RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy13313
         (50 letters)



>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
          protein kinase kinase kinase kinase-like Protein
          Serine/Threonine Kinases.  Serine/threonine kinases
          (STKs), mitogen-activated protein kinase (MAPK) kinase
          kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3-like
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily includes
          MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins.
          Vertebrate members contain an N-terminal catalytic
          domain and a C-terminal citron homology (CNH)
          regulatory domain, similar to MAP4K4/6. MAP4Ks are
          involved in some MAPK signaling pathways that are
          important in mediating cellular responses to
          extracellular signals by activating a MAPK kinase
          kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. MAP4K1, also called haematopoietic progenitor
          kinase 1 (HPK1), is a hematopoietic-specific STK
          involved in many cellular signaling cascades including
          MAPK, antigen receptor, apoptosis, growth factor, and
          cytokine signaling. It participates in the regulation
          of T cell receptor signaling and T cell-mediated immune
          responses. MAP4K2 was referred to as germinal center
          (GC) kinase because of its preferred location in GC B
          cells. MAP4K3 plays a role in the nutrient-responsive
          pathway of mTOR (mammalian target of rapamycin)
          signaling. It is required in the activation of S6
          kinase by amino acids and for the phosphorylation of
          the mTOR-regulated inhibitor of eukaryotic initiation
          factor 4E. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 92.7 bits (231), Expect = 2e-25
 Identities = 31/40 (77%), Positives = 37/40 (92%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          M+K+C+H NI+AY+GSYLR+DKLWI MEYCGGGSLQDIY 
Sbjct: 53 MLKECRHPNIVAYFGSYLRRDKLWIVMEYCGGGSLQDIYQ 92


>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 3.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K3 plays a role in the
          nutrient-responsive pathway of mTOR (mammalian target
          of rapamycin) signaling. MAP4K3 is required in the
          activation of S6 kinase by amino acids and for the
          phosphorylation of the mTOR-regulated inhibitor of
          eukaryotic initiation factor 4E. mTOR regulates
          ribosome biogenesis and protein translation, and is
          frequently deregulated in cancer.
          Length = 267

 Score = 89.7 bits (222), Expect = 3e-24
 Identities = 35/40 (87%), Positives = 39/40 (97%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          MMKDCKH NI+AY+GSYLR+DKLWICME+CGGGSLQDIYH
Sbjct: 59 MMKDCKHSNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYH 98


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-activated protein
          kinase kinase kinase kinase 5.  Serine/threonine
          kinases (STKs), mitogen-activated protein kinase (MAPK)
          kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAP4K5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          contain an N-terminal catalytic domain and a C-terminal
          citron homology (CNH) regulatory domain, similar to
          MAP4K4/6. MAP4Ks are involved in some MAPK signaling
          pathways that are important in mediating cellular
          responses to extracellular signals by activating a MAPK
          kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAP4K5, also called germinal center
          kinase-related enzyme (GCKR), has been shown to
          activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
          also facilitates Wnt signaling in B cells, and may
          therefore be implicated in the control of cell fate,
          proliferation, and polarity.
          Length = 267

 Score = 85.1 bits (210), Expect = 2e-22
 Identities = 32/40 (80%), Positives = 38/40 (95%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          M+K+CKH NI+AY+GSYL ++KLWICMEYCGGGSLQDIYH
Sbjct: 59 MVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYH 98


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c)
          domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The STE family
          is part of a larger superfamily that includes the
          catalytic domains of other protein serine/threonine
          kinases (STKs), protein tyrosine kinases (PTKs), RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          family is composed of STKs, and some dual-specificity
          PKs that phosphorylate both threonine and tyrosine
          residues of target proteins. Most members are kinases
          involved in mitogen-activated protein kinase (MAPK)
          signaling cascades, acting as MAPK kinases (MAPKKs),
          MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase
          kinases (MAP4Ks). The MAPK signaling pathways are
          important mediators of cellular responses to
          extracellular signals. The pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPKK, which itself
          is phosphorylated and activated by a MAPKKK. Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAPKKK to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. Other STE family members include
          p21-activated kinases (PAKs) and class III myosins,
          among others. PAKs are Rho family GTPase-regulated
          kinases that serve as important mediators in the
          function of Cdc42 (cell division cycle 42) and Rac.
          Class III myosins are motor proteins containing an
          N-terminal kinase catalytic domain and a C-terminal
          actin-binding domain, which can phosphorylate several
          cytoskeletal proteins, conventional myosin regulatory
          light chains, as well as autophosphorylate the
          C-terminal motor domain. They play an important role in
          maintaining the structural integrity of photoreceptor
          cell microvilli.
          Length = 253

 Score = 73.4 bits (181), Expect = 4e-18
 Identities = 25/43 (58%), Positives = 34/43 (79%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          ++K CKH NI+ YYGSYL+KD+LWI ME+C GGSL+D+  +  
Sbjct: 50 ILKKCKHPNIVKYYGSYLKKDELWIVMEFCSGGSLKDLLKSTN 92


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mammalian Ste20-like protein
          kinase 1 and 2.  Serine/threonine kinases (STKs),
          mammalian Ste20-like protein kinase 1 (MST1) and MST2
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MST1/2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST1, MST2, and related proteins including
          Drosophila Hippo and Dictyostelium discoideum Krs1
          (kinase responsive to stress 1). MST1/2 and Hippo are
          involved in a conserved pathway that governs cell
          contact inhibition, organ size control, and tumor
          development. MST1 activates the mitogen-activated
          protein kinases (MAPKs) p38 and c-Jun N-terminal kinase
          (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK
          kinase kinase) by acting as a MAPK kinase kinase kinase
          (MAPKKKK). Activation of JNK by MST1 leads to caspase
          activation and apoptosis. MST1 has also been implicated
          in cell proliferation and differentiation. Krs1 may
          regulate cell growth arrest and apoptosis in response
          to cellular stress.
          Length = 256

 Score = 66.5 bits (163), Expect = 2e-15
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++K C    I+ YYGSY +   LWI MEYCG GS+ DI
Sbjct: 51 ILKQCDSPYIVKYYGSYFKNTDLWIVMEYCGAGSVSDI 88


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 60.7 bits (148), Expect = 2e-13
 Identities = 25/38 (65%), Positives = 29/38 (76%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +MKDCKH NI+ YY SYL  D+LW+ MEY  GGSL DI
Sbjct: 68  IMKDCKHPNIVDYYDSYLVGDELWVVMEYMDGGSLTDI 105


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
          domain.  Phosphotransferases. Serine or
          threonine-specific kinase subfamily.
          Length = 254

 Score = 56.0 bits (136), Expect = 1e-11
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          ++K  KH NI+  Y  +  +DKL++ MEYC GG L D+        
Sbjct: 50 ILKKLKHPNIVRLYDVFEDEDKLYLVMEYCEGGDLFDLLKKRGRLS 95


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 55.1 bits (133), Expect = 3e-11
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +M+D +H NI+  Y SYL  D+LW+ ME+  GG+L DI
Sbjct: 69  IMRDYQHPNIVEMYSSYLVGDELWVVMEFLEGGALTDI 106


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
          protein kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), mammalian Ste20-like
          protein kinase 3 (MST3)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1
          and Sid1, Saccharomyces cerevisiae sporulation-specific
          protein 1 (SPS1), and related proteins. Nak1 is
          required by fission yeast for polarizing the tips of
          actin cytoskeleton and is involved in cell growth, cell
          separation, cell morphology and cell-cycle progression.
          Sid1 is a component in the septation initiation network
          (SIN) signaling pathway, and plays a role in
          cytokinesis. SPS1 plays a role in regulating proteins
          required for spore wall formation. MST4 plays a role in
          mitogen-activated protein kinase (MAPK) signaling
          during cytoskeletal rearrangement, morphogenesis, and
          apoptosis. MST3 phosphorylates the STK NDR and may play
          a role in cell cycle progression and cell morphology.
          STK25 may play a role in the regulation of cell
          migration and polarization.
          Length = 274

 Score = 54.5 bits (132), Expect = 4e-11
 Identities = 21/44 (47%), Positives = 27/44 (61%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKI 44
           +  C+   I  YYGS+L+  KLWI MEYCGGGS  D+    K+
Sbjct: 52 FLSQCRSPYITKYYGSFLKGSKLWIIMEYCGGGSCLDLLKPGKL 95


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
          Serine/Threonine Kinases, Oxidative stress response
          kinase and Ste20-related proline alanine-rich kinase.
          Serine/threonine kinases (STKs), oxidative stress
          response kinase (OSR1) and Ste20-related proline
          alanine-rich kinase (SPAK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The OSR1 and SPAK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. SPAK is also referred to as
          STK39 or PASK (proline-alanine-rich STE20-related
          kinase). OSR1 and SPAK regulate the activity of
          cation-chloride cotransporters through direct
          interaction and phosphorylation. They are also
          implicated in cytoskeletal rearrangement, cell
          differentiation, transformation and proliferation. OSR1
          and SPAK contain a conserved C-terminal (CCT) domain,
          which recognizes a unique motif ([RK]FX[VI]) present in
          their activating kinases (WNK1/WNK4) and their
          substrates.
          Length = 267

 Score = 52.7 bits (127), Expect = 2e-10
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           M  C H N++ YY S++  D+LW+ M Y  GGSL DI
Sbjct: 52 AMSQCNHPNVVKYYTSFVVGDELWLVMPYLSGGSLLDI 89


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division
          control protein 7-like Protein Serine/Threonine
          Kinases.  Serine/threonine kinases (STKs),  (Cdc7)-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Cdc7-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          include Schizosaccharomyces pombe Cdc7, Saccharomyces
          cerevisiae Cdc15, Arabidopsis thaliana
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) epsilon, and related proteins. MAPKKKs
          phosphorylate and activate MAPK kinases (MAPKKs or MKKs
          or MAP2Ks), which in turn phosphorylate and activate
          MAPKs during signaling cascades that are important in
          mediating cellular responses to extracellular signals.
          Fission yeast Cdc7 is essential for cell division by
          playing a key role in the initiation of septum
          formation and cytokinesis. Budding yeast Cdc15
          functions to coordinate mitotic exit with cytokinesis.
          Arabidopsis MAPKKK epsilon is required for pollen
          development in the plasma membrane.
          Length = 254

 Score = 52.3 bits (126), Expect = 2e-10
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          +K+ KH NI+ Y GS    D L+I +EY   GSL+ I   +  FP
Sbjct: 53 LKNLKHPNIVKYIGSIETSDSLYIILEYAENGSLRQIIKKFGPFP 97


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
          Protein Kinase, Mitogen-Activated Protein Kinase
          Kinase.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, catalytic (c) domain. PKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The MAPKK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK or MAP2K), which itself is phosphorylated and
          activated by a MAPK kinase kinase (MAPKKK or MKKK or
          MAP3K). MAPKKs are dual-specificity PKs that
          phosphorylate their downstream targets, MAPKs, at
          specific threonine and tyrosine residues. There are
          three MAPK subfamilies: extracellular signal-regulated
          kinase (ERK), c-Jun N-terminal kinase (JNK), and p38.
          In mammalian cells, there are seven MAPKKs (named
          MKK1-7) and 20 MAPKKKs. Each MAPK subfamily can be
          activated by at least two cognate MAPKKs and by
          multiple MAPKKKs.
          Length = 265

 Score = 51.9 bits (125), Expect = 4e-10
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 5  CKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIY 39
          C    I+ +YG++     + ICMEY  GGSL  I 
Sbjct: 56 CNSPYIVGFYGAFYNNGDISICMEYMDGGSLDKIL 90


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal
          Pek1-like dual-specificity MAP kinase kinases.  Protein
          kinases (PKs), MAP kinase kinase(MAPKK) subfamily,
          fungal Pek1-like proteins, catalytic (c) domain. PKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine or tyrosine residues on
          protein substrates. The MAPKK subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include the MAPKKs Pek1/Skh1 from
          Schizosaccharomyces pombe and MKK2 from Saccharomyces
          cerevisiae, and related proteins. Both fission yeast
          Pek1 and baker's yeast MKK2 are components of the cell
          integrity MAPK pathway. In fission yeast, Pek1
          phosphorylates and activates the MAPK Pmk1/Spm1 and is
          regulated by the MAPKKK Mkh1. In baker's yeast, the
          pathway involves the MAPK Slt2, the MAPKKs MKK1 and
          MKK2, and the MAPKKK Bck1. The cell integrity MAPK
          cascade is activated by multiple stress conditions, and
          is essential  in cell wall construction, morphogenesis,
          cytokinesis, and ion homeostasis.
          Length = 287

 Score = 52.0 bits (125), Expect = 4e-10
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 2  MKDCKHHNIIAYYGSYLRKDK--LWICMEYCGGGSLQDIY 39
           K CK   I+ YYG++L +    + I MEYC GGSL  IY
Sbjct: 53 NKSCKSPYIVKYYGAFLDESSSSIGIAMEYCEGGSLDSIY 92


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 51.4 bits (123), Expect = 6e-10
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +M++ KH NI+ Y  SYL  D+LW+ MEY  GGSL D+
Sbjct: 69  VMRENKHPNIVNYLDSYLVGDELWVVMEYLAGGSLTDV 106


