression, and in signaling changes in
           the environment. It is not essential for yeast viability
           and is the functional homolog of mammalian CDK5, which
           plays a role in central nervous system development.
          Length = 284

 Score = 25.1 bits (55), Expect = 7.7
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 74  VKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
            ++  LG G Y  V K R+  TG ++A+KE
Sbjct: 3   KQLEKLGEGTYATVYKGRNRTTGEIVALKE 32


>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
           Serine/Threonine Kinase, beta-adrenergic receptor
           kinase.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily,
           beta-adrenergic receptor kinase (beta-ARK) group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. The beta-ARK
           group is composed of GRK2, GRK3, and similar proteins.
           GRK2 and GRK3 are both widely expressed in many tissues,
           although GRK2 is present at higher levels. They contain
           an N-terminal RGS homology (RH) domain, a central
           catalytic domain, and C-terminal pleckstrin homology
           (PH) domain that mediates PIP2 and G protein
           betagamma-subunit translocation to the membrane. GRK2
           (also called beta-ARK or beta-ARK1) is important in
           regulating several cardiac receptor responses. It plays
           a role in cardiac development and in hypertension.
           Deletion of GRK2 in mice results in embryonic lethality,
           caused by hypoplasia of the ventricular myocardium. GRK2
           also plays important roles in the liver (as a regulator
           of portal blood pressure), in immune cells, and in the
           nervous system. Altered GRK2 expression has been
           reported in several disorders including major
           depression, schizophrenia, bipolar disorder, and
           Parkinsonism.
          Length = 278

 Score = 25.3 bits (55), Expect = 8.1
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 79  LGRGAYGIVEKMRHVATGTMMAVK 102
           +GRG +G V   R   TG M A+K
Sbjct: 2   IGRGGFGEVYGCRKADTGKMYAMK 25


>gnl|CDD|225248 COG2373, COG2373, Large extracellular alpha-helical protein [General
            function prediction only].
          Length = 1621

 Score = 25.5 bits (56), Expect = 8.5
 Identities = 11/44 (25%), Positives = 17/44 (38%)

Query: 11   SEHESLKPADIIPSDNTVLLRRPGLSLQVSAVESPAVSIPSNLD 54
             +   L P   I  D    L    ++ Q+    +PA  I + LD
Sbjct: 1117 VKTVVLAPGFTISGDLLAGLSPQAVNAQLQLSGTPAADIAALLD 1160


>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional.
          Length = 294

 Score = 25.2 bits (55), Expect = 8.5
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 75  KICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           K+  +G G YG+V K R   T   +A+K+
Sbjct: 6   KVEKIGEGTYGVVYKARDRVTNETIALKK 34


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 25.2 bits (56), Expect = 8.5
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 4/34 (11%)

Query: 73  LVKICDLGRGAYGIVEK----MRHVATGTMMAVK 102
           L     LG GA+G V K         T T +AVK
Sbjct: 1   LELGKKLGEGAFGEVYKGTLKGDGEGTETKVAVK 34


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-1 is
           expressed ubiquitously and is localized in the
           cytoplasm. Its kinase activity is cell cycle dependent
           and peaks at the S and G2 phases. PCTAIRE-1 is highly
           expressed in the brain and may play a role in regulating
           neurite outgrowth. It can also associate with Trap
           (Tudor repeat associator with PCTAIRE-2), a
           physiological partner of PCTAIRE-2; with p11, a small
           dimeric protein with similarity to S100; and with 14-3-3
           proteins, mediators of phosphorylation-dependent
           interactions in many different proteins.
          Length = 301

 Score = 25.0 bits (54), Expect = 8.6
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 74  VKICDLGRGAYGIVEKMRHVATGTMMAVKE 103
           +K+  LG G Y  V K R   T  ++A+KE
Sbjct: 9   IKLDKLGEGTYATVYKGRSKLTDNLVALKE 38


>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 2.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           LATS2 is an essential mitotic regulator responsible for
           coordinating accurate cytokinesis completion and
           governing the stabilization of other mitotic regulators.
           It is also critical in the maintenance of proper
           chromosome number, genomic stability, mitotic fidelity,
           and the integrity of centrosome duplication.
           Downregulation of LATS2 is associated with poor
           prognosis in acute lymphoblastic leukemia and breast
           cancer.
          Length = 381

