Query         psy13302
Match_columns 88
No_of_seqs    100 out of 196
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:00:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13302.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13302hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3533|consensus              100.0 3.3E-31 7.2E-36  230.3   2.2   84    1-84   2583-2666(2706)
  2 KOG2243|consensus               99.8 4.9E-21 1.1E-25  167.9   4.0   84    1-84   4936-5019(5019)
  3 cd00350 rubredoxin_like Rubred  62.8     2.3 4.9E-05   22.5  -0.1   15    3-17     18-32  (33)
  4 PF00653 BIR:  Inhibitor of Apo  57.7     2.8 6.1E-05   25.2  -0.4   26    3-28     37-62  (70)
  5 KOG1101|consensus               56.8     7.8 0.00017   27.3   1.7   26    3-28     52-77  (147)
  6 PF00253 Ribosomal_S14:  Riboso  54.5     5.9 0.00013   23.3   0.7   19    1-19     15-33  (55)
  7 cd00729 rubredoxin_SM Rubredox  54.2     4.2   9E-05   21.8  -0.0   15    3-17     19-33  (34)
  8 smart00265 BH4 BH4 Bcl-2 homol  48.6      16 0.00034   19.1   1.7   18   53-70      9-26  (27)
  9 COG1773 Rubredoxin [Energy pro  46.2     8.3 0.00018   23.3   0.4   16    4-19     38-53  (55)
 10 smart00238 BIR Baculoviral inh  44.9      15 0.00033   21.6   1.5   26    3-28     37-62  (71)
 11 PF10764 Gin:  Inhibitor of sig  44.4      12 0.00026   21.5   0.9   11    4-14      1-11  (46)
 12 cd00730 rubredoxin Rubredoxin;  43.6     7.1 0.00015   22.8  -0.2   14    4-17     36-49  (50)
 13 PRK08061 rpsN 30S ribosomal pr  43.1      15 0.00032   22.5   1.2   19    1-19     20-38  (61)
 14 PF03904 DUF334:  Domain of unk  42.9      15 0.00032   28.0   1.4   19   25-43    190-208 (230)
 15 PF09963 DUF2197:  Uncharacteri  41.4      13 0.00029   22.5   0.8   10    1-10      1-10  (56)
 16 PRK05766 rps14P 30S ribosomal   40.7      14 0.00031   21.8   0.8   18    2-19     14-31  (52)
 17 cd00022 BIR Baculoviral inhibi  39.5      22 0.00047   20.8   1.5   26    3-28     35-60  (69)
 18 PF02180 BH4:  Bcl-2 homology r  37.9      25 0.00053   18.4   1.4   18   53-70      9-26  (27)
 19 PF13894 zf-C2H2_4:  C2H2-type   34.1      11 0.00023   17.0  -0.4   11   20-30     14-24  (24)
 20 PRK06911 rpsN 30S ribosomal pr  33.9      18 0.00039   23.9   0.6   19    1-19     59-77  (100)
 21 PRK13619 psbV cytochrome c-550  33.4      15 0.00032   26.6   0.1   38   45-82    102-139 (160)
 22 KOG4477|consensus               32.3      20 0.00042   27.1   0.6   17    3-19     39-55  (228)
 23 PF14392 zf-CCHC_4:  Zinc knuck  32.1      16 0.00034   20.8   0.1   10    1-10     30-39  (49)
 24 PF01702 TGT:  Queuine tRNA-rib  31.9     8.7 0.00019   28.1  -1.3   54    4-59    178-235 (238)
 25 PF00098 zf-CCHC:  Zinc knuckle  28.9      15 0.00031   17.1  -0.4    7    4-10      2-8   (18)
 26 COG1644 RPB10 DNA-directed RNA  28.0      25 0.00054   21.9   0.5   15   47-61     34-48  (63)
 27 KOG3497|consensus               27.5      27 0.00059   21.8   0.6    8    3-10      5-12  (69)
 28 PF03802 CitX:  Apo-citrate lya  27.3      21 0.00045   25.5   0.0   11    3-13    133-143 (170)
 29 PF09706 Cas_CXXC_CXXC:  CRISPR  26.1      25 0.00054   21.6   0.2    9    2-10      5-13  (69)
 30 TIGR03124 ctirate_citX holo-AC  26.1      28  0.0006   24.9   0.5   11    3-13    131-141 (165)
 31 PF10664 NdhM:  Cyanobacterial   26.0      47   0.001   22.6   1.5   26   51-76     73-98  (108)
 32 CHL00074 rps14 ribosomal prote  25.7      28 0.00061   23.0   0.4   19    1-19     59-77  (100)
 33 TIGR00009 L28 ribosomal protei  25.6      36 0.00078   20.1   0.9   11    1-11      1-11  (56)
 34 PRK08881 rpsN 30S ribosomal pr  25.0      26 0.00056   23.1   0.2   19    1-19     60-78  (101)
 35 PLN00032 DNA-directed RNA poly  24.7      27  0.0006   22.1   0.2    8    3-10      5-12  (71)
 36 TIGR03523 GldN gliding motilit  24.7      24 0.00052   27.5  -0.1   10   26-35    269-278 (278)
 37 PRK04016 DNA-directed RNA poly  24.4      28 0.00061   21.5   0.2    9    3-11      5-13  (62)
 38 PRK01392 citX 2'-(5''-triphosp  23.3      32  0.0007   24.9   0.4   12    3-14    140-151 (180)
 39 PRK01008 queuine tRNA-ribosylt  22.8      41 0.00088   27.1   0.9   41    4-44    320-365 (372)
 40 COG0199 RpsN Ribosomal protein  22.4      39 0.00084   20.7   0.6   16    2-17     21-36  (61)
 41 PF01194 RNA_pol_N:  RNA polyme  22.1      25 0.00053   21.6  -0.4    6    4-9       6-11  (60)
 42 PF06084 Cytomega_TRL10:  Cytom  21.3      27 0.00058   24.6  -0.3   19   35-54     74-92  (150)
 43 smart00547 ZnF_RBZ Zinc finger  20.2      39 0.00084   16.3   0.2    9    3-11     17-25  (26)