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
          myosin-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), Class III myosin-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          class III myosin-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Class III
          myosins are motor proteins with an N-terminal kinase
          catalytic domain and a C-terminal actin-binding motor
          domain. Class III myosins are present in the
          photoreceptors of invertebrates and vertebrates and in
          the auditory hair cells of mammals. The kinase domain
          of myosin III can phosphorylate several cytoskeletal
          proteins, conventional myosin regulatory light chains,
          and can autophosphorylate the C-terminal motor domain.
          Myosin III may play an important role in maintaining
          the structural integrity of photoreceptor cell
          microvilli. It may also function as a cargo carrier
          during light-dependent translocation, in photoreceptor
          cells, of proteins such as transducin and arrestin. The
          Drosophila class III myosin, called NinaC (Neither
          inactivation nor afterpotential protein C), is critical
          in normal adaptation and termination of photoresponse. 
          Vertebrates contain two isoforms of class III myosin,
          IIIA and IIIB. This subfamily also includes mammalian
          NIK-like embryo-specific kinase (NESK), Traf2- and
          Nck-interacting kinase (TNIK), mitogen-activated
          protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4
          or MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are
          involved in some MAPK signaling pathways by activating
          a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each
          MAPK cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAP3K to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. MAPK signaling cascades are important
          in mediating cellular responses to extracellular
          signals.
          Length = 275

 Score = 51.5 bits (124), Expect = 6e-10
 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 7/45 (15%)

Query: 1  MMKD-CKHHNIIAYYGSYLRK------DKLWICMEYCGGGSLQDI 38
          +++    H NI  +YG++++K      D+LW+ ME CGGGS+ D+
Sbjct: 55 ILRKYSNHPNIATFYGAFIKKNPPGNDDQLWLVMELCGGGSVTDL 99


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like
          kinase-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), Ste20-like kinase
          (SLK)-like subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The SLK-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Members of the
          subfamily include SLK, STK10 (also called LOK for
          lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni
          SLK), and related proteins. SLK promotes apoptosis
          through apoptosis signal-regulating kinase 1 (ASK1) and
          the mitogen-activated protein kinase (MAPK) p38. It
          also plays a role in mediating actin reorganization.
          STK10 is responsible in regulating the CD28 responsive
          element in T cells, as well as leukocyte function
          associated antigen (LFA-1)-mediated lymphocyte
          adhesion. SmSLK is capable of activating the MAPK Jun
          N-terminal kinase (JNK) pathway in human embryonic
          kidney (HEK) cells as well as in Xenopus oocytes. It
          may participate in regulating MAPK cascades during
          host-parasite interactions.
          Length = 280

 Score = 51.3 bits (123), Expect = 6e-10
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 5  CKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          CKH NI+  Y +Y  ++KLWI +E+C GG+L  I
Sbjct: 59 CKHPNIVGLYEAYFYENKLWILIEFCDGGALDSI 92


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 51.1 bits (123), Expect = 6e-10
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          +++   H NI+    ++  KD L++ MEYC GG L D         
Sbjct: 51 ILRRLSHPNIVRLIDAFEDKDHLYLVMEYCEGGDLFDYLSRGGPLS 96


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase (Nek)
          family, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek family is composed
          of 11 different mammalian members (Nek1-11) with
          similarity to the catalytic domain of Aspergillus
          nidulans NIMA kinase, the founding member of the Nek
          family which was identified in a screen for cell cycle
          mutants that were prevented from entering mitosis. Neks
          contain a conserved N-terminal catalytic domain and a
          more divergent C-terminal regulatory region of various
          sizes and structures. They are involved in the
          regulation of downstream processes following the
          activation of Cdc2, and many of their functions are
          cell cycle-related. They play critical roles in
          microtubule dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 50.6 bits (122), Expect = 1e-09
 Identities = 19/42 (45%), Positives = 21/42 (50%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          +K   H NII YY S+  K KL I MEY  GG L       K
Sbjct: 53 LKKLNHPNIIKYYESFEEKGKLCIVMEYADGGDLSQKIKKQK 94


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-Activated Protein
          Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks)
          are also called MAP/ERK kinase kinases (MEKKs) in some
          cases. They phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. This subfamily is composed of
          the Apoptosis Signal-regulating Kinases ASK1 (or
          MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3,
          MEKK4, as well as plant and fungal MAPKKKs. Also
          included in this subfamily are the cell division
          control proteins Schizosaccharomyces pombe Cdc7 and
          Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 49.5 bits (119), Expect = 3e-09
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWIC--MEYCGGGSLQDIYHTYKIFP 46
          ++   +H NI+ YYGS   ++K  +   +EY  GGSL  +   +   P
Sbjct: 52 ILSSLQHPNIVRYYGSERDEEKNTLNIFLEYVSGGSLSSLLKKFGKLP 99


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 49.3 bits (117), Expect = 4e-09
 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIY-HT 41
           +M+D +H N++  Y SYL  D+LW+ ME+  GG+L DI  HT
Sbjct: 70  IMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHT 111


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mammalian Ste20-like protein
           kinase 4.  Serine/threonine kinases (STKs), mammalian
           Ste20-like protein kinase 4 (MST4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MST4 is sometimes
           referred to as MASK (MST3 and SOK1-related kinase). It
           plays a role in mitogen-activated protein kinase (MAPK)
           signaling during cytoskeletal rearrangement,
           morphogenesis, and apoptosis. It influences cell growth
           and transformation by modulating the extracellular
           signal-regulated kinase (ERK) pathway. MST4 may also
           play a role in tumor formation and progression. It
           localizes in the Golgi apparatus by interacting with the
           Golgi matrix protein GM130 and may play a role in cell
           migration.
          Length = 277

 Score = 48.5 bits (115), Expect = 7e-09
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI-----YHTYKIFPLLKK 50
           ++  C    +  YYGSYL+  KLWI MEY GGGS  D+     +  ++I  +LK+
Sbjct: 55  VLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKE 109


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mitogen-Activated Protein
           Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
           (or MAP4K6) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAP4K4/MAP4K6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Members of this subfamily
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain. MAP4Ks (or
           MAPKKKKs) are involved in MAPK signaling pathways that
           are important in mediating cellular responses to
           extracellular signals by activating a MAPK kinase kinase
           (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAP4K4 is also called Nck Interacting kinase
           (NIK). It facilitates the activation of the MAPKs,
           extracellular signal-regulated kinase (ERK) 1, ERK2, and
           c-Jun N-terminal kinase (JNK), by phosphorylating and
           activating MEKK1. MAP4K4 plays a role in tumor necrosis
           factor (TNF) alpha-induced insulin resistance. MAP4K4
           silencing in skeletal muscle cells from type II diabetic
           patients restores insulin-mediated glucose uptake.
           MAP4K4, through JNK, also plays a broad role in cell
           motility, which impacts inflammation, homeostasis, as
           well as the invasion and spread of cancer. MAP4K4 is
           found to be highly expressed in most tumor cell lines
           relative to normal tissue. MAP4K6 (also called MINK for
           Misshapen/NIKs-related kinase) is activated after Ras
           induction and mediates activation of p38 MAPK. MAP4K6
           plays a role in cell cycle arrest, cytoskeleton
           organization, cell adhesion, and cell motility.
          Length = 282

 Score = 48.1 bits (114), Expect = 9e-09
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 1   MMKDCKHH-NIIAYYGSYLRK------DKLWICMEYCGGGSLQDIYHTYK 43
           M+K   HH NI  YYG++++K      D+LW+ ME+CG GS+ D+    K
Sbjct: 65  MLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTK 114


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 47.8 bits (113), Expect = 1e-08
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +M++ K+ NI+ Y  SYL  D+LW+ MEY  GGSL D+
Sbjct: 69  VMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDV 106


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 47.7 bits (113), Expect = 1e-08
 Identities = 20/42 (47%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIY-HT 41
           +M+D  H N++  Y SYL  D+LW+ ME+  GG+L DI  HT
Sbjct: 72  IMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHT 113


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 1.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 1, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK1 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK1 is
           important in the regulation of many cellular processes
           including cytoskeletal dynamics, cell motility, growth,
           and proliferation. Although PAK1 has been regarded
           mainly as a cytosolic protein, recent reports indicate
           that PAK1 also exists in significant amounts in the
           nucleus, where it is involved in transcription
           modulation and in cell cycle regulatory events. PAK1 is
           also involved in transformation and tumorigenesis. Its
           overexpression, hyperactivation and increased nuclear
           accumulation is correlated to breast cancer invasiveness
           and progression. Nuclear accumulation is also linked to
           tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 47.8 bits (113), Expect = 1e-08
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +M++ K+ NI+ Y  SYL  D+LW+ MEY  GGSL D+
Sbjct: 70  VMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDV 107


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein
          Kinases (PKs), catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The PK family is part of a larger
          superfamily that includes the catalytic domains of RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, phosphoinositide 3-kinase (PI3K), and
          actin-fragmin kinase. PKs make up a large family of
          serine/threonine kinases, protein tyrosine kinases
          (PTKs), and dual-specificity PKs that phosphorylate
          both serine/threonine and tyrosine residues of target
          proteins. Majority of protein phosphorylation, about
          95%, occurs on serine residues while only 1% occurs on
          tyrosine residues. Protein phosphorylation is a
          mechanism by which a wide variety of cellular proteins,
          such as enzymes and membrane channels, are reversibly
          regulated in response to certain stimuli. PKs often
          function as components of signal transduction pathways
          in which one kinase activates a second kinase, which in
          turn, may act on other kinases; this sequential action
          transmits a signal from the cell surface to target
          proteins, which results in cellular responses. The PK
          family is one of the largest known protein families
          with more than 100 homologous yeast enzymes and 550
          human proteins. A fraction of PK family members are
          pseudokinases that lack crucial residues for catalytic
          activity. The mutiplicity of kinases allows for
          specific regulation according to substrate, tissue
          distribution, and cellular localization. PKs regulate
          many cellular processes including proliferation,
          division, differentiation, motility, survival,
          metabolism, cell-cycle progression, cytoskeletal
          rearrangement, immunity, and neuronal functions. Many
          kinases are implicated in the development of various
          human diseases including different types of cancer.
          Length = 215

 Score = 47.2 bits (113), Expect = 2e-08
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          ++K   H NI+  YG +  ++ L++ MEYC GGSL+D+    +
Sbjct: 44 ILKKLNHPNIVKLYGVFEDENHLYLVMEYCEGGSLKDLLKENE 86


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 47.3 bits (112), Expect = 2e-08
 Identities = 17/38 (44%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +M+D +H N++  Y SYL  ++LW+ ME+  GG+L DI
Sbjct: 71  IMRDYQHQNVVEMYKSYLVGEELWVLMEFLQGGALTDI 108


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Traf2- and Nck-interacting
           kinase.  Serine/threonine kinases (STKs), Traf2- and
           Nck-interacting kinase (TNIK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The TNIK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to mitogen-activated protein kinase (MAPK),
           kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
           participate in some MAPK signaling pathways by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). TNIK is an effector of Rap2, a small GTP-binding
           protein from the Ras family. TNIK specifically activates
           the c-Jun N-terminal kinase (JNK) pathway and plays a
           role in regulating the actin cytoskeleton.
          Length = 272

 Score = 47.0 bits (111), Expect = 2e-08
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 1   MMKDCKHH-NIIAYYGSYLRK------DKLWICMEYCGGGSLQDIYHTYK 43
           M+K   HH NI  YYG++++K      D+LW+ ME+CG GS+ D+    K
Sbjct: 55  MLKKYSHHRNIATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKNTK 104


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, STK25 or Yeast
          Sps1/Ste20-related kinase 1.  Serine/threonine kinases
          (STKs), STK25 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The STK25 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. STK25 is also
          called Ste20/oxidant stress response kinase 1 (SOK1) or
          yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is
          localized in the Golgi apparatus through its
          interaction with the Golgi matrix protein GM130. It may
          play a role in the regulation of cell migration and
          polarization. STK25 binds and phosphorylates CCM3
          (cerebral cavernous malformation 3), also called PCD10
          (programmed cell death 10), and may play a role in
          apoptosis. Human STK25 is a candidate gene responsible
          for pseudopseudohypoparathyroidism (PPHP), a disease
          that shares features with the Albright hereditary
          osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 47.0 bits (111), Expect = 3e-08
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++  C    I  YYGSYL+  KLWI MEY GGGS  D+
Sbjct: 55 VLSQCDSPYITRYYGSYLKGTKLWIIMEYLGGGSALDL 92


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 3.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 3 (MST3) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST3 phosphorylates the STK
          NDR and may play a role in cell cycle progression and
          cell morphology. It may also regulate paxillin and
          consequently, cell migration. MST3 is present in human
          placenta, where it plays an essential role in the
          oxidative stress-induced apoptosis of trophoblasts in
          normal spontaneous delivery. Dysregulation of
          trophoblast apoptosis may result in pregnancy
          complications such as preeclampsia and intrauterine
          growth retardation.
          Length = 277

 Score = 46.6 bits (110), Expect = 3e-08
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++  C    +  YYGSYL+  KLWI MEY GGGS  D+
Sbjct: 55 VLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDL 92


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
          Protein Serine/Threonine Kinases.  Serine/threonine
          kinases (STKs), Nak1 subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The Nak1 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of Schizosaccharomyces pombe Nak1,
          Saccharomyces cerevisiae Kic1p (kinase that interacts
          with Cdc31p) and related proteins. Nak1 (also known as
          N-rich kinase 1), is required by fission yeast for
          polarizing the tips of actin cytoskeleton and is
          involved in cell growth, cell separation, cell
          morphology and cell-cycle progression. Kic1p is
          required by budding yeast for cell integrity and
          morphogenesis. Kic1p interacts with Cdc31p, the yeast
          homologue of centrin, and phosphorylates substrates in
          a Cdc31p-dependent manner.
          Length = 277

 Score = 46.7 bits (111), Expect = 3e-08
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 9  NIIAYYGSYLRKDKLWICMEYCGGGSL 35
          NI  YYGSYL+  +LWI MEY  GGS+
Sbjct: 63 NITKYYGSYLKGPRLWIIMEYAEGGSV 89


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 45.1 bits (107), Expect = 1e-07
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
           ++   +H NI+ Y G+   +D L+I +E   GGSL  +   Y  FP
Sbjct: 55  LLSKLQHPNIVQYLGTEREEDNLYIFLELVPGGSLAKLLKKYGSFP 100