 Score = 25.0 bits (54), Expect = 9.0
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 73  LVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
            VKI  LG GA+G V     V T  + A+K
Sbjct: 3   FVKIKTLGIGAFGEVCLACKVDTHALYAMK 32


>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
           Protein Tyrosine Kinases, Janus kinases 2 and 3.
           Protein Tyrosine Kinase (PTK) family; Janus kinase 2
           (Jak2) and Jak3; catalytic (c) domain (repeat 2). The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Jak2 and
           Jak3 are members of the Janus kinase (Jak) subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal FERM domain, followed
           by a Src homology 2 (SH2) domain, a pseudokinase domain,
           and a C-terminal catalytic tyr kinase domain. Jaks are
           crucial for cytokine receptor signaling. They are
           activated by autophosphorylation upon cytokine-induced
           receptor aggregation, and subsequently trigger
           downstream signaling events such as the phosphorylation
           of signal transducers and activators of transcription
           (STATs). Jak2 is widely expressed in many tissues while
           Jak3 is expressed only in hematopoietic cells. Jak2 is
           essential for the signaling of hormone-like cytokines
           such as growth hormone, erythropoietin, thrombopoietin,
           and prolactin, as well as some IFNs and cytokines that
           signal through the IL-3 and gp130 receptors. Jak3 binds
           the shared receptor subunit common gamma chain and thus,
           is essential in the signaling of cytokines that use it
           such as IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21.
           Disruption of Jak2 in mice results in an embryonic
           lethal phenotype with multiple defects including
           erythropoietic and cardiac abnormalities. It is the only
           Jak gene that results in a lethal phenotype when
           disrupted in mice. A mutation in the pseudokinase domain
           of Jak2, V617F, is present in many myeloproliferative
           diseases, including almost all patients with
           polycythemia vera, and 50% of patients with essential
           thrombocytosis and myelofibrosis. Jak3 is important in
           lymphoid development and myeloid cell differentiation.
           Inactivating mutations in Jak3 have been reported in
           humans with severe combined immunodeficiency (SCID).
          Length = 284

 Score = 25.1 bits (55), Expect = 9.2
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 4/39 (10%)

Query: 69  EADDLVKICDLGRGAYGIVEKMRH----VATGTMMAVKE 103
           E   L  I  LG+G +G VE  R+      TG ++AVK+
Sbjct: 2   EERHLKFIQQLGKGNFGSVELCRYDPLQDNTGEVVAVKK 40


>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PFTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PFTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PFTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PFTAIRE-1 is
           widely expressed except in the spleen and thymus. It is
           highly expressed in the brain, heart, pancreas, testis,
           and ovary, and is localized in the cytoplasm. It is
           regulated by cyclin D3 and is inhibited by the p21 cell
           cycle inhibitor. It has also been shown to interact with
           the membrane-associated cyclin Y, which recruits the
           protein to the plasma membrane.
          Length = 303

 Score = 25.0 bits (54), Expect = 9.3
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 69  EADDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           +AD   K+  LG G+Y  V K +    G ++A+K
Sbjct: 3   KADSYEKLEKLGEGSYATVYKGKSKVNGKLVALK 36


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
           (NDR) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The NDR subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. NDR kinases
           regulate mitosis, cell growth, embryonic development,
           and neurological processes. They are also required for
           proper centrosome duplication. Higher eukaryotes contain
           two NDR isoforms, NDR1 and NDR2. This subfamily also
           contains fungal NDR-like kinases.
          Length = 364

 Score = 25.0 bits (55), Expect = 9.7
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 71  DDLVKICDLGRGAYGIVEKMRHVATGTMMAVK 102
           DD   I  +GRGA+G V  ++   TG + A+K
Sbjct: 1   DDFESIKVIGRGAFGEVRLVQKKDTGHIYAMK 32


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.314    0.131    0.354 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,154,348
Number of extensions: 425584
Number of successful extensions: 448
Number of sequences better than 10.0: 1
Number of HSP's gapped: 448
Number of HSP's successfully gapped: 116
Length of query: 106
Length of database: 10,937,602
Length adjustment: 71
Effective length of query: 35
Effective length of database: 7,788,468
Effective search space: 272596380
Effective search space used: 272596380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (24.0 bits)