No 1  
>KOG3533|consensus
Probab=99.96  E-value=3.3e-31  Score=230.29  Aligned_cols=84  Identities=36%  Similarity=0.708  Sum_probs=80.2

Q ss_pred             CCceeeeeCCCccccccCCCChHHHhhhhccchhHHHHHHHhccCCCCCCChhhHHHHHHHhcCCCCeeecchhhhhhch
Q psy13302          1 MESNCFICGIGKDYFDKVPHGFDTHVQQEHNLANYMFFLMHLINKPDTEFTGQETYVWNMYQQRCWDFFPVGDCFRKQYE   80 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~~~F~~Hi~~eHn~WnYl~fi~yL~~K~~~e~tg~E~yV~~~i~~~d~swfP~~~~~~l~~~   80 (88)
                      +|++|||||++|+.||++...|++||+.|||||||+|||+.++-|++|||||+||||.+++++++++|||..||+||+..
T Consensus      2583 LKttCFICgLeR~kFDNktVsFEeHik~EHNmWhYLyfIVlvkvKd~Te~TGPESYVaqmvk~~nLdWFPRmrAmSLvs~ 2662 (2706)
T KOG3533|consen 2583 LKTTCFICGLERSKFDNKTVTFEEHIKTEHNMWHYLYFIVLVKVKDETEFTGPESYVAQMVKDRNLDWFPRMRAMSLVSS 2662 (2706)
T ss_pred             HhcceeEeecchhhccCceeeHHHhhhhhhhhHHhhheeEEEEecCCccccChHHHHHHHHHhcccchhhhhHhhhhhcc
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             hhhc
Q psy13302         81 EDLG   84 (88)
Q Consensus        81 ~~~~   84 (88)
                      +.-+
T Consensus      2663 e~dg 2666 (2706)
T KOG3533|consen 2663 ELDG 2666 (2706)
T ss_pred             cccc
Confidence            6443


No 2  
>KOG2243|consensus
Probab=99.82  E-value=4.9e-21  Score=167.85  Aligned_cols=84  Identities=77%  Similarity=1.528  Sum_probs=81.8

Q ss_pred             CCceeeeeCCCccccccCCCChHHHhhhhccchhHHHHHHHhccCCCCCCChhhHHHHHHHhcCCCCeeecchhhhhhch
Q psy13302          1 MESNCFICGIGKDYFDKVPHGFDTHVQQEHNLANYMFFLMHLINKPDTEFTGQETYVWNMYQQRCWDFFPVGDCFRKQYE   80 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~~~F~~Hi~~eHn~WnYl~fi~yL~~K~~~e~tg~E~yV~~~i~~~d~swfP~~~~~~l~~~   80 (88)
                      |+.+||||||..+.||..+.||+.|..+|||+-||+||++||-.|++||.||.|+||+++.+++-++|||.+.|+..|.+
T Consensus      4936 metkcficgigndyfdt~phgfethtlqehnlanylfflmylinkdetehtgqesyvwkmyqercwdffpagdcfrkqye 5015 (5019)
T KOG2243|consen 4936 METKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYE 5015 (5019)
T ss_pred             hhcceEEeccccccccCCCCcccccchhhhhHHHHHHHHHHHhcccccccccchhHHHHHHHHHHHhhCCchhhHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhc
Q psy13302         81 EDLG   84 (88)
Q Consensus        81 ~~~~   84 (88)
                      ++++
T Consensus      5016 dql~ 5019 (5019)
T KOG2243|consen 5016 DQLG 5019 (5019)
T ss_pred             hhcC
Confidence            8874


No 3  
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=62.80  E-value=2.3  Score=22.53  Aligned_cols=15  Identities=47%  Similarity=0.882  Sum_probs=12.2

Q ss_pred             ceeeeeCCCcccccc
Q psy13302          3 SNCFICGIGKDYFDK   17 (88)
Q Consensus         3 n~CFICgi~r~~fd~   17 (88)
                      -+|-+||..++.|..
T Consensus        18 ~~CP~Cg~~~~~F~~   32 (33)
T cd00350          18 WVCPVCGAPKDKFEK   32 (33)
T ss_pred             CcCcCCCCcHHHcEE
Confidence            379999999988864