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
          Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          4 (MEKK4) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK4 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MEKK4 is a
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK or MKKK or MAP3K), that phosphorylates and
          activates MAPK kinases (MAPKKs or MKKs or MAP2Ks),
          which in turn phosphorylate and activate MAPKs during
          signaling cascades that are important in mediating
          cellular responses to extracellular signals. MEKK4
          activates the c-Jun N-terminal kinase (JNK) and p38
          MAPK signaling pathways by directly activating their
          respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. JNK and p38
          are collectively known as stress-activated MAPKs, as
          they are activated in response to a variety of
          environmental stresses and pro-inflammatory cytokines.
          MEKK4 also plays roles in the re-polarization of the
          actin cytoskeleton in response to osmotic stress, in
          the proper closure of the neural tube, in
          cardiovascular development, and in immune responses.
          Length = 264

 Score = 44.3 bits (105), Expect = 2e-07
 Identities = 16/42 (38%), Positives = 28/42 (66%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFPL 47
          KH N++ YYG  + ++K++I MEYC GG+L+++    +I   
Sbjct: 57 KHPNLVKYYGVEVHREKVYIFMEYCSGGTLEELLEHGRILDE 98


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 44.0 bits (105), Expect = 2e-07
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +MK   H NI+   G   + + L+I  EY  GG L D
Sbjct: 54 IMKKLSHPNIVRLLGVCTQGEPLYIVTEYMPGGDLLD 90


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 9.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek9 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek9, also called Nercc1, is
          primarily a cytoplasmic protein but can also localize
          in the nucleus. It is involved in modulating chromosome
          alignment and splitting during mitosis. It interacts
          with the gamma-tubulin ring complex and the Ran GTPase,
          and is implicated in microtubule organization. Nek9
          associates with FACT (FAcilitates Chromatin
          Transcription) and modulates interphase progression. It
          also interacts with Nek6, and Nek7, during mitosis,
          resulting in their activation.
          Length = 256

 Score = 44.0 bits (104), Expect = 3e-07
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 7  HHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          H NIIAYY  ++  + L I MEY  GG+L D 
Sbjct: 58 HPNIIAYYNHFMDDNTLLIEMEYANGGTLYDK 89


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 43.9 bits (103), Expect = 3e-07
 Identities = 17/38 (44%), Positives = 27/38 (71%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
           +MK+ K+ NI+ +  S+L  D+L++ MEY  GGSL D+
Sbjct: 69  VMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDV 106


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
          Protein Tyrosine Kinase (PTK) family, catalytic domain.
          This PTKc family is part of a larger superfamily that
          includes the catalytic domains of protein
          serine/threonine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. They can
          be classified into receptor and non-receptor tyr
          kinases. PTKs play important roles in many cellular
          processes including, lymphocyte activation, epithelium
          growth and maintenance, metabolism control,
          organogenesis regulation, survival, proliferation,
          differentiation, migration, adhesion, motility, and
          morphogenesis. Receptor tyr kinases (RTKs) are integral
          membrane proteins which contain an extracellular
          ligand-binding region, a transmembrane segment, and an
          intracellular tyr kinase domain. RTKs are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain, leading to
          intracellular signaling. Some RTKs are orphan receptors
          with no known ligands. Non-receptor (or cytoplasmic)
          tyr kinases are distributed in different intracellular
          compartments and are usually multi-domain proteins
          containing a catalytic tyr kinase domain as well as
          various regulatory domains such as SH3 and SH2. PTKs
          are usually autoinhibited and require a mechanism for
          activation. In many PTKs, the phosphorylation of tyr
          residues in the activation loop is essential for
          optimal activity. Aberrant expression of PTKs is
          associated with many development abnormalities and
          cancers.
          Length = 262

 Score = 41.4 bits (98), Expect = 2e-06
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +MK   H N++   G    ++ L++ +EY  GG L D
Sbjct: 49 VMKKLGHPNVVRLLGVCTEEEPLYLVLEYMEGGDLLD 85


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
          Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
          and similar domains.  Serine/Threonine Kinases (STKs),
          Chlamydomonas reinhardtii FA2-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Chlamydomonas
          reinhardtii FA2-like subfamily belongs to the
          (NIMA)-related kinase (Nek) family. The Nek family
          includes seven different Chlamydomonas Neks (CNKs 1-6
          and Fa2). This subfamily includes FA2 and CNK4.  The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase.  Chlamydomonas reinhardtii
          FA2 was discovered in a genetic screen for
          deflagellation-defective mutants. It is essential for
          basal-body/centriole-associated microtubule severing,
          and plays a role in cell cycle progression. No cellular
          function has yet been ascribed to CNK4.
          Length = 256

 Score = 41.3 bits (97), Expect = 2e-06
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFPL 47
          ++       II YY S+L K KL I MEY   G L  +    +  PL
Sbjct: 52 VLAKLDSSYIIRYYESFLDKGKLNIVMEYAENGDLHKLLKMQRGRPL 98


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
           Kinase, Thousand-and-one amino acids proteins.
           Serine/threonine kinases (STKs), thousand-and-one amino
           acids (TAO) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. They activate the MAPKs, p38 and c-Jun
           N-terminal kinase (JNK), by phosphorylating and
           activating the respective MAP/ERK kinases (MEKs, also
           known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
           signaling cascades are important in mediating cellular
           responses to extracellular signals. Vertebrates contain
           three TAO subfamily members, named TAO1, TAO2, and TAO3.
          Length = 307

 Score = 40.9 bits (96), Expect = 3e-06
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           ++  +H N I Y G YLR+   W+ MEYC  GS  DI   +K
Sbjct: 69  LQQLRHPNTIEYKGCYLREHTAWLVMEYC-LGSASDILEVHK 109


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 40.9 bits (95), Expect = 3e-06
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 1   MMKDCKHHNIIAYYGSYLRK--DKLWICMEYCGGGSL-QDIYHTYKIF 45
           +M++ KH NI+ Y   +L K   KL+I ME+C  G L ++I   YK+F
Sbjct: 65  VMRELKHKNIVRYIDRFLNKANQKLYILMEFCDAGDLSRNIQKCYKMF 112


>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIA myosin.
           Serine/threonine kinases (STKs), class IIIA myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           In photoreceptor cells, they may also function as cargo
           carriers during light-dependent translocation of
           proteins such as transducin and arrestin. Class IIIA
           myosin is highly expressed in retina and in inner ear
           hair cells. It is localized to the distal ends of
           actin-bundled structures. Mutations in human myosin IIIA
           are responsible for progressive nonsyndromic hearing
           loss. Human myosin IIIA possesses ATPase and kinase
           activities, and the ability to move actin filaments in a
           motility assay. It may function as a cellular
           transporter capable of moving along actin bundles in
           sensory cells.
          Length = 286

 Score = 40.4 bits (94), Expect = 5e-06
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 5/37 (13%)

Query: 7   HHNIIAYYGSYLRKD-----KLWICMEYCGGGSLQDI 38
           H N++ +YG Y +KD     +LW+ +E C GGS+ D+
Sbjct: 74  HPNVVKFYGMYYKKDVKNGDQLWLVLELCNGGSVTDL 110


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
          dual-specificity MAP kinase kinases and similar
          proteins.  Protein kinases (PKs), MAP kinase kinase
          (MAPKK) subfamily, Plant MAPKKs and similar proteins,
          catalytic (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MAPKK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include MAPKKs from plants, kinetoplastids,
          alveolates, and mycetozoa. The MAPKK, LmxPK4, from
          Leishmania mexicana, is important in differentiation
          and virulence. Dictyostelium discoideum MEK1 is
          required for proper chemotaxis. MEK1 null mutants
          display severe defects in cell polarization and
          directional movement. Plants contain multiple MAPKKs
          like other eukaryotes. The Arabidopsis genome encodes
          for 10 MAPKKs while poplar and rice contain 13 MAPKKs
          each. The functions of these proteins have not been
          fully elucidated. There is evidence to suggest that
          MAPK cascades are involved in plant stress responses.
          In Arabidopsis, MKK3 plays a role in pathogen
          signaling, MKK2 is involved in cold and salt stress
          signaling, MKK4/MKK5 participates in innate immunity,
          and MKK7 regulates basal and systemic acquired
          resistance.
          Length = 264

 Score = 39.9 bits (94), Expect = 7e-06
 Identities = 12/43 (27%), Positives = 23/43 (53%)

Query: 4  DCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
           C+   ++  YG++ ++ ++ I +EY  GGSL D+       P
Sbjct: 55 SCESPYVVKCYGAFYKEGEISIVLEYMDGGSLADLLKKVGKIP 97


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal
          Byr1-like dual-specificity MAP kinase kinases.  Protein
          kinases (PKs), MAP kinase kinase (MAPKK) subfamily,
          fungal Byr1-like proteins, catalytic (c) domain. PKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine or tyrosine residues on
          protein substrates. The MAPKK subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include the MAPKKs Byr1 from Schizosaccharomyces
          pombe, FUZ7 from Ustilago maydis, and related proteins.
          Byr1 phosphorylates its downstream target, the MAPK
          Spk1, and is regulated by the MAPKKK Byr2. The Spk1
          cascade is pheromone-responsive and is essential for
          sporulation and sexual differentiation in fission
          yeast. FUZ7 phosphorylates and activates its target,
          the MAPK Crk1, which is required in mating and
          virulence in U. maydis.
          Length = 284

 Score = 40.2 bits (94), Expect = 7e-06
 Identities = 14/42 (33%), Positives = 27/42 (64%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTY 42
          +M +C+   I+++YG++L ++ + +CME+   GSL  IY   
Sbjct: 56 IMHECRSPYIVSFYGAFLNENNICMCMEFMDCGSLDRIYKKG 97


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 5.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek5 subfamily is one of a family of 11 different Neks
          (Nek1-11). The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Neks are
          involved in the regulation of downstream processes
          following the activation of Cdc2, and many of their
          functions are cell cycle-related. They play critical
          roles in microtubule dynamics during ciliogenesis and
          mitosis. The specific function of Nek5 is unknown.
          Length = 257

 Score = 39.9 bits (93), Expect = 8e-06
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++   KH NI+ ++ S+    +L+I MEYC GG L
Sbjct: 52 LLAKMKHPNIVTFFASFQENGRLFIVMEYCDGGDL 86


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 39.8 bits (93), Expect = 8e-06
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
           ++K+ +H NI+ Y GS L  D L I +EY  GGS+  + + Y  F 
Sbjct: 59  LLKELQHENIVQYLGSSLDADHLNIFLEYVPGGSVAALLNNYGAFE 104


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 39.4 bits (93), Expect = 1e-05
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +M+   H N++   G    ++ L+I MEY  GG L  
Sbjct: 54 IMRKLDHPNVVKLLGVCTEEEPLYIVMEYMEGGDLLS 90


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 39.1 bits (92), Expect = 1e-05
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +M+   H NI+   G    ++ L I MEY  GG L D
Sbjct: 54 IMRKLDHPNIVKLLGVCTEEEPLMIVMEYMPGGDLLD 90


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
          Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
          kinase.  Serine/threonine kinases (STKs), STK10
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          STK10 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Other names for STK10
          include lymphocyte-oriented kinase (LOK) and Xenopus
          polo-like kinase kinase 1 (xPlkk1). STK10 is highly
          expressed in lymphocytes and is responsible in
          regulating leukocyte function associated antigen
          (LFA-1)-mediated lymphocyte adhesion. It plays a role
          in regulating the CD28 responsive element in T cells,
          and may also function as a regulator of polo-like
          kinase 1 (Plk1), a protein which is overexpressed in
          multiple tumor types.
          Length = 292

 Score = 38.1 bits (88), Expect = 3e-05
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++  C H  I+   G++    KLWI +E+C GG++  I
Sbjct: 62 ILATCNHPYIVKLLGAFYWDGKLWIMIEFCPGGAVDAI 99


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 1.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO1 is sometimes referred to as prostate-derived
           sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
           MAPK through direct interaction with and activation of
           MEK3. TAO1 is highly expressed in the brain and may play
           a role in neuronal apoptosis. TAO1 interacts with the
           checkpoint proteins BubR1 and Mad2, and plays an
           important role in regulating mitotic progression, which
           is required for both chromosome congression and
           checkpoint-induced anaphase delay. TAO1 may play a role
           in protecting genomic stability.
          Length = 317

 Score = 38.1 bits (88), Expect = 3e-05
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           ++  KH N I Y G YLR+   W+ MEYC  GS  D+   +K
Sbjct: 79  LQRIKHPNSIEYKGCYLREHTAWLVMEYC-LGSASDLLEVHK 119


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 2.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           Human TAO2 is also known as prostate-derived Ste20-like
           kinase (PSK) and was identified in a screen for
           overexpressed RNAs in prostate cancer. TAO2 activates
           both p38 and c-Jun N-terminal kinase (JNK), by
           phosphorylating and activating the respective MAP/ERK
           kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
           and MKK4/MKK7. TAO2 contains a long C-terminal extension
           with autoinhibitory segments. It is activated by the
           release of this inhibition and the phosphorylation of
           its activation loop serine. TAO2 functions as a
           regulator of actin cytoskeletal and microtubule
           organization. In addition, it regulates the transforming
           growth factor-activated kinase 1 (TAK1), which is a
           MAPKKK that plays an essential role in the signaling
           pathways of tumor necrosis factor (TNF), interleukin 1
           (IL-1), and Toll-like receptor (TLR).
          Length = 308

 Score = 38.1 bits (88), Expect = 4e-05
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           ++  +H N I Y G YLR+   W+ MEYC  GS  D+   +K
Sbjct: 69  LQKLRHPNTIQYRGCYLREHTAWLVMEYC-LGSASDLLEVHK 109


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 37.6 bits (87), Expect = 5e-05
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
           ++K  KH NI+ Y G+ L  + + I ME+  GGS+  I + +   P
Sbjct: 55  LLKSLKHVNIVQYLGTCLDDNTISIFMEFVPGGSISSILNRFGPLP 100


