BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13301
         (194 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2WYH|A Chain A, Structure Of The Streptococcus Pyogenes Family Gh38 Alpha-
           Mannosidase
 pdb|2WYH|B Chain B, Structure Of The Streptococcus Pyogenes Family Gh38 Alpha-
           Mannosidase
 pdb|2WYI|A Chain A, Structure Of The Streptococcus Pyogenes Family Gh38 Alpha-
           Mannosidase Complexed With Swainsonine
 pdb|2WYI|B Chain B, Structure Of The Streptococcus Pyogenes Family Gh38 Alpha-
           Mannosidase Complexed With Swainsonine
          Length = 923

 Score = 28.1 bits (61), Expect = 3.5,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 128 FDTHVQQEHNLANYMFFLMHLINKPDTEFTGQETYVWNMYQQRCW 172
           F TH++ +H+LA+ +F  +   N PD  F    +   N   Q C+
Sbjct: 702 FPTHLKTDHHLADSIFETVKRPNHPDATFWKNPS---NPQHQECF 743


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.145    0.474 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,234,188
Number of Sequences: 62578
Number of extensions: 191004
Number of successful extensions: 459
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 458
Number of HSP's gapped (non-prelim): 1
length of query: 194
length of database: 14,973,337
effective HSP length: 94
effective length of query: 100
effective length of database: 9,091,005
effective search space: 909100500
effective search space used: 909100500
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)