No 4  
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=57.72  E-value=2.8  Score=25.22  Aligned_cols=26  Identities=23%  Similarity=0.682  Sum_probs=19.2

Q ss_pred             ceeeeeCCCccccccCCCChHHHhhh
Q psy13302          3 SNCFICGIGKDYFDKVPHGFDTHVQQ   28 (88)
Q Consensus         3 n~CFICgi~r~~fd~~~~~F~~Hi~~   28 (88)
                      -+||-||+.-+.++....-++.|.+.
T Consensus        37 v~C~~C~~~l~~w~~~Ddp~~~H~~~   62 (70)
T PF00653_consen   37 VRCFYCGLELDNWEPNDDPWEEHKRH   62 (70)
T ss_dssp             EEETTTTEEEES-STT--HHHHHHHH
T ss_pred             EEEeccCCEEeCCCCCCCHHHHHHHH
Confidence            47999999998888777788888775


No 5  
>KOG1101|consensus
Probab=56.83  E-value=7.8  Score=27.33  Aligned_cols=26  Identities=23%  Similarity=0.574  Sum_probs=23.9

Q ss_pred             ceeeeeCCCccccccCCCChHHHhhh
Q psy13302          3 SNCFICGIGKDYFDKVPHGFDTHVQQ   28 (88)
Q Consensus         3 n~CFICgi~r~~fd~~~~~F~~Hi~~   28 (88)
                      -+||-||..=...|.....|.+|-+.
T Consensus        52 ~~Cf~C~~~L~~We~~DDPW~EH~k~   77 (147)
T KOG1101|consen   52 VKCFFCSGGLDDWEPGDDPWEEHAKW   77 (147)
T ss_pred             eECcccCcccccCCCCCCcHHHHHhh
Confidence            47999999999999999999999885


No 6  
>PF00253 Ribosomal_S14:  Ribosomal protein S14p/S29e;  InterPro: IPR001209 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. S14 is one of the proteins from the small ribosomal subunit. In Escherichia coli, S14 is known to be required for the assembly of 30S particles and may also be responsible for determining the conformation of 16S rRNA at the A site. It belongs to a family of ribosomal proteins [, ] that include, bacterial, algal and plant chloroplast, yeast mitochondrial, cyanelle and archael, Methanococcus vannielii S14's, as well as yeast mitochondrial MRP2, yeast YS29A/B and mammalian S29.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XZN_N 2XZM_N 1S1H_N 3IZ6_N 2YKR_N 2QBB_N 3I1Z_N 3OAQ_N 3R8O_N 2Z4K_N ....
Probab=54.49  E-value=5.9  Score=23.33  Aligned_cols=19  Identities=21%  Similarity=0.504  Sum_probs=15.7

Q ss_pred             CCceeeeeCCCccccccCC
Q psy13302          1 MESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~   19 (88)
                      ..|.|.+||-.|..+-+.+
T Consensus        15 ~~nrC~~tGR~rgv~r~f~   33 (55)
T PF00253_consen   15 IKNRCVITGRSRGVIRKFG   33 (55)
T ss_dssp             SCSSBSSSCSSSSBETTTS
T ss_pred             CCeecccCCCceeeecccc
Confidence            3689999999999887654


No 7  
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=54.20  E-value=4.2  Score=21.84  Aligned_cols=15  Identities=40%  Similarity=0.957  Sum_probs=11.8

Q ss_pred             ceeeeeCCCcccccc
Q psy13302          3 SNCFICGIGKDYFDK   17 (88)
Q Consensus         3 n~CFICgi~r~~fd~   17 (88)
                      ..|-|||-.++.|++
T Consensus        19 ~~CP~Cg~~~~~F~~   33 (34)
T cd00729          19 EKCPICGAPKEKFEE   33 (34)
T ss_pred             CcCcCCCCchHHcEE
Confidence            478889888888764


No 8  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=48.61  E-value=16  Score=19.09  Aligned_cols=18  Identities=17%  Similarity=0.167  Sum_probs=15.9

Q ss_pred             hhHHHHHHHhcCCCCeee
Q psy13302         53 QETYVWNMYQQRCWDFFP   70 (88)
Q Consensus        53 ~E~yV~~~i~~~d~swfP   70 (88)
                      ++.||.-||.++...|.|
T Consensus         9 V~~yv~yKLsQrgy~w~~   26 (27)
T smart00265        9 VVDYVTYKLSQNGYEWDA   26 (27)
T ss_pred             HHHHHHHHHhhcCCCCCC
Confidence            688999999999998875


No 9  
>COG1773 Rubredoxin [Energy production and conversion]
Probab=46.20  E-value=8.3  Score=23.28  Aligned_cols=16  Identities=38%  Similarity=0.879  Sum_probs=13.3

Q ss_pred             eeeeeCCCccccccCC
Q psy13302          4 NCFICGIGKDYFDKVP   19 (88)
Q Consensus         4 ~CFICgi~r~~fd~~~   19 (88)
                      .|-.||.+++.|++..
T Consensus        38 ~CP~Cg~~K~~F~~~~   53 (55)
T COG1773          38 VCPECGVGKKDFEMID   53 (55)
T ss_pred             CCCCCCCCHhHeeecc
Confidence            5888999999998764