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 37.7 bits (87), Expect = 5e-05
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           ++  KH N I Y G YL++   W+ MEYC  GS  D+   +K
Sbjct: 75  LQQLKHPNTIEYKGCYLKEHTAWLVMEYC-LGSASDLLEVHK 115


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 2.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek2 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek2 subfamily includes
          Aspergillus nidulans NIMA kinase, the founding member
          of the Nek family, which was identified in a screen for
          cell cycle mutants prevented from entering mitosis.
          NIMA is essential for mitotic entry and progression
          through mitosis, and its degradation is essential for
          mitotic exit. NIMA is involved in nuclear membrane
          fission. Vertebrate Nek2 is a cell cycle-regulated STK,
          localized in centrosomes and kinetochores, that
          regulates centrosome splitting at the G2/M phase. It
          also interacts with other mitotic kinases such as
          Polo-like kinase 1 and may play a role in spindle
          checkpoint. An increase in the expression of the human
          NEK2 gene is strongly associated with the progression
          of non-Hodgkin lymphoma.
          Length = 265

 Score = 37.6 bits (88), Expect = 5e-05
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 2  MKDCKHHNIIAYYGSYLRKDK--LWICMEYCGGGSLQDI 38
          +++ KH NI+ YY   + +    L+I MEYC GG L  +
Sbjct: 53 LRELKHPNIVRYYDRIIDRSNQTLYIVMEYCEGGDLAQL 91


>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal
           Bck1-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Bck1-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Saccharomyces cerevisiae Bck1 and Schizosaccharomyces
           pombe Mkh1, and related proteins. MAPKKKs phosphorylate
           and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks),
           which in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Budding
           yeast Bck1 is part of the cell integrity MAPK pathway,
           which is activated by stresses and aggressions to the
           cell wall. The MAPKKK Bck1, MAPKKs Mkk1 and Mkk2, and
           the MAPK Slt2 make up the cascade that is important in
           the maintenance of cell wall homeostasis. Fission yeast
           Mkh1 is involved in MAPK cascades regulating cell
           morphology, cell wall integrity, salt resistance, and
           filamentous growth in response to stress.
          Length = 272

 Score = 37.5 bits (87), Expect = 6e-05
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIF 45
            +KD  H NI+ Y G    ++ L I +EY  GGS+     TY  F
Sbjct: 61  TLKDLDHLNIVQYLGFETTEEYLSIFLEYVPGGSIGSCLRTYGRF 105


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 8.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek8 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek8 contains an N-terminal
          kinase catalytic domain and a C-terminal RCC1
          (regulator of chromosome condensation) domain. A double
          point mutation in Nek8 causes cystic kidney disease in
          mice that genetically resembles human autosomal
          recessive polycystic kidney disease (ARPKD). Nek8 is
          also associated with a rare form of juvenile renal
          cystic disease, nephronophthisis type 9. It has been
          suggested that a defect in the ciliary localization of
          Nek8 contributes to the development of cysts manifested
          by these diseases.
          Length = 256

 Score = 37.1 bits (86), Expect = 7e-05
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          ++K   H NII YY ++L    L I MEY  GG+L +
Sbjct: 52 VLKLLSHPNIIEYYENFLEDKALMIVMEYAPGGTLAE 88


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase
          kinase 3-like Protein Serine/Threonine Kinases.
          Serine/threonine kinases (STKs), MAP/ERK kinase kinase
          3 (MEKK3)-like subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The MEKK3-like subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of MEKK3, MEKK2, and related proteins, all
          containing an N-terminal PB1 domain, which mediates
          oligomerization, and a C-terminal catalytic domain.
          MEKK2 and MEKK3 are mitogen-activated protein kinase
          (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
          proteins that phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. MEKK2 and MEKK3 activate MEK5
          (also called MKK5), which activates extracellular
          signal-regulated kinase 5 (ERK5). The ERK5 cascade
          plays roles in promoting cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. MEKK3 plays an essential role in
          embryonic angiogenesis and early heart development.
          MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
          N-terminal kinase (JNK) and p38, through their
          respective MAPKKs.
          Length = 263

 Score = 36.3 bits (84), Expect = 1e-04
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTY 42
          ++K+ +H  I+ YYG     + L I MEY  GGS++D    Y
Sbjct: 57 LLKNLQHERIVQYYGCLRDDETLSIFMEYMPGGSVKDQLKAY 98


>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity
          Protein Kinase, MAP/ERK Kinase.  Protein kinases (PKs),
          MAP/ERK kinase (MEK) subfamily, catalytic (c) domain.
          PKs catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine or tyrosine residues on
          protein substrates. The MEK subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are
          dual-specificity PKs that phosphorylate and activate
          the downstream targets, ERK(extracellular
          signal-regulated kinase) 1 and ERK2, on specific
          threonine and tyrosine residues. The ERK cascade starts
          with extracellular signals including growth factors,
          hormones, and neurotransmitters, which act through
          receptors and ion channels to initiate intracellular
          signaling that leads to the activation at the MAPKKK
          (Raf-1 or MOS) level, which leads to the transmission
          of signals to MEK1/2, and finally to ERK1/2. The ERK
          cascade plays an important role in cell proliferation,
          differentiation, oncogenic transformation, and cell
          cycle control, as well as in apoptosis and cell
          survival under certain conditions. This cascade has
          also been implicated in synaptic plasticity, migration,
          morphological determination, and stress response
          immunological reactions. Gain-of-function mutations in
          genes encoding ERK cascade proteins, including MEK1/2,
          cause cardiofaciocutaneous (CFC) syndrome, a condition
          leading to multiple congenital anomalies and mental
          retardation in patients.
          Length = 308

 Score = 36.3 bits (84), Expect = 1e-04
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 4  DCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          +C    I+ +YG++    ++ ICME+  GGSL
Sbjct: 55 ECNSPYIVGFYGAFYSDGEISICMEHMDGGSL 86


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score = 36.2 bits (83), Expect = 2e-04
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
           ++ +C    I+ +YG++    ++ ICME+  GGSL  +    K  P
Sbjct: 56  VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIP 101


>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Ste20-like kinase.
          Serine/threonine kinases (STKs), Ste20-like kinase
          (SLK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          SLK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. SLK promotes apoptosis
          through apoptosis signal-regulating kinase 1 (ASK1) and
          the mitogen-activated protein kinase (MAPK) p38. It
          acts as a MAPK kinase kinase (MAPKKK) by
          phosphorylating ASK1, resulting in the phosphorylation
          of p38. SLK also plays a role in mediating actin
          reorganization. It is part of a microtubule-associated
          complex that is targeted at adhesion sites, and is
          required in focal adhesion turnover and in regulating
          cell migration.
          Length = 282

 Score = 35.4 bits (81), Expect = 3e-04
 Identities = 11/38 (28%), Positives = 23/38 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++  C H NI+    ++  ++ LWI +E+C GG++  +
Sbjct: 55 ILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAV 92


>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 10.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 10 (Nek10)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek10 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. No function has yet been ascribed to Nek10.
           The gene encoding Nek10 is a putative causative gene for
           breast cancer; it is located within a breast cancer
           susceptibility loci on chromosome 3p24.
          Length = 269

 Score = 34.8 bits (80), Expect = 5e-04
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 6   KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           +H NI+ YY ++L  D+L+I M+   G  L + +++ K
Sbjct: 67  RHPNIVRYYKTFLENDRLYIVMDLIEGAPLGEHFNSLK 104


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal
          PBS2-like dual-specificity MAP kinase kinases.  Protein
          kinases (PKs), MAP kinase kinase (MAPKK) subfamily,
          fungal PBS2-like proteins, catalytic (c) domain. PKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine or tyrosine residues on
          protein substrates. The MAPKK subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). Members of this
          group include the MAPKKs Polymyxin B resistance protein
          2 (PBS2) from Saccharomyces cerevisiae, Wis1 from
          Schizosaccharomyces pombe, and related proteins. PBS2
          and Wis1 are components of stress-activated MAPK
          cascades in budding and fission yeast, respectively.
          PBS2 is the specific activator of the MAPK Hog1, which
          plays a central role in the response of budding yeast
          to stress including exposure to arsenite and
          hyperosmotic environments. Wis1 phosphorylates and
          activates the MAPK Sty1 (also called Spc1 or Phh1),
          which stimulates a transcriptional response to a wide
          range of cellular insults through the bZip
          transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 34.8 bits (80), Expect = 5e-04
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 10 IIAYYGSYLRKDKLWICMEYCGGGSLQDIY 39
          I+ +YG++  +  +++CMEY   GSL  +Y
Sbjct: 61 IVDFYGAFFIEGAVYMCMEYMDAGSLDKLY 90


>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein
           Serine/Threonine Kinase, Class IIIB myosin.
           Serine/threonine kinases (STKs), class IIIB myosin
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins containing an N-terminal kinase catalytic
           domain and a C-terminal actin-binding domain. Class III
           myosins may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           They may also function as cargo carriers during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. Class IIIB
           myosin is expressed highly in retina. It is also present
           in the brain and testis. The human class IIIB myosin
           gene maps to a region that overlaps the locus for
           Bardet-Biedl syndrome, which is characterized by
           dysmorphic extremities, retinal dystrophy, obesity, male
           hypogenitalism, and renal abnormalities.
          Length = 291

 Score = 33.8 bits (77), Expect = 0.001
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 5/37 (13%)

Query: 7   HHNIIAYYGSYLRKDK-----LWICMEYCGGGSLQDI 38
           H N++ +YG + + DK     LW+ +E C GGS+ ++
Sbjct: 78  HPNVVKFYGMFYKADKLVGGQLWLVLELCNGGSVTEL 114


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 1.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek1 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek1 is associated with
          centrosomes throughout the cell cycle. It is involved
          in the formation of primary cilium and in the
          maintenance of centrosomes. It cycles through the
          nucleus and may be capable of relaying signals between
          the cilium and the nucleus. Nek1 is implicated in the
          development of polycystic kidney disease, which is
          characterized by benign polycystic tumors formed by
          abnormal overgrowth of renal epithelial cells. It
          appears also to be involved in DNA damage response, and
          may be important for both correct DNA damage checkpoint
          activation and DNA repair.
          Length = 256

 Score = 34.0 bits (78), Expect = 0.001
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          KH NI+ Y  S+     L+I M+YC GG L
Sbjct: 57 KHPNIVQYQESFEENGNLYIVMDYCEGGDL 86


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 3.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek3 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek3 is primarily localized
          in the cytoplasm and shows no cell cycle-dependent
          changes in its activity. It is present in the axons of
          neurons and affects morphogenesis and polarity through
          its regulation of microtubule acetylation. Nek3
          modulates the signaling of the prolactin receptor
          through its activation of Vav2 and contributes to
          prolactin-mediated motility of breast cancer cells.
          Length = 255

 Score = 33.8 bits (77), Expect = 0.001
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++   KH NI+A+  S+     L+I MEYC GG L
Sbjct: 51 LLAKMKHPNIVAFKESFEADGHLYIVMEYCDGGDL 85


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity
          Protein Kinase, MAP/ERK Kinase 1.  Protein kinases
          (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c)
          domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MEK
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a
          dual-specificity PK that phosphorylates and activates
          the downstream targets, extracellular signal-regulated
          kinase (ERK) 1 and ERK2, on specific threonine and
          tyrosine residues. The ERK cascade starts with
          extracellular signals including growth factors,
          hormones, and neurotransmitters, which act through
          receptors and ion channels to initiate intracellular
          signaling that leads to the activation at the MAPKKK
          (Raf-1 or MOS) level, which leads to the transmission
          of signals to MEK1, and finally to ERK1/2. The ERK
          cascade plays an important role in cell proliferation,
          differentiation, oncogenic transformation, and cell
          cycle control, as well as in apoptosis and cell
          survival under certain conditions. Gain-of-function
          mutations in genes encoding ERK cascade proteins,
          including MEK1, cause cardiofaciocutaneous (CFC)
          syndrome, a condition leading to multiple congenital
          anomalies and mental retardation in patients. MEK1 also
          plays a role in cell cycle control.
          Length = 333

 Score = 33.9 bits (77), Expect = 0.001
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          ++ +C    I+ +YG++    ++ ICME+  GGSL  +
Sbjct: 56 VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQV 93


>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity
          Protein Kinase, MAP kinase kinase 5.  Protein kinases
          (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic
          (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MKK5
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MKK5, also
          referred to as MEK5, is a dual-specificity PK that
          phosphorylates its downstream target, extracellular
          signal-regulated kinase 5 (ERK5), on specific threonine
          and tyrosine residues. MKK5 is activated by MEKK2 and
          MEKK3 in response to mitogenic and stress stimuli. The
          ERK5 cascade promotes cell proliferation,
          differentiation, neuronal survival, and
          neuroprotection. This cascade plays an essential role
          in heart development. Mice deficient in either ERK5 or
          MKK5 die around embryonic day 10 due to cardiovascular
          defects including underdevelopment of the myocardium.
          In addition, MKK5 is associated with metastasis and
          unfavorable prognosis in prostate cancer.
          Length = 279

 Score = 33.3 bits (76), Expect = 0.002
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 5  CKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIY 39
          C    II +YG++  ++++ IC E+  GGSL D+Y
Sbjct: 56 CDSPYIIGFYGAFFVENRISICTEFMDGGSL-DVY 89


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
          Serine/Threonine Kinase, Chlamydomonas reinhardtii
          CNK2,  and similar domains.  Serine/Threonine Kinases
          (STKs), Chlamydomonas reinhardtii Never In Mitosis gene
          A (NIMA)-related kinase 1 (CNK2)-like subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Chlamydomonas
          reinhardtii CNK2-like subfamily belongs to the
          (NIMA)-related kinase (Nek) family. The Nek family
          includes seven different Chlamydomonas Neks (CNKs 1-6
          and Fa2). This subfamily includes CNK1, and -2.  The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase.  Chlamydomonas reinhardtii
          CNK2 has both cilliary and cell cycle functions. It
          influences flagellar length through promoting flagellar
          disassembly, and it regulates cell size, through
          influencing the size threshold at which cells commit to
          mitosis.
          Length = 256