No 10 
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=44.90  E-value=15  Score=21.63  Aligned_cols=26  Identities=23%  Similarity=0.553  Sum_probs=19.4

Q ss_pred             ceeeeeCCCccccccCCCChHHHhhh
Q psy13302          3 SNCFICGIGKDYFDKVPHGFDTHVQQ   28 (88)
Q Consensus         3 n~CFICgi~r~~fd~~~~~F~~Hi~~   28 (88)
                      -+||.||+.=+..+....-+..|.+.
T Consensus        37 v~C~~C~~~l~~w~~~d~p~~~H~~~   62 (71)
T smart00238       37 VKCFFCGGELDNWEPGDDPWEEHKKW   62 (71)
T ss_pred             EEeCCCCCCcCCCCCCCCHHHHHhHh
Confidence            47999999877766666778887553


No 11 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=44.35  E-value=12  Score=21.53  Aligned_cols=11  Identities=45%  Similarity=1.081  Sum_probs=8.3

Q ss_pred             eeeeeCCCccc
Q psy13302          4 NCFICGIGKDY   14 (88)
Q Consensus         4 ~CFICgi~r~~   14 (88)
                      +|+|||-.+..
T Consensus         1 ~CiiC~~~~~~   11 (46)
T PF10764_consen    1 KCIICGKEKEE   11 (46)
T ss_pred             CeEeCCCcCCC
Confidence            59999877664


No 12 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=43.55  E-value=7.1  Score=22.85  Aligned_cols=14  Identities=50%  Similarity=1.111  Sum_probs=12.0

Q ss_pred             eeeeeCCCcccccc
Q psy13302          4 NCFICGIGKDYFDK   17 (88)
Q Consensus         4 ~CFICgi~r~~fd~   17 (88)
                      +|-+||..|+.|.+
T Consensus        36 ~CP~C~a~K~~F~~   49 (50)
T cd00730          36 VCPVCGAGKDDFEP   49 (50)
T ss_pred             CCCCCCCcHHHcEe
Confidence            79999999998864


No 13 
>PRK08061 rpsN 30S ribosomal protein S14; Reviewed
Probab=43.09  E-value=15  Score=22.53  Aligned_cols=19  Identities=21%  Similarity=0.426  Sum_probs=15.7

Q ss_pred             CCceeeeeCCCccccccCC
Q psy13302          1 MESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~   19 (88)
                      .+|.|.+||-.|..+-+-+
T Consensus        20 ~~nRC~~tGR~rgvir~fg   38 (61)
T PRK08061         20 AYTRCERCGRPHSVYRKFG   38 (61)
T ss_pred             cceeeecCCCCcceeccCC
Confidence            3689999999998887654


No 14 
>PF03904 DUF334:  Domain of unknown function (DUF334);  InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function.
Probab=42.91  E-value=15  Score=28.04  Aligned_cols=19  Identities=11%  Similarity=0.557  Sum_probs=15.9

Q ss_pred             HhhhhccchhHHHHHHHhc
Q psy13302         25 HVQQEHNLANYMFFLMHLI   43 (88)
Q Consensus        25 Hi~~eHn~WnYl~fi~yL~   43 (88)
                      -|+..|..|-||+||+|+-
T Consensus       190 ~ik~se~~~~~lwyi~Y~v  208 (230)
T PF03904_consen  190 KIKASESFWTYLWYIAYLV  208 (230)
T ss_pred             HHhhhHhHHHHHHHHHHhh
Confidence            3667788999999999974


No 15 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=41.38  E-value=13  Score=22.47  Aligned_cols=10  Identities=30%  Similarity=0.976  Sum_probs=8.0

Q ss_pred             CCceeeeeCC
Q psy13302          1 MESNCFICGI   10 (88)
Q Consensus         1 ~kn~CFICgi   10 (88)
                      |+-+|.|||-
T Consensus         1 m~vkC~lCdk   10 (56)
T PF09963_consen    1 MRVKCILCDK   10 (56)
T ss_pred             CeeEEEecCC
Confidence            6778999964


No 16 
>PRK05766 rps14P 30S ribosomal protein S14P; Reviewed
Probab=40.72  E-value=14  Score=21.81  Aligned_cols=18  Identities=22%  Similarity=0.457  Sum_probs=15.1

Q ss_pred             CceeeeeCCCccccccCC
Q psy13302          2 ESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         2 kn~CFICgi~r~~fd~~~   19 (88)
                      .|.|.+||-.|..+.+-+
T Consensus        14 ~nrC~~~Gr~rgvirkf~   31 (52)
T PRK05766         14 ARECQRCGRKQGLIRKYG   31 (52)
T ss_pred             CceeecCCCCceeHHhhC
Confidence            689999999998877654


No 17 
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=39.46  E-value=22  Score=20.85  Aligned_cols=26  Identities=19%  Similarity=0.593  Sum_probs=19.4