 Score = 33.2 bits (76), Expect = 0.002
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++    H NII+Y  ++L  +KL I MEY   G L
Sbjct: 52 ILASVNHPNIISYKEAFLDGNKLCIVMEYAPFGDL 86


>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
          Length = 478

 Score = 32.7 bits (74), Expect = 0.003
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 5   CKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
           C H  I+ ++  +   DKL + MEY  GG L
Sbjct: 122 CDHFGIVKHFDDFKSDDKLLLIMEYGSGGDL 152


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
          prediction only / Signal transduction mechanisms /
          Transcription / DNA replication, recombination, and
          repair].
          Length = 384

 Score = 32.8 bits (73), Expect = 0.003
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 1  MMKDCKHH-NIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFPLL 48
          ++    H  NI+  Y  +  +  L++ MEY  GGSL+D+         L
Sbjct: 50 ILASLNHPPNIVKLYDFFQDEGSLYLVMEYVDGGSLEDLLKKIGRKGPL 98


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Apoptosis signal-regulating
          kinase.  Serine/threonine kinases (STKs), Apoptosis
          signal-regulating kinase (ASK) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The ASK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Subfamily members are
          mitogen-activated protein kinase (MAPK) kinase kinases
          (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2,
          and MAPKKK15. MAPKKKs phosphorylate and activate MAPK
          kinases (MAPKKs or MKKs or MAP2Ks), which in turn
          phosphorylate and activate MAPKs during signaling
          cascades that are important in mediating cellular
          responses to extracellular signals. ASK1 (also called
          MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
          and p38 MAPK signaling pathways by directly activating
          their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
          plays important roles in cytokine and stress responses,
          as well as in reactive oxygen species (ROS)-mediated
          cellular responses. ASK1 is implicated in various
          diseases mediated by oxidative stress including
          inschemic heart disease, hypertension, vessel injury,
          brain ischemia, Fanconi anemia, asthma, and pulmonary
          edema, among others. ASK2 (also called MAPKKK6)
          functions only in a heteromeric complex with ASK1, and
          can activate ASK1 by direct phosphorylation. The
          function of MAPKKK15 is still unknown.
          Length = 268

 Score = 32.5 bits (74), Expect = 0.004
 Identities = 14/36 (38%), Positives = 17/36 (47%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHT 41
          KH NI+ Y GS        I ME   GGSL  +  +
Sbjct: 63 KHRNIVQYLGSDSENGFFKIFMEQVPGGSLSALLRS 98


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK3 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK3 plays an essential role in embryonic angiogenesis
           and early heart development. In addition, MEKK3 is
           involved in interleukin-1 receptor and Toll-like
           receptor 4 signaling. It is also a specific regulator of
           the proinflammatory cytokines IL-6 and GM-CSF in some
           immune cells. MEKK3 also regulates calcineurin, which
           plays a critical role in T cell activation, apoptosis,
           skeletal myocyte differentiation, and cardiac
           hypertrophy.
          Length = 266

 Score = 32.3 bits (73), Expect = 0.004
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1   MMKDCKHHNIIAYYGSYLR---KDKLWICMEYCGGGSLQDIYHTY 42
           ++K+ +H  I+ YYG  LR   +  L I MEY  GGS++D    Y
Sbjct: 57  LLKNLQHERIVQYYGC-LRDRAEKTLTIFMEYMPGGSVKDQLKAY 100


>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase
          adapter protein.  Protein Kinase family, STE20-related
          kinase adapter protein (STRAD) subfamily, pseudokinase
          domain. The STRAD subfamily is part of a larger
          superfamily that includes the catalytic domains of
          serine/threonine kinases (STKs), protein tyrosine
          kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The pseudokinase domain
          shows similarity to protein kinases but lacks crucial
          residues for catalytic activity. STRAD forms a complex
          with the scaffolding protein MO25, and the STK, LKB1,
          resulting in the activation of the kinase. In the
          complex, LKB1 phosphorylates and activates adenosine
          monophosphate-activated protein kinases (AMPKs), which
          regulate cell energy metabolism and cell polarity. LKB1
          is a tumor suppressor linked to the rare inherited
          disease, Peutz-Jeghers syndrome, which is characterized
          by a predisposition to benign polyps and
          hyperpigmentation of the buccal mucosa. There are two
          forms of STRAD, alpha and beta, that complex with LKB1
          and MO25. The structure of STRAD-alpha is available and
          shows that this protein binds ATP, has an ordered
          activation loop, and adopts a closed conformation
          typical of fully active protein kinases. It does not
          possess activity due to nonconservative substitutions
          of essential catalytic residues. ATP binding enhances
          the affinity of STRAD for MO25.  The conformation of
          STRAD-alpha stabilized through ATP and MO25 may be
          needed to activate LKB1.
          Length = 314

 Score = 31.9 bits (73), Expect = 0.005
 Identities = 10/41 (24%), Positives = 21/41 (51%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTY 42
           +  +H NI+ Y  S++   +L++       GS +D+  T+
Sbjct: 53 SRQLQHPNILPYVTSFIVDSELYVVSPLMAYGSCEDLLKTH 93


>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 4.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek4 subfamily is one of a family of 11 different Neks
          (Nek1-11). The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Neks are
          involved in the regulation of downstream processes
          following the activation of Cdc2, and many of their
          functions are cell cycle-related. They play critical
          roles in microtubule dynamics during ciliogenesis and
          mitosis. Nek4 is highly abundant in the testis. Its
          specific function is unknown.
          Length = 257

 Score = 31.5 bits (71), Expect = 0.007
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 1  MMKDCKHHNIIAYYGSYLRKD-KLWICMEYCGGGSLQDIYHTYK 43
          ++   KH NI+AY  S+  +D  L+I M +C GG   D+YH  K
Sbjct: 52 LLSQLKHPNIVAYRESWEGEDGLLYIVMGFCEGG---DLYHKLK 92


>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase
           kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain,
           functionally uncharacterized subgroup 1. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MEKK3-like subfamily is
           composed of MEKK3, MEKK2, and related proteins, all
           containing an N-terminal PB1 domain, which mediates
           oligomerization, and a C-terminal catalytic domain.
           MEKK2 and MEKK3 are mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks),
           proteins that phosphorylate and activate MAPK kinases
           (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
           and activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK2 and MEKK3 activate MEK5
           (also called MKK5), which activates extracellular
           signal-regulated kinase 5 (ERK5). The ERK5 cascade plays
           roles in promoting cell proliferation, differentiation,
           neuronal survival, and neuroprotection. MEKK3 plays an
           essential role in embryonic angiogenesis and early heart
           development. MEKK2 and MEKK3 can also activate the
           MAPKs, c-Jun N-terminal kinase (JNK) and p38, through
           their respective MAPKKs.
          Length = 264

 Score = 31.5 bits (71), Expect = 0.008
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 1   MMKDCKHHNIIAYYGSYLR---KDKLWICMEYCGGGSLQDIYHTY 42
           ++K+ +H  I+ YYG  LR   + KL I +EY  GGS++D    Y
Sbjct: 57  LLKNLRHDRIVQYYGC-LRDPEEKKLSIFVEYMPGGSIKDQLKAY 100


>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Fibroblast Growth Factor Receptors.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor (FGFR) subfamily; catalytic (c) domain. The
           FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
           and similar proteins. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K).PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. FGFR subfamily members
           are receptor tyr kinases (RTKs) containing an
           extracellular ligand-binding region with three
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding of
           FGFRs to their ligands, the FGFs, and to heparin/heparan
           sulfate (HS) results in the formation of a ternary
           complex, which leads to receptor dimerization and
           activation, and intracellular signaling. There are at
           least 23 FGFs and four types of FGFRs. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. FGF/FGFR signaling is
           important in the regulation of embryonic development,
           homeostasis, and regenerative processes. Depending on
           the cell type and stage, FGFR signaling produces diverse
           cellular responses including proliferation, growth
           arrest, differentiation, and apoptosis. Aberrant
           signaling leads to many human diseases such as skeletal,
           olfactory, and metabolic disorders, as well as cancer.
          Length = 293

 Score = 30.8 bits (70), Expect = 0.011
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 1   MMKDC-KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
           MMK   KH NII   G   ++  L++ +EY   G+L+D
Sbjct: 68  MMKMIGKHKNIINLLGVCTQEGPLYVVVEYAAHGNLRD 105


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
          Kinase Like Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Cyclin-dependent protein kinase like
          (CDKL) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          CDKL subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDKL1-5 and
          similar proteins. Some CDKLs, like CDKL1 and CDKL3, may
          be implicated in transformation and others, like CDKL3
          and CDKL5, are associated with mental retardation when
          impaired. CDKL2 plays a role in learning and memory.
          Length = 288

 Score = 30.7 bits (70), Expect = 0.014
 Identities = 9/38 (23%), Positives = 21/38 (55%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDI 38
          +++  +H NI+    ++ RK +L++  EY     L+ +
Sbjct: 53 VLRQLRHENIVNLKEAFRRKGRLYLVFEYVERTLLELL 90


>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 2.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2
           (MEKK2) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK2 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK2 also activates ERK1/2, c-Jun N-terminal kinase
           (JNK) and p38 through their respective MAPKKs MEK1/2,
           JNK-activating kinase 2 (JNKK2), and MKK3/6. MEKK2 plays
           roles in T cell receptor signaling, immune synapse
           formation, cytokine gene expression, as well as in EGF
           and FGF receptor signaling.
          Length = 265

 Score = 30.8 bits (69), Expect = 0.017
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1   MMKDCKHHNIIAYYGSYLR---KDKLWICMEYCGGGSLQDIYHTY 42
           ++K+  H  I+ YYG  LR   +  L I ME+  GGS++D   +Y
Sbjct: 57  LLKNLLHERIVQYYG-CLRDPMERTLSIFMEHMPGGSIKDQLKSY 100


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 11.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 11 (Nek11)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek11 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek11 is involved, through direct
           phosphorylation, in regulating the degradation of Cdc25A
           (Cell Division Cycle 25 homolog A), which plays a role
           in cell cycle progression and in activating cyclin
           dependent kinases. Nek11 is activated by CHK1
           (CHeckpoint Kinase 1) and may be involved in the G2/M
           checkpoint. Nek11 may also play a role in the S-phase
           checkpoint as well as in DNA replication and genotoxic
           stress responses.
          Length = 260

 Score = 30.3 bits (68), Expect = 0.020
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 7   HHNIIAYYGSYLRKDKLWICMEYCGGGSL----QDIYHTYKIFP 46
           H  I+ ++ S+L +D   I  EYC G  L    +++ HT K   
Sbjct: 61  HPAIVKFHASFLERDAFCIITEYCEGRDLDCKLEELKHTGKTLS 104


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 7.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek7 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek7 is required for mitotic
          spindle formation and cytokinesis. It is enriched in
          the centrosome and is critical for microtubule
          nucleation. Nek7 is activated by Nek9 during mitosis,
          and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 30.4 bits (68), Expect = 0.020
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          ++K   H N+I YY S++  ++L I +E    G L  +   +K
Sbjct: 55 LLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFK 97


>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like
          Protein Tyrosine Kinases.  Protein Tyrosine Kinase
          (PTK) family; Src kinase subfamily; catalytic (c)
          domain. Src subfamily members include Src, Lck, Hck,
          Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Src (or
          c-Src) proteins are cytoplasmic (or non-receptor) tyr
          kinases which are anchored to the plasma membrane. They
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. They were identified as the first
          proto-oncogene products, and they regulate cell
          adhesion, invasion, and motility in cancer cells and
          tumor vasculature, contributing to cancer progression
          and metastasis. Src kinases are overexpressed in a
          variety of human cancers, making them attractive
          targets for therapy. They are also implicated in acute
          inflammatory responses and osteoclast function. Src,
          Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
          Hck, Fgr, and Lyn show a limited expression pattern.
          Length = 261

 Score = 30.4 bits (69), Expect = 0.021
 Identities = 11/40 (27%), Positives = 19/40 (47%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHT 41
          MK  +H  ++  Y     ++ ++I  EY   GSL D   +
Sbjct: 55 MKKLRHDKLVQLYAVCSEEEPIYIVTEYMSKGSLLDFLKS 94


>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; C-terminal Src kinase (Csk)
          subfamily; catalytic (c) domain. The Csk subfamily is
          composed of Csk, Chk, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Csk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing the Src homology domains, SH3 and
          SH2, N-terminal to the catalytic tyr kinase domain.
          They negatively regulate the activity of Src kinases
          that are anchored to the plasma membrane. To inhibit
          Src kinases, Csk and Chk are translocated to the
          membrane via binding to specific transmembrane
          proteins, G-proteins, or adaptor proteins near the
          membrane. Csk catalyzes the tyr phosphorylation of the
          regulatory C-terminal tail of Src kinases, resulting in
          their inactivation. Chk inhibit Src kinases using a
          noncatalytic mechanism by simply binding to them. As
          negative regulators of Src kinases, Csk and Chk play
          important roles in cell proliferation, survival, and
          differentiation, and consequently, in cancer
          development and progression.
          Length = 256

 Score = 30.1 bits (68), Expect = 0.027
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          M   +H N++   G  L+ + L+I  EY   GSL D
Sbjct: 54 MTTLRHPNLVQLLGVVLQGNPLYIVTEYMAKGSLVD 89


>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
          Serine/Threonine Kinase, Novel Protein Kinase C
          epsilon.  Serine/Threonine Kinases (STKs), Novel
          Protein Kinase C (nPKC), epsilon isoform, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The nPKC subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKCs are classified into
          three groups (classical, atypical, and novel) depending
          on their mode of activation and the structural
          characteristics of their regulatory domain. nPKCs are
          calcium-independent, but require DAG
          (1,2-diacylglycerol) and phosphatidylserine (PS) for
          activity. There are four nPKC isoforms, delta, epsilon,
          eta, and theta. PKC-epsilon has been shown to behave as
          an oncoprotein. Its overexpression contributes to
          neoplastic transformation depending on the cell type.
          It contributes to oncogenesis by inducing disordered
          cell growth and inhibiting cell death. It also plays a
          role in tumor invasion and metastasis. PKC-epsilon has
          also been found to confer cardioprotection against
          ischemia and reperfusion-mediated damage. Other
          cellular functions include the regulation of gene
          expression, cell adhesion, and cell motility.
          Length = 321

 Score = 28.7 bits (64), Expect = 0.069
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          KH  + A +  +  KD+L+  MEY  GG L
Sbjct: 54 KHPFLTALHCCFQTKDRLFFVMEYVNGGDL 83


>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
          Kinases, Tropomyosin Related Kinases.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
          subfamily; catalytic (c) domain. The Trk subfamily
          consists of TrkA, TrkB, TrkC, and similar proteins. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Trk
          subfamily members are receptor tyr kinases (RTKs)
          containing an extracellular region with arrays of
          leucine-rich motifs flanked by two cysteine-rich
          clusters followed by two immunoglobulin-like domains, a
          transmembrane segment, and an intracellular catalytic
          domain. Binding to their ligands, the nerve growth
          factor (NGF) family of neutrotrophins, leads to Trk
          receptor oligomerization and activation of the
          catalytic domain. Trk receptors are mainly expressed in
          the peripheral and central nervous systems. They play
          important roles in cell fate determination, neuronal
          survival and differentiation, as well as in the
          regulation of synaptic plasticity. Altered expression
          of Trk receptors is associated with many human
          diseases.
          Length = 280

 Score = 28.6 bits (64), Expect = 0.075
 Identities = 10/35 (28%), Positives = 17/35 (48%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++ + +H NI+ +YG     D   +  EY   G L
Sbjct: 61 LLTNFQHENIVKFYGVCTEGDPPIMVFEYMEHGDL 95


>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase 1.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, SGK1 isoform, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The SGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three isoforms of
          SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
          expressed and is under transcriptional control of
          numerous stimuli including cell stress (cell
          shrinkage), serum, hormones (gluco- and
          mineralocorticoids), gonadotropins, growth factors,
          interleukin-6, and other cytokines. It plays roles in
          sodium retention and potassium elimination in the
          kidney, nutrient transport, salt sensitivity, memory
          consolidation, and cardiac repolarization. A common
          SGK1 variant is associated with increased blood
          pressure and body weight. SGK1 may also contribute to
          tumor growth, neurodegeneration, fibrosing disease, and
          ischemia.
          Length = 325

 Score = 28.4 bits (63), Expect = 0.086
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          ++K+ KH  ++  + S+   DKL+  ++Y  GG L   YH
Sbjct: 49 LLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGEL--FYH 86


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Phosphoinositide-dependent
          kinase 1.  Serine/Threonine Kinases (STKs),
          Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PDK1 carries an
          N-terminal catalytic domain and a C-terminal pleckstrin
          homology (PH) domain that binds phosphoinositides. It
          phosphorylates the activation loop of AGC kinases that
          are regulated by PI3K such as PKB, SGK, and PKC, among
          others, and is crucial for their activation. Thus, it
          contributes in regulating many processes including
          metabolism, growth, proliferation, and survival. PDK1
          also has the ability to autophosphorylate and is
          constitutively active in mammalian cells. PDK1 is
          essential for normal embryo development and is
          important in regulating cell volume.
          Length = 280

 Score = 28.3 bits (64), Expect = 0.088
 Identities = 10/45 (22%), Positives = 18/45 (40%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIF 45
          + +   H  II  Y ++  ++ L+  +EY   G L      Y   
Sbjct: 55 LTRLNGHPGIIKLYYTFQDEENLYFVLEYAPNGELLQYIRKYGSL 99


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of
          Microtubule-associated serine/threonine kinase-like
          proteins.  Serine/Threonine Kinases (STKs),
          Microtubule-associated serine/threonine (MAST) kinase
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAST kinase subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The MAST kinase subfamily
          includes MAST kinases, MAST-like (MASTL) kinases, and
          fungal kinases with similarity to Saccharomyces
          cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
          MAST kinases contain an N-terminal domain of unknown
          function, a central catalytic domain, and a C-terminal
          PDZ domain that mediates protein-protein interactions.
          MASTL kinases carry only a catalytic domain which
          contains a long insert relative to other kinases. The
          fungal kinases in this subfamily harbor other domains
          in addition to a central catalytic domain, which also
          contains an insert relative to MAST kinases like MASTL.
          Rim15 contains a C-terminal signal receiver (REC)
          domain while cek1 contains an N-terminal PAS domain.
          MAST kinases are cytoskeletal associated kinases of
          unknown function that are also expressed at
          neuromuscular junctions and postsynaptic densities. The
          fungal proteins Rim15 and cek1 are involved in the
          regulation of meiosis and mitosis, respectively.
          Length = 265

 Score = 28.4 bits (64), Expect = 0.089
 Identities = 10/45 (22%), Positives = 18/45 (40%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          +   +   ++  Y S+  K  L++ MEY  GG L  +        
Sbjct: 47 LSQAQSPYVVKLYYSFQGKKNLYLVMEYLPGGDLASLLENVGSLD 91


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein
          Serine/Threonine Kinase, cAMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cAMP-dependent
          protein kinase (PKA) subfamily, catalytic (c) subunit.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The PKA subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          subfamily is composed of the cAMP-dependent proteins
          kinases, PKA and PRKX. The inactive PKA holoenzyme is a
          heterotetramer composed of two phosphorylated and
          active catalytic (C) subunits with a dimer of
          regulatory (R) subunits. Activation is achieved through
          the binding of the important second messenger cAMP to
          the R subunits, which leads to the dissociation of PKA
          into the R dimer and two active C subunits. PKA is
          present ubiquitously in cells and interacts with many
          different downstream targets. It plays a role in the
          regulation of diverse processes such as growth,
          development, memory, metabolism, gene expression,
          immunity, and lipolysis.
          Length = 290

 Score = 28.3 bits (64), Expect = 0.11
 Identities = 11/35 (31%), Positives = 20/35 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          +++  +H  ++  YGS+     L++ MEY  GG L
Sbjct: 54 ILQSIRHPFLVNLYGSFQDDSNLYLVMEYVPGGEL 88


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
          Protein Kinases, MAP kinase kinases 3 and 6.  Protein
          kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
          subfamily, catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The MKK3 and MKK6 subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein serine/threonine kinases, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are
          dual-specificity PKs that phosphorylate and activate
          their downstream target, p38 MAPK, on specific
          threonine and tyrosine residues. MKK3/6 plays roles in
          the regulation of cell cycle progression, cytokine- and
          stress-induced apoptosis, oncogenic transformation, and
          adult tissue regeneration. In addition, MKK6 plays a
          critical role in osteoclast survival in inflammatory
          disease while MKK3 is associated with tumor invasion,
          progression, and poor patient survival in glioma.
          Length = 283

 Score = 28.2 bits (63), Expect = 0.13
 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 4  DCKHHNIIAYYGSYLRKDKLWICME 28
          DC     + +YG+  R+  +WICME
Sbjct: 58 DCP--YTVTFYGALFREGDVWICME 80


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
          Serine/Threonine Kinase, cGMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cGMP-dependent
          protein kinase (cGK or PKG) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The cGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Mammals have two cGK
          isoforms from different genes, cGKI and cGKII. cGKI
          exists as two splice variants, cGKI-alpha and
          cGKI-beta. cGK consists of an N-terminal regulatory
          domain containing a dimerization and an autoinhibitory
          pseudosubstrate region, two cGMP-binding domains, and a
          C-terminal catalytic domain. Binding of cGMP to both
          binding sites releases the inhibition of the catalytic
          center by the pseudosubstrate region, allowing
          autophosphorylation and activation of the kinase. cGKI
          is a  soluble protein expressed in all smooth muscles,
          platelets, cerebellum, and kidney. It is also expressed
          at lower concentrations in other tissues. cGKII is a
          membrane-bound protein that is most abundantly
          expressed in the intestine. It is also present in the
          brain nuclei, adrenal cortex, kidney, lung, and
          prostate. cGKI is involved in the regulation of smooth
          muscle tone, smooth cell proliferation, and platelet
          activation. cGKII plays a role in the regulation of
          secretion, such as renin secretion by the kidney and
          aldosterone secretion by the adrenal. It also regulates
          bone growth and the circadian rhythm.
          Length = 262

 Score = 28.0 bits (63), Expect = 0.13
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          +++C H  I+  Y ++  K  +++ MEYC GG L  I  
Sbjct: 47 LEECNHPFIVKLYRTFKDKKYIYMLMEYCLGGELWTILR 85


>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1
           (MEKK1) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK1 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK1 activates the extracellular
           signal-regulated kinase 1/2 (ERK1/2) and c-Jun
           N-terminal kinase (JNK) pathways by activating their
           respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively.
           MEKK1 is important in regulating cell survival and
           apoptosis. MEKK1 also plays a role in cell migration,
           tissue maintenance and homeostasis, and wound healing.
          Length = 268

 Score = 27.9 bits (62), Expect = 0.14
 Identities = 11/45 (24%), Positives = 19/45 (42%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIF 45
           +M    H +II   G+        + +E+  GGS+  +   Y  F
Sbjct: 56  LMARLNHPHIIRMLGATCEDSHFNLFVEWMAGGSVSHLLSKYGAF 100


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
          Serine/Threonine Kinases (STKs), Pho85 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The Pho85 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Pho85 is a multifunctional
          Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs
          belong to a large family of STKs that are regulated by
          their cognate cyclins. Together, they are involved in
          the control of cell-cycle progression, transcription,
          and neuronal function. Pho85 is regulated by 10
          different cyclins (Pcls) and plays a role in G1
          progression, cell polarity, phosphate and glycogen
          metabolism, gene expression, and in signaling changes
          in the environment. It is not essential for yeast
          viability and is the functional homolog of mammalian
          CDK5, which plays a role in central nervous system
          development.
          Length = 284

 Score = 27.8 bits (62), Expect = 0.17
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYC 30
          +MK+ KH NI+  +     ++KL +  EY 
Sbjct: 51 LMKELKHENIVRLHDVIHTENKLMLVFEYM 80


>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Large Tumor Suppressor 2.
          Serine/Threonine Kinases (STKs), Large Tumor Suppressor
          (LATS) subfamily, LATS2 isoform, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The LATS subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. LATS functions
          as a tumor suppressor and is implicated in cell cycle
          regulation. LATS2 is an essential mitotic regulator
          responsible for coordinating accurate cytokinesis
          completion and governing the stabilization of other
          mitotic regulators. It is also critical in the
          maintenance of proper chromosome number, genomic
          stability, mitotic fidelity, and the integrity of
          centrosome duplication. Downregulation of LATS2 is
          associated with poor prognosis in acute lymphoblastic
          leukemia and breast cancer.
          Length = 381

 Score = 27.7 bits (61), Expect = 0.22
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 10 IIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          ++  Y S+  KD L+  M+Y  GG +  +    ++FP
Sbjct: 63 VVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMEVFP 99


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity
          Protein Kinase, MAP kinase kinase 4.  Protein kinases
          (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic
          (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MKK4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising of the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a
          dual-specificity PK that phosphorylates and activates
          the downstream targets, c-Jun N-terminal kinase (JNK)
          and p38 MAPK, on specific threonine and tyrosine
          residues. JNK and p38 are collectively known as
          stress-activated MAPKs, as they are activated in
          response to a variety of environmental stresses and
          pro-inflammatory cytokines. Their activation is
          associated with the induction of cell death. Mice
          deficient in MKK4 die during embryogenesis and display
          anemia, severe liver hemorrhage, and abnormal
          hepatogenesis. MKK4 may also play roles in the immune
          system and in cardiac hypertrophy. It plays a major
          role in cancer as a tumor and metastasis suppressor.
          Under certain conditions, MKK4 is pro-oncogenic.
          Length = 288

 Score = 27.3 bits (61), Expect = 0.22
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICME 28
          M+      I+ +YG+  R+   WICME
Sbjct: 57 MRSSDCPYIVKFYGALFREGDCWICME 83


>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related
          kinase adapter protein alpha.  Protein Kinase family,
          STE20-related kinase adapter protein (STRAD) alpha
          subfamily, pseudokinase domain. The STRAD alpha
          subfamily is part of a larger superfamily that includes
          the catalytic domains of serine/threonine kinases
          (STKs), protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The pseudokinase domain
          shows similarity to protein kinases but lacks crucial
          residues for catalytic activity. STRAD forms a complex
          with the scaffolding protein MO25, and the STK, LKB1,
          resulting in the activation of the kinase. In the
          complex, LKB1 phosphorylates and activates adenosine
          monophosphate-activated protein kinases (AMPKs), which
          regulate cell energy metabolism and cell polarity. LKB1
          is a tumor suppressor linked to the rare inherited
          disease, Peutz-Jeghers syndrome, which is characterized
          by a predisposition to benign polyps and
          hyperpigmentation of the buccal mucosa. There are two
          forms of STRAD, alpha and beta, that complex with LKB1
          and MO25. The structure of STRAD-alpha is available and
          shows that this protein binds ATP, has an ordered
          activation loop, and adopts a closed conformation
          typical of fully active protein kinases. It does not
          possess activity due to nonconservative substitutions
          of essential catalytic residues. ATP binding enhances
          the affinity of STRAD for MO25.  The conformation of
          STRAD-alpha, stabilized through ATP and MO25, may be
          needed to activate LKB1. A mutation which results in a
          truncation of a C-terminal part of the human
          STRAD-alpha pseudokinase domain and disrupts its
          association with LKB1, leads to PMSE (polyhydramnios,
          megalencephaly, symptomatic epilepsy) syndrome. Several
          splice variants of STRAD-alpha exist which exhibit
          different effects on the localization and activation of
          LKB1.
          Length = 327

 Score = 27.2 bits (60), Expect = 0.23
 Identities = 10/36 (27%), Positives = 21/36 (58%)

Query: 7  HHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTY 42
          H NI+ Y  +++  ++LW+   +   GS +D+  T+
Sbjct: 58 HPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTH 93


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 6.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek6 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek6 is required for the
          transition from metaphase to anaphase. It also plays
          important roles in mitotic spindle formation and
          cytokinesis.  Activated by Nek9 during mitosis, Nek6
          phosphorylates Eg5, a kinesin that is important for
          spindle bipolarity. Nek6 localizes to spindle
          microtubules during metaphase and anaphase, and to the
          midbody during cytokinesis.
          Length = 267

 Score = 27.3 bits (60), Expect = 0.24
 Identities = 12/43 (27%), Positives = 22/43 (51%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          ++K   H N+I Y  S++  ++L I +E    G L  +   +K
Sbjct: 55 LLKQLNHPNVIKYLDSFIEDNELNIVLELADAGDLSQMIKYFK 97


>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine
          Kinase, Lyn.  Protein Tyrosine Kinase (PTK) family; Lyn
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Lyn is a
          member of the Src subfamily of proteins, which are
          cytoplasmic (or non-receptor) tyr kinases. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Lyn is expressed in B lymphocytes
          and myeloid cells. It exhibits both positive and
          negative regulatory roles in B cell receptor (BCR)
          signaling. Lyn, as well as Fyn and Blk, promotes B cell
          activation by phosphorylating ITAMs (immunoreceptor tyr
          activation motifs) in CD19 and in Ig components of BCR.
          It negatively regulates signaling by its unique ability
          to phosphorylate ITIMs (immunoreceptor tyr inhibition
          motifs) in cell surface receptors like CD22 and CD5.
          Lyn also plays an important role in G-CSF receptor
          signaling by phosphorylating a variety of adaptor
          molecules.
          Length = 261

 Score = 27.3 bits (60), Expect = 0.24
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +MK  +H  ++  Y    +++ ++I  EY   GSL D
Sbjct: 54 LMKTLQHDKLVRLYAVVTKEEPIYIITEYMAKGSLLD 90


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinases, Never In Mitosis gene
          A-related kinase 6 and 7.  Serine/Threonine Kinases
          (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
          (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The Nek6/7 subfamily is part of a family of
          11 different Neks (Nek1-11) that are involved in cell
          cycle control. The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Nek6 and Nek7
          are the shortest Neks, consisting only of the catalytic
          domain and a very short N-terminal extension. They show
          distinct expression patterns and both appear to be
          downstream substrates of Nek9. They are required for
          mitotic spindle formation and cytokinesis. They may
          also be regulators of the p70 ribosomal S6 kinase.
          Length = 267

 Score = 27.0 bits (60), Expect = 0.27
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K   H N+I Y  S++  ++L I +E    G L
Sbjct: 55 LLKQLDHPNVIKYLASFIENNELNIVLELADAGDL 89


>gnl|CDD|226965 COG4606, CeuB, ABC-type enterochelin transport system, permease
           component [Inorganic ion transport and metabolism].
          Length = 321

 Score = 27.3 bits (61), Expect = 0.28
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%)

Query: 9   NIIA-YYGSYLRKDKLWICMEYCGGG--SLQDIYHTYKIFP 46
           NI++ Y G  LR++  W+ +   G     L DI     IFP
Sbjct: 254 NIVSLYRGDNLRQNLPWVAL--LGALFVLLCDIIGRVIIFP 292


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Large Tumor Suppressor 1.
          Serine/Threonine Kinases (STKs), Large Tumor Suppressor
          (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The LATS subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. LATS functions
          as a tumor suppressor and is implicated in cell cycle
          regulation. Inactivation of LATS1 in mice results in
          the development of various tumors, including sarcomas
          and ovarian cancer. Promoter methylation, loss of
          heterozygosity, and missense mutations targeting the
          LATS1 gene have also been found in human sarcomas and
          ovarian cancers. In addition, decreased expression of
          LATS1 is associated with an aggressive phenotype and
          poor prognosis. LATS1 induces G2 arrest and promotes
          cytokinesis. It may be a component of the mitotic exit
          network in higher eukaryotes.
          Length = 382

 Score = 27.3 bits (60), Expect = 0.30
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 10 IIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          ++  Y S+  KD L+  M+Y  GG +  +     IFP
Sbjct: 63 VVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFP 99


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
          protein Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase (CDK)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKs are partly regulated by their
          subcellular localization, which defines substrate
          phosphorylation and the resulting specific function.
          CDK1, CDK2, CDK4, and CDK6 have well-defined functions
          in the cell cycle, such as the regulation of the early
          G1 phase by CDK4 or CDK6, the G1/S phase transition by
          CDK2, or the entry of mitosis by CDK1. They also
          exhibit overlapping cyclin specificity and functions in
          certain conditions. Knockout mice with a single CDK
          deleted remain viable with specific phenotypes, showing
          that some CDKs can compensate for each other. For
          example, CDK4 can compensate for the loss of CDK6,
          however, double knockout mice with both CDK4 and CDK6
          deleted die in utero. CDK8 and CDK9 are mainly involved
          in transcription while CDK5 is implicated in neuronal
          function. CDK7 plays essential roles in both the cell
          cycle as a CDK-Activating Kinase (CAK) and in
          transcription as a component of the general
          transcription factor TFIIH.
          Length = 282

 Score = 27.1 bits (61), Expect = 0.30
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 2  MKDCKHHNIIAYYGSYLRKDKLWICMEYC 30
          +K+ KH NI+        + KL++  EYC
Sbjct: 52 LKELKHPNIVKLLDVIHTERKLYLVFEYC 80


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein
          Serine/Threonine Kinase, Protein Kinase C.
          Serine/Threonine Kinases (STKs), Protein Kinase C (PKC)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PKC subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKCs are classified into
          three groups (classical, atypical, and novel) depending
          on their mode of activation and the structural
          characteristics of their regulatory domain. PKCs
          undergo three phosphorylations in order to take mature
          forms. In addition, classical PKCs depend on calcium,
          DAG (1,2-diacylglycerol), and in most cases,
          phosphatidylserine (PS) for activation. Novel PKCs are
          calcium-independent, but require DAG and PS for
          activity, while atypical PKCs only require PS. PKCs
          phosphorylate and modify the activities of a wide
          variety of cellular proteins including receptors,
          enzymes, cytoskeletal proteins, transcription factors,
          and other kinases. They play a central role in signal
          transduction pathways that regulate cell migration and
          polarity, proliferation, differentiation, and
          apoptosis. Also included in this subfamily are the
          PKC-like proteins, called PKNs.
          Length = 318

 Score = 27.0 bits (60), Expect = 0.30
 Identities = 10/27 (37%), Positives = 12/27 (44%)

Query: 20 KDKLWICMEYCGGGSLQDIYHTYKIFP 46
          KD+L+  MEY  GG L         F 
Sbjct: 68 KDRLFFVMEYVNGGDLMFHIQRSGRFD 94


>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein
          Serine/Threonine Kinase, Protein Kinase B.
          Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
          or Akt subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          PKB subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). There are three PKB
          isoforms from different genes, PKB-alpha (or Akt1),
          PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
          contains an N-terminal pleckstrin homology (PH) domain
          and a C-terminal catalytic domain. It is activated
          downstream of PI3K and plays important roles in diverse
          cellular functions including cell survival, growth,
          proliferation, angiogenesis, motility, and migration.
          PKB also has a central role in a variety of human
          cancers, having been implicated in tumor initiation,
          progression, and metastasis.
          Length = 323

 Score = 26.7 bits (59), Expect = 0.39
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++++ +H  + A   S+   D+L   MEY  GG L
Sbjct: 48 VLQNTRHPFLTALKYSFQTHDRLCFVMEYANGGEL 82


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
          Serine/Threonine Kinase, Protein Kinase B gamma.
          Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
          or Akt subfamily, gamma (or Akt3) isoform, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PKB subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three PKB isoforms
          from different genes, PKB-alpha (or Akt1), PKB-beta (or
          Akt2), and PKB-gamma (or Akt3). PKB contains an
          N-terminal pleckstrin homology (PH) domain and a
          C-terminal catalytic domain. PKB-gamma is predominantly
          expressed in neuronal tissues. Mice deficient in
          PKB-gamma show a reduction in brain weight due to the
          decreases in cell size and cell number. PKB-gamma has
          also been shown to be upregulated in estrogen-deficient
          breast cancer cells, androgen-independent prostate
          cancer cells, and primary ovarian tumors. It acts as a
          key mediator in the genesis of ovarian cancer.
          Length = 328

 Score = 26.6 bits (58), Expect = 0.40
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K+ +H  + +   S+  KD+L   MEY  GG L
Sbjct: 48 VLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGEL 82


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
          Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. 
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 1 (CDKL1) and CDKL4 subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL1 and CDKL4
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKL1, also called p42 KKIALRE, is a glial
          protein that is upregulated in gliosis. It is present
          in neuroblastoma and A431 human carcinoma cells, and
          may be implicated in neoplastic transformation. The
          function of CDKL4 is unknown.
          Length = 286

 Score = 26.6 bits (59), Expect = 0.41
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYC 30
          M+K  KH N++     + RK KL +  EYC
Sbjct: 53 MLKQLKHPNLVNLIEVFRRKRKLHLVFEYC 82


>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Fes subfamily; catalytic (c) domain. Fes
          subfamily members include Fes (or Fps), Fer, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Fes subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal
          region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
          domains, followed by a SH2 domain, and a C-terminal
          catalytic domain. The genes for Fes (feline sarcoma)
          and Fps (Fujinami poultry sarcoma) were first isolated
          from tumor-causing retroviruses. The viral oncogenes
          encode chimeric Fes proteins consisting of Gag
          sequences at the N-termini, resulting in unregulated
          tyr kinase activity. Fes and Fer kinases play roles in
          haematopoiesis, inflammation and immunity, growth
          factor signaling, cytoskeletal regulation, cell
          migration and adhesion, and the regulation of cell-cell
          interactions. Fes and Fer show redundancy in their
          biological functions.
          Length = 251

 Score = 26.7 bits (59), Expect = 0.42
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K   H NI+   G  ++K  ++I ME   GGSL
Sbjct: 45 ILKQYDHPNIVKLIGVCVQKQPIYIVMELVPGGSL 79


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
          Serine/Threonine Kinase, Large Tumor Suppressor.
          Serine/Threonine Kinases (STKs), Large Tumor Suppressor
          (LATS) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          LATS subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. LATS was originally
          identified in Drosophila using a screen for genes whose
          inactivation led to overproliferation of cells. In
          tetrapods, there are two LATS isoforms, LATS1 and
          LATS2. Inactivation of LATS1 in mice results in the
          development of various tumors, including sarcomas and
          ovarian cancer. LATS functions as a tumor suppressor
          and is implicated in cell cycle regulation.
          Length = 376

 Score = 26.7 bits (59), Expect = 0.46
 Identities = 11/37 (29%), Positives = 18/37 (48%)

Query: 10 IIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFP 46
          ++  Y S+  KD L+  M+Y  GG +  +     IF 
Sbjct: 63 VVKLYYSFQDKDNLYFVMDYIPGGDMMSLLIRLGIFE 99


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity
          Protein Kinase, MAP kinase kinase 7.  Protein kinases
          (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic
          (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MKK7
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a
          dual-specificity PK that phosphorylates and activates
          its downstream target, c-Jun N-terminal kinase (JNK),
          on specific threonine and tyrosine residues. Although
          MKK7 is capable of dual phosphorylation, it prefers to
          phosphorylate the threonine residue of JNK. Thus,
          optimal activation of JNK requires both MKK4 (not
          included in this subfamily) and MKK7. MKK7 is primarily
          activated by cytokines. MKK7 is essential for liver
          formation during embryogenesis. It plays roles in G2/M
          cell cycle arrest and cell growth. In addition, it is
          involved in the control of programmed cell death, which
          is crucial in oncogenesis, cancer chemoresistance, and
          antagonism to TNFalpha-induced killing, through its
          inhibition by Gadd45beta and the subsequent suppression
          of the JNK cascade.
          Length = 296

 Score = 26.6 bits (59), Expect = 0.50
 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 4  DCKHHNIIAYYGSYLRKDKLWICME 28
          DC +  I+  YG ++    ++ICME
Sbjct: 72 DCPY--IVKCYGYFITDSDVFICME 94


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 5.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 5 (CDK5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK5 is unusual in that it is regulated by
          non-cyclin proteins, p35 and p39. It is highly
          expressed in the nervous system and is critical in
          normal neural development and function. It plays a role
          in neuronal migration and differentiation, and is also
          important in synaptic plasticity and learning. CDK5
          also participates in protecting against cell death and
          promoting angiogenesis. Impaired CDK5 activity is
          implicated in Alzheimer's disease, amyotrophic lateral
          sclerosis, Parkinson's disease, Huntington's disease
          and acute neuronal injury.
          Length = 284

 Score = 26.2 bits (58), Expect = 0.50
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYC 30
          ++K+ KH NI+  Y       KL +  EYC
Sbjct: 52 LLKELKHKNIVRLYDVLHSDKKLTLVFEYC 81