Q ss_pred             ceeeeeCCCccccccCCCChHHHhhh
Q psy13302          3 SNCFICGIGKDYFDKVPHGFDTHVQQ   28 (88)
Q Consensus         3 n~CFICgi~r~~fd~~~~~F~~Hi~~   28 (88)
                      -+|+-||+.=+..+....-++.|.+.
T Consensus        35 v~C~~C~~~~~~w~~~d~p~~~H~~~   60 (69)
T cd00022          35 VKCFFCGLELKNWEPGDDPWEEHKRW   60 (69)
T ss_pred             EEeCCCCCCccCCCCCCCHHHHHhHh
Confidence            47999999877766666677777654


No 18 
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=37.95  E-value=25  Score=18.41  Aligned_cols=18  Identities=22%  Similarity=0.240  Sum_probs=15.5

Q ss_pred             hhHHHHHHHhcCCCCeee
Q psy13302         53 QETYVWNMYQQRCWDFFP   70 (88)
Q Consensus        53 ~E~yV~~~i~~~d~swfP   70 (88)
                      +|.||.-||.++...|.+
T Consensus         9 V~~yi~yKLsQrgy~w~~   26 (27)
T PF02180_consen    9 VEDYISYKLSQRGYVWEE   26 (27)
T ss_dssp             HHHHHHHHHHHTTSTSTT
T ss_pred             HHHHHHHHhhhcCCCCCC
Confidence            688999999999888865


No 19 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=34.11  E-value=11  Score=17.01  Aligned_cols=11  Identities=18%  Similarity=0.492  Sum_probs=7.7

Q ss_pred             CChHHHhhhhc
Q psy13302         20 HGFDTHVQQEH   30 (88)
Q Consensus        20 ~~F~~Hi~~eH   30 (88)
                      ..+..|+...|
T Consensus        14 ~~l~~H~~~~H   24 (24)
T PF13894_consen   14 SELRQHMRTHH   24 (24)
T ss_dssp             HHHHHHHHHHS
T ss_pred             HHHHHHHHhhC
Confidence            56778887754


No 20 
>PRK06911 rpsN 30S ribosomal protein S14; Reviewed
Probab=33.87  E-value=18  Score=23.95  Aligned_cols=19  Identities=21%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             CCceeeeeCCCccccccCC
Q psy13302          1 MESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~   19 (88)
                      ++|.|.++|-.|..+-+-+
T Consensus        59 ~rNRC~~TGR~Rgv~r~Fg   77 (100)
T PRK06911         59 YVTRCKQCGRPHAVYRKFN   77 (100)
T ss_pred             hhcccCCCCCCcccccccC
Confidence            4799999999999887654


No 21 
>PRK13619 psbV cytochrome c-550; Provisional
Probab=33.41  E-value=15  Score=26.62  Aligned_cols=38  Identities=24%  Similarity=0.215  Sum_probs=25.5

Q ss_pred             CCCCCCChhhHHHHHHHhcCCCCeeecchhhhhhchhh
Q psy13302         45 KPDTEFTGQETYVWNMYQQRCWDFFPVGDCFRKQYEED   82 (88)
Q Consensus        45 K~~~e~tg~E~yV~~~i~~~d~swfP~~~~~~l~~~~~   82 (88)
                      |+++-|+|.|++..-.-.-...+-||..|.|+-+.-..
T Consensus       102 k~PtsyDG~~~~a~~hpsi~~~di~P~mr~LtdedL~~  139 (160)
T PRK13619        102 KHPTSYDGEDDYSELHPNVSRPDIFPELRNFTEDDLYD  139 (160)
T ss_pred             hCCcccccchhhhhhcccccccccccccCCCCHHHHHH
Confidence            78999999998654332224456788888887654433


No 22 
>KOG4477|consensus
Probab=32.32  E-value=20  Score=27.07  Aligned_cols=17  Identities=29%  Similarity=0.794  Sum_probs=12.2

Q ss_pred             ceeeeeCCCccccccCC
Q psy13302          3 SNCFICGIGKDYFDKVP   19 (88)
Q Consensus         3 n~CFICgi~r~~fd~~~   19 (88)
                      -+|||||.-+-.=-+++
T Consensus        39 fkC~vCdvRKGTSTRkp   55 (228)
T KOG4477|consen   39 FKCFVCDVRKGTSTRKP   55 (228)
T ss_pred             hheeeecccccccccCC
Confidence            37999998776655553


No 23 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=32.11  E-value=16  Score=20.75  Aligned_cols=10  Identities=40%  Similarity=1.032  Sum_probs=7.5

Q ss_pred             CCceeeeeCC
Q psy13302          1 MESNCFICGI   10 (88)
Q Consensus         1 ~kn~CFICgi   10 (88)
                      +.+.||.||.
T Consensus        30 lp~~C~~C~~   39 (49)
T PF14392_consen   30 LPRFCFHCGR   39 (49)
T ss_pred             cChhhcCCCC
Confidence            3467999985


No 24 
>PF01702 TGT:  Queuine tRNA-ribosyltransferase;  InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2.4.2.29 from EC, also known as tRNA-guanine transglycosylase and guanine insertion enzyme. Queuine tRNA-ribosyltransferase modifies tRNAs for asparagine, aspartic acid, histidine and tyrosine with queuine at position 34 and with archaeosine at position 15 in archaeal tRNAs. In bacterial it catalyses the exchange of guanine-34 at the wobble position with 7-aminomethyl-7-deazaguanine, and the addition of a cyclopentenediol moiety to 7-aminomethyl-7-deazaguanine-34 tRNA; giving a hypermodified base queuine in the wobble position [, ]. The aligned region contains a zinc binding motif C-x-C-x2-C-x29-H, and important tRNA and 7-aminomethyl-7deazaguanine binding residues [].; GO: 0008479 queuine tRNA-ribosyltransferase activity, 0006400 tRNA modification, 0008616 queuosine biosynthetic process; PDB: 2ASH_A 1J2B_A 1IT8_A 1IT7_B 1IQ8_A 1R5Y_A 1P0B_A 3BL3_A 3EOS_A 1EFZ_A ....
Probab=31.92  E-value=8.7  Score=28.07  Aligned_cols=54  Identities=17%  Similarity=0.338  Sum_probs=28.1

Q ss_pred             eeeee-CCCcccccc---CCCChHHHhhhhccchhHHHHHHHhccCCCCCCChhhHHHHH
Q psy13302          4 NCFIC-GIGKDYFDK---VPHGFDTHVQQEHNLANYMFFLMHLINKPDTEFTGQETYVWN   59 (88)
Q Consensus         4 ~CFIC-gi~r~~fd~---~~~~F~~Hi~~eHn~WnYl~fi~yL~~K~~~e~tg~E~yV~~   59 (88)
                      .|++| ..+|..+-.   ...--.......||+|.|.-|+.-++..=.++-  ++.|+.+
T Consensus       178 ~C~~C~~~trayl~hL~~~~e~l~~~Ll~~HNl~~~~~~~~~iR~~I~~~~--~~~~~~~  235 (238)
T PF01702_consen  178 SCPTCRNYTRAYLHHLLKAKEMLGPVLLSIHNLHHYLRFFKEIREAIRNGT--LREFVEE  235 (238)
T ss_dssp             -SHHHHH-BHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT---HHHHHHH
T ss_pred             CCCCCcccCHHHHHHHHcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC--HHHHHHH
Confidence            57888 333333321   111222234467999999999887775433332  4444443


No 25 
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=28.94  E-value=15  Score=17.09  Aligned_cols=7  Identities=57%  Similarity=1.516  Sum_probs=5.2

Q ss_pred             eeeeeCC
Q psy13302          4 NCFICGI   10 (88)
Q Consensus         4 ~CFICgi   10 (88)
                      +||.||-
T Consensus         2 ~C~~C~~    8 (18)
T PF00098_consen    2 KCFNCGE    8 (18)
T ss_dssp             BCTTTSC
T ss_pred             cCcCCCC
Confidence            5888864


No 26 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=28.04  E-value=25  Score=21.85  Aligned_cols=15  Identities=13%  Similarity=0.091  Sum_probs=9.0

Q ss_pred             CCCCChhhHHHHHHH
Q psy13302         47 DTEFTGQETYVWNMY   61 (88)
Q Consensus        47 ~~e~tg~E~yV~~~i   61 (88)
                      -.+--|++.|....+
T Consensus        34 vLDdLGv~RYCCRRM   48 (63)
T COG1644          34 VLDDLGVKRYCCRRM   48 (63)
T ss_pred             HHHHhCcHHHHHHHH
Confidence            345567777765543


No 27 
>KOG3497|consensus
Probab=27.46  E-value=27  Score=21.84  Aligned_cols=8  Identities=50%  Similarity=1.348  Sum_probs=6.0

Q ss_pred             ceeeeeCC
Q psy13302          3 SNCFICGI   10 (88)
Q Consensus         3 n~CFICgi   10 (88)
                      -+||.||-
T Consensus         5 iRCFtCGK   12 (69)
T KOG3497|consen    5 IRCFTCGK   12 (69)
T ss_pred             eEeeeccc
Confidence            37999973


No 28 
>PF03802 CitX:  Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase;  InterPro: IPR005551 Members of this protein family are annotated as CitX, containing the CitX domain, the domain is also found in the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25 from EC), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.; GO: 0051191 prosthetic group biosynthetic process
Probab=27.33  E-value=21  Score=25.48  Aligned_cols=11  Identities=36%  Similarity=0.963  Sum_probs=7.9

Q ss_pred             ceeeeeCCCcc
Q psy13302          3 SNCFICGIGKD   13 (88)
Q Consensus         3 n~CFICgi~r~   13 (88)
                      -+|||||-+.-
T Consensus       133 R~CliC~~~Ak  143 (170)
T PF03802_consen  133 RRCLICGRPAK  143 (170)
T ss_pred             CcccCCChhHH
Confidence            47999976543


No 29 
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=26.14  E-value=25  Score=21.57  Aligned_cols=9  Identities=44%  Similarity=1.184  Sum_probs=7.2

Q ss_pred             CceeeeeCC
Q psy13302          2 ESNCFICGI   10 (88)
Q Consensus         2 kn~CFICgi   10 (88)
                      +..|++||-
T Consensus         5 ~~~C~~Cg~   13 (69)
T PF09706_consen    5 KYNCIFCGE   13 (69)
T ss_pred             CCcCcCCCC
Confidence            468999994


No 30 
>TIGR03124 ctirate_citX holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.
Probab=26.05  E-value=28  Score=24.90  Aligned_cols=11  Identities=18%  Similarity=0.761  Sum_probs=7.9

Q ss_pred             ceeeeeCCCcc
Q psy13302          3 SNCFICGIGKD   13 (88)
Q Consensus         3 n~CFICgi~r~   13 (88)
                      -+|||||-+.-
T Consensus       131 R~CliC~~~Ak  141 (165)
T TIGR03124       131 RKCLLCEEDAK  141 (165)
T ss_pred             CeeecCCchHH
Confidence            47999976543


No 31 
>PF10664 NdhM:  Cyanobacterial and plastid NDH-1 subunit M;  InterPro: IPR018922 The NADH dehydrogenase I complex shuttles electrons from an unknown electron donor, via FMN and iron-sulphur (Fe-S) centres, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in plants is believed to be plastoquinone. The NADH dehydrogenase I complex couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. This entry represents subunit M of the NADH dehydrogenase I complex in cyanobacteria and plant chloroplasts []. ; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0055114 oxidation-reduction process
Probab=25.96  E-value=47  Score=22.59  Aligned_cols=26  Identities=8%  Similarity=0.130  Sum_probs=21.9

Q ss_pred             ChhhHHHHHHHhcCCCCeeecchhhh
Q psy13302         51 TGQETYVWNMYQQRCWDFFPVGDCFR   76 (88)
Q Consensus        51 tg~E~yV~~~i~~~d~swfP~~~~~~   76 (88)
                      +.+|-||+++++...|++=|-.|.+.
T Consensus        73 SdLE~~iR~LLq~GeisYNl~~RVlN   98 (108)
T PF10664_consen   73 SDLEHFIRSLLQAGEISYNLDSRVLN   98 (108)
T ss_pred             cHHHHHHHHHHHCCceeeCCCcceec
Confidence            36899999999999999988777543


No 32 
>CHL00074 rps14 ribosomal protein S14
Probab=25.73  E-value=28  Score=22.96  Aligned_cols=19  Identities=16%  Similarity=0.579  Sum_probs=15.5

Q ss_pred             CCceeeeeCCCccccccCC
Q psy13302          1 MESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~   19 (88)
                      ++|.|.++|-.|..+-.-+
T Consensus        59 i~NRC~~TGR~Rgv~r~F~   77 (100)
T CHL00074         59 LHNRCFLTGRPRGNYRDFG   77 (100)
T ss_pred             HhccccCCCCCCccccCcC
Confidence            3689999999999887653


No 33 
>TIGR00009 L28 ribosomal protein L28. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture and are not included.
Probab=25.62  E-value=36  Score=20.13  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=7.8

Q ss_pred             CCceeeeeCCC
Q psy13302          1 MESNCFICGIG   11 (88)
Q Consensus         1 ~kn~CFICgi~   11 (88)
                      |...|-|||-.
T Consensus         1 Ms~~C~i~GK~   11 (56)
T TIGR00009         1 MSRKCQLTGKG   11 (56)
T ss_pred             CCCEeeeCCCc
Confidence            55679999743


No 34 
>PRK08881 rpsN 30S ribosomal protein S14; Reviewed
Probab=24.97  E-value=26  Score=23.14  Aligned_cols=19  Identities=21%  Similarity=0.597  Sum_probs=15.4

Q ss_pred             CCceeeeeCCCccccccCC
Q psy13302          1 MESNCFICGIGKDYFDKVP   19 (88)
Q Consensus         1 ~kn~CFICgi~r~~fd~~~   19 (88)
                      ++|.|+++|-.|..+-.-+
T Consensus        60 i~NRC~~TGR~Rgv~r~F~   78 (101)
T PRK08881         60 LRNRCELTGRPRGYYRKFG   78 (101)
T ss_pred             HhccccCCCCCCccccCcC
Confidence            3689999999998887653


No 35 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=24.69  E-value=27  Score=22.10  Aligned_cols=8  Identities=50%  Similarity=1.381  Sum_probs=5.8

Q ss_pred             ceeeeeCC
Q psy13302          3 SNCFICGI   10 (88)
Q Consensus         3 n~CFICgi   10 (88)
                      -.||-||-
T Consensus         5 VRCFTCGk   12 (71)
T PLN00032          5 VRCFTCGK   12 (71)
T ss_pred             eeecCCCC
Confidence            36999973


No 36 
>TIGR03523 GldN gliding motility associated protien GldN. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldN is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldN abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein also include those which are not believed to express the gliding phenotype, such as Prevotella intermedia and Porphyromonas gingivales.
Probab=24.66  E-value=24  Score=27.47  Aligned_cols=10  Identities=30%  Similarity=0.541  Sum_probs=7.8

Q ss_pred             hhhhccchhH
Q psy13302         26 VQQEHNLANY   35 (88)
Q Consensus        26 i~~eHn~WnY   35 (88)
                      ...||+||+|
T Consensus       269 ~~fE~dmW~y  278 (278)
T TIGR03523       269 LEFEDDLWEY  278 (278)
T ss_pred             HHHHHhhhcC
Confidence            3468999987


No 37 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=24.42  E-value=28  Score=21.47  Aligned_cols=9  Identities=44%  Similarity=1.106  Sum_probs=6.3

Q ss_pred             ceeeeeCCC
Q psy13302          3 SNCFICGIG   11 (88)
Q Consensus         3 n~CFICgi~   11 (88)
                      -.||-||-.
T Consensus         5 vRCFTCGkv   13 (62)
T PRK04016          5 VRCFTCGKV   13 (62)
T ss_pred             eEecCCCCC
Confidence            369999743


No 38 
>PRK01392 citX 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA:apo-citrate lyase; Reviewed
Probab=23.28  E-value=32  Score=24.93  Aligned_cols=12  Identities=25%  Similarity=0.880  Sum_probs=8.4

Q ss_pred             ceeeeeCCCccc
Q psy13302          3 SNCFICGIGKDY   14 (88)
Q Consensus         3 n~CFICgi~r~~   14 (88)
                      -+|||||-+.-.
T Consensus       140 R~CliC~~~Ak~  151 (180)
T PRK01392        140 RRCLLCGQDAKV  151 (180)
T ss_pred             CeeecCCchHHH
Confidence            479999765433


No 39 
>PRK01008 queuine tRNA-ribosyltransferase; Provisional
Probab=22.81  E-value=41  Score=27.07  Aligned_cols=41  Identities=17%  Similarity=0.355  Sum_probs=28.9

Q ss_pred             eeeeeC--CCccccccC---CCChHHHhhhhccchhHHHHHHHhcc
Q psy13302          4 NCFICG--IGKDYFDKV---PHGFDTHVQQEHNLANYMFFLMHLIN   44 (88)
Q Consensus         4 ~CFICg--i~r~~fd~~---~~~F~~Hi~~eHn~WnYl~fi~yL~~   44 (88)
                      .|+.|.  .+|..+-.-   ..---......||++.|.-++..+++
T Consensus       320 ~C~~C~~~ytraYLhHL~~~~E~l~~~LltiHNl~~~~~l~~~iR~  365 (372)
T PRK01008        320 SCLACSSGISRAYLRHLFKVHEPNAGIWASIHNLHHMQQVMKEIRE  365 (372)
T ss_pred             CCcCcCCCCCHHHHHHHhcCChHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            599993  677754332   33355677788999999888877653


No 40 
>COG0199 RpsN Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]
Probab=22.41  E-value=39  Score=20.71  Aligned_cols=16  Identities=25%  Similarity=0.567  Sum_probs=13.6

Q ss_pred             CceeeeeCCCcccccc
Q psy13302          2 ESNCFICGIGKDYFDK   17 (88)
Q Consensus         2 kn~CFICgi~r~~fd~   17 (88)
                      .|.|-+||-.|..+-+
T Consensus        21 ~nRC~~cGRprg~~Rk   36 (61)
T COG0199          21 RNRCRRCGRPRGVIRK   36 (61)
T ss_pred             cccccccCCCccchhh
Confidence            6899999998888766


No 41 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=22.06  E-value=25  Score=21.57  Aligned_cols=6  Identities=67%  Similarity=2.012  Sum_probs=4.0

Q ss_pred             eeeeeC
Q psy13302          4 NCFICG    9 (88)
Q Consensus         4 ~CFICg    9 (88)
                      +||-||
T Consensus         6 RCFTCG   11 (60)
T PF01194_consen    6 RCFTCG   11 (60)
T ss_dssp             S-STTT
T ss_pred             ecCCCC
Confidence            688887


No 42 
>PF06084 Cytomega_TRL10:  Cytomegalovirus TRL10 protein;  InterPro: IPR009284 This family consists of several Cytomegalovirus TRL10 proteins. TRL10 represents a structural component of the virus particle and like the other HCMV envelope glycoproteins, is present in a disulphide-linked complex [].
Probab=21.26  E-value=27  Score=24.56  Aligned_cols=19  Identities=21%  Similarity=0.478  Sum_probs=15.6

Q ss_pred             HHHHHHHhccCCCCCCChhh
Q psy13302         35 YMFFLMHLINKPDTEFTGQE   54 (88)
Q Consensus        35 Yl~fi~yL~~K~~~e~tg~E   54 (88)
                      -|||++|-+..+.++ ||.|
T Consensus        74 viffviy~re~~~~~-~gt~   92 (150)
T PF06084_consen   74 VIFFVIYSREEEKNN-NGTE   92 (150)
T ss_pred             HHhheeEeccccccC-CCce
Confidence            579999999988777 7765


No 43 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=20.21  E-value=39  Score=16.25  Aligned_cols=9  Identities=56%  Similarity=1.346  Sum_probs=6.7

Q ss_pred             ceeeeeCCC
Q psy13302          3 SNCFICGIG   11 (88)
Q Consensus         3 n~CFICgi~   11 (88)
                      ..|++||-.
T Consensus        17 ~~C~~C~~p   25 (26)
T smart00547       17 SKCFACGAP   25 (26)
T ss_pred             ccccccCCc
Confidence            579999753


Done!