>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase 3.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, SGK3 isoform, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The SGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three isoforms of
          SGK, named SGK1, SGK2, and SGK3 (also called
          cytokine-independent survival kinase CISK). SGK3 is
          expressed in most tissues and is most abundant in the
          embryo and adult heart and spleen. It was originally
          discovered in a screen for antiapoptotic genes. It
          phosphorylates and inhibits the proapoptotic proteins,
          Bad and FKHRL1. SGK3 also regulates many transporters,
          ion channels, and receptors. It plays a critical role
          in hair follicle morphogenesis and hair cycling.
          Length = 325

 Score = 26.5 bits (58), Expect = 0.53
 Identities = 9/35 (25%), Positives = 21/35 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K+ KH  ++  + S+   +KL+  +++  GG L
Sbjct: 49 LLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGEL 83


>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Tyrosine kinase expressed in hepatocellular
          carcinoma (Tec) subfamily; catalytic (c) domain. The
          Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk
          (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tec
          kinases are cytoplasmic (or nonreceptor) tyr kinases
          (nRTKs) with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. In
          addition, some members contain the Tec homology (TH)
          domain, which contains proline-rich and zinc-binding
          regions. Tec kinases form the second largest subfamily
          of nRTKs and are expressed mainly by haematopoietic
          cells, although Tec and Bmx are also found in
          endothelial cells. B-cells express Btk and Tec, while
          T-cells express Itk, Txk, and Tec. Collectively, Tec
          kinases are expressed in a variety of myeloid cells
          such as mast cells, platelets, macrophages, and
          dendritic cells. Each Tec kinase shows a distinct
          cell-type pattern of expression. The function of Tec
          kinases in lymphoid cells have been studied
          extensively. They play important roles in the
          development, differentiation, maturation, regulation,
          survival, and function of B-cells and T-cells.
          Mutations in Btk cause the severe B-cell
          immunodeficiency, X-linked agammaglobulinaemia (XLA).
          Length = 256

 Score = 25.9 bits (57), Expect = 0.74
 Identities = 10/37 (27%), Positives = 18/37 (48%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +M    H N++  YG   ++  ++I  EY   G L +
Sbjct: 52 VMMKLSHPNLVQLYGVCTKQRPIFIVTEYMANGCLLN 88


>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 3.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR3 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Many FGFR3 splice
           variants have been reported with the IIIb and IIIc
           isoforms being the predominant forms. FGFR3 IIIc is the
           isoform expressed in chondrocytes, the cells affected in
           dwarfism, while IIIb is expressed in epithelial cells.
           FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and
           FGF23. It is a negative regulator of long bone growth.
           In the cochlear duct and in the lens, FGFR3 is involved
           in differentiation while it appears to have a role in
           cell proliferation in epithelial cells. Germline
           mutations in FGFR3 are associated with skeletal
           disorders including several forms of dwarfism. Some
           missense mutations are associated with multiple myeloma
           and carcinomas of the bladder and cervix. Overexpression
           of FGFR3 is found in thyroid carcinoma.
          Length = 334

 Score = 26.1 bits (57), Expect = 0.74
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 1   MMKDC-KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
           MMK   KH NII   G+  +   L++ +EY   G+L++
Sbjct: 70  MMKMIGKHKNIINLLGACTQDGPLYVLVEYASKGNLRE 107


>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A
            (vWA) domain [General function prediction only].
          Length = 4600

 Score = 26.1 bits (57), Expect = 0.76
 Identities = 8/16 (50%), Positives = 11/16 (68%)

Query: 10   IIAYYGSYLRKDKLWI 25
            II Y  S  +KDK+W+
Sbjct: 4368 IIPYIASQFKKDKIWM 4383


>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The SGK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. There are three
          isoforms of SGK, named SGK1, SGK2, and SGK3 (also
          called cytokine-independent survival kinase CISK). SGKs
          are activated by insulin and growth factors via
          phosphoinositide 3-kinase and PDK1. They activate ion
          channels, ion carriers, and the Na-K-ATPase, as well as
          regulate the activity of enzymes and transcription
          factors. SGKs play important roles in transport,
          hormone release, neuroexcitability, cell proliferation,
          and apoptosis.
          Length = 323

 Score = 25.9 bits (57), Expect = 0.79
 Identities = 11/35 (31%), Positives = 21/35 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K+ KH  ++  + S+   DKL+  ++Y  GG L
Sbjct: 49 LLKNVKHPFLVGLHYSFQTADKLYFVLDYVNGGEL 83


>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine
          Kinase, Fes.  Protein Tyrosine Kinase (PTK) family; Fes
          (or Fps) kinase subfamily; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fes
          subfamily proteins are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal region with FCH
          (Fes/Fer/CIP4 homology) and coiled-coil domains,
          followed by a SH2 domain, and a C-terminal catalytic
          domain. The genes for Fes (feline sarcoma) and Fps
          (Fujinami poultry sarcoma) were first isolated from
          tumor-causing retroviruses. The viral oncogenes encode
          chimeric Fes proteins consisting of Gag sequences at
          the N-termini, resulting in unregulated tyr kinase
          activity. Fes kinase is expressed in myeloid, vascular
          endothelial, epithelial, and neuronal cells. It plays
          important roles in cell growth and differentiation,
          angiogenesis, inflammation and immunity, and
          cytoskeletal regulation. A recent study implicates Fes
          kinase as a tumor suppressor in colorectal cancer.
          Length = 252

 Score = 25.7 bits (56), Expect = 0.82
 Identities = 12/41 (29%), Positives = 18/41 (43%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHT 41
          ++K   H NI+   G   +K  ++I ME   GG       T
Sbjct: 46 ILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRT 86


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 25.9 bits (57), Expect = 0.85
 Identities = 8/36 (22%), Positives = 21/36 (58%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQ 36
           +++D  H N++  +  +    ++ + +E+  GGSL+
Sbjct: 125 ILRDVNHPNVVKCHDMFDHNGEIQVLLEFMDGGSLE 160


>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor beta.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) beta; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           beta is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR beta forms homodimers or heterodimers
           with PDGFR alpha, depending on the nature of the PDGF
           ligand. PDGF-BB and PDGF-DD induce PDGFR beta
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           beta signaling leads to a variety of cellular effects
           including the stimulation of cell growth and chemotaxis,
           as well as the inhibition of apoptosis and GAP
           junctional communication. It is critical in normal
           angiogenesis as it is involved in the recruitment of
           pericytes and smooth muscle cells essential for vessel
           stability. Aberrant PDGFR beta expression is associated
           with some human cancers. The continuously-active fusion
           proteins of PDGFR beta with COL1A1 and TEL are
           associated with dermatofibrosarcoma protuberans (DFSP)
           and a subset of chronic myelomonocytic leukemia (CMML),
           respectively.
          Length = 401

 Score = 25.7 bits (56), Expect = 1.0
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 7   HHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           H NI+   G+  +   ++I  EYC  G L D  H  K
Sbjct: 100 HLNIVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNK 136


>gnl|CDD|238737 cd01460, vWA_midasin, VWA_Midasin: Midasin is a member of the AAA
          ATPase family. The proteins of this family are unified
          by their common archetectural organization that is
          based upon a conserved ATPase domain. The AAA domain of
          midasin contains six tandem AAA protomers. The AAA
          domains in midasin is followed by a D/E rich domain
          that is following by a VWA domain. The members of this
          subgroup have a conserved MIDAS motif. The function of
          this domain is not exactly known although it has been
          speculated to play a crucial role in midasin function.
          Length = 266

 Score = 25.4 bits (56), Expect = 1.0
 Identities = 9/15 (60%), Positives = 10/15 (66%)

Query: 10 IIAYYGSYLRKDKLW 24
          II Y  S  RKDK+W
Sbjct: 36 IIPYIASQFRKDKIW 50


>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 1.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR1 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Alternative splicing of
           FGFR1 transcripts produces a variety of isoforms, which
           are differentially expressed in cells. FGFR1 binds the
           ligands, FGF1 and FGF2, with high affinity and has also
           been reported to bind FGF4, FGF6, and FGF9. FGFR1
           signaling is critical in the control of cell migration
           during embryo development. It promotes cell
           proliferation in fibroblasts. Nuclear FGFR1 plays a role
           in the regulation of transcription. Mutations,
           insertions or deletions of FGFR1 have been identified in
           patients with Kallman's syndrome (KS), an inherited
           disorder characterized by hypogonadotropic hypogonadism
           and loss of olfaction. Aberrant FGFR1 expression has
           been found in some human cancers including 8P11
           myeloproliferative syndrome (EMS), breast cancer, and
           pancreatic adenocarcinoma.
          Length = 307

 Score = 25.4 bits (55), Expect = 1.1
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 1   MMKDC-KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
           MMK   KH NII   G+  +   L++ +EY   G+L++
Sbjct: 76  MMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLRE 113


>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 2.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR2 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. There are many splice
           variants of FGFR2 which show differential expression and
           binding to FGF ligands. Disruption of either FGFR2 or
           FGFR2b is lethal in mice, due to defects in the placenta
           or severe impairment of tissue development including
           lung, limb, and thyroid, respectively. Disruption of
           FGFR2c in mice results in defective bone and skull
           development. Genetic alterations of FGFR2 are associated
           with many human skeletal disorders including Apert
           syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and
           Pfeiffer syndrome.
          Length = 304

 Score = 25.4 bits (55), Expect = 1.1
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 1   MMKDC-KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
           MMK   KH NII   G+  +   L++ +EY   G+L++
Sbjct: 73  MMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLRE 110


>gnl|CDD|221367 pfam11997, DUF3492, Domain of unknown function (DUF3492).  This
           presumed domain is functionally uncharacterized. This
           domain is found in bacteria, archaea and eukaryotes.
           This domain is typically between 259 to 282 amino acids
           in length. This domain is found associated with
           pfam00534. This domain has two conserved sequence
           motifs: GGVS and EHGIY.
          Length = 268

 Score = 25.3 bits (56), Expect = 1.2
 Identities = 9/29 (31%), Positives = 12/29 (41%), Gaps = 2/29 (6%)

Query: 23  LWICMEYCGGGSLQDIYHTYKIF--PLLK 49
                EYC   S  D + T +    PLL+
Sbjct: 136 TEQYREYCTDPSFVDYFWTVRNMHLPLLQ 164


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), AGC (Protein Kinases A, G and C) family,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The AGC family is part
          of a larger superfamily that includes the catalytic
          domains of other protein STKs, protein tyrosine
          kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          Phosphoinositide 3-Kinase (PI3K). Members of this
          family include cAMP-dependent Protein Kinase (PKA),
          cGMP-dependent Protein Kinase (PKG), Protein Kinase C
          (PKC), Protein Kinase B (PKB), G protein-coupled
          Receptor Kinase (GRK), Serum- and
          Glucocorticoid-induced Kinase (SGK), and 70 kDa
          ribosomal Protein S6 Kinase (p70S6K or S6K), among
          others. AGC kinases share an activation mechanism based
          on the phosphorylation of up to three sites: the
          activation loop (A-loop), the hydrophobic motif (HM)
          and the turn motif. Phosphorylation at the A-loop is
          required of most AGC kinases, which results in a
          disorder-to-order transition of the A-loop. The ordered
          conformation results in the access of substrates and
          ATP to the active site. A subset of AGC kinases with
          C-terminal extensions containing the HM also requires
          phosphorylation at this site. Phosphorylation at the HM
          allows the C-terminal extension to form an ordered
          structure that packs into the hydrophobic pocket of the
          catalytic domain, which then reconfigures the kinase
          into an active bi-lobed state. In addition, growth
          factor-activated AGC kinases such as PKB, p70S6K, RSK,
          MSK, PKC, and SGK, require phosphorylation at the turn
          motif (also called tail or zipper site), located
          N-terminal to the HM at the C-terminal extension. AGC
          kinases regulate many cellular processes including
          division, growth, survival, metabolism, motility, and
          differentiation. Many are implicated in the development
          of various human diseases.
          Length = 250

 Score = 25.2 bits (56), Expect = 1.3
 Identities = 11/47 (23%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFPL 47
          ++    H  I+  + ++  ++KL++ +EY  GG L    H  K    
Sbjct: 46 ILSRINHPFIVKLHYAFQTEEKLYLVLEYAPGGEL--FSHLSKEGRF 90


>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein
          Serine/Threonine Kinase, Serum- and
          Glucocorticoid-induced Kinase 2.  Serine/Threonine
          Kinases (STKs), Serum- and Glucocorticoid-induced
          Kinase (SGK) subfamily, SGK2 isoform, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The SGK subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three isoforms of
          SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more
          restricted distribution that SGK1 and is most
          abundantly expressed in epithelial tissues including
          kidney, liver, pancreas, and the choroid plexus of the
          brain. In vitro cellular assays show that SGK2 can
          stimulate the activity of ion channels, the glutamate
          transporter EEAT4, and the glutamate receptors, GluR6
          and GLUR1.
          Length = 321

 Score = 25.3 bits (55), Expect = 1.3
 Identities = 10/35 (28%), Positives = 21/35 (60%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++K+ KH  ++  + S+   +KL+  ++Y  GG L
Sbjct: 49 LLKNLKHPFLVGLHYSFQTAEKLYFVLDYVNGGEL 83


>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine-like kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST-like (MASTL) kinases, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAST kinases contain an N-terminal domain of
           unknown function, a central catalytic domain, and a
           C-terminal PDZ domain that mediates protein-protein
           interactions. The MASTL kinases in this group carry only
           a catalytic domain, which contains a long insertion
           relative to MAST kinases. The human MASTL gene has also
           been labelled FLJ14813. A missense mutation in FLJ14813
           is associated with autosomal dominant thrombocytopenia.
           To date, the function of MASTL is unknown.
          Length = 669

 Score = 25.2 bits (55), Expect = 1.3
 Identities = 11/36 (30%), Positives = 19/36 (52%)

Query: 10  IIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIF 45
           I+  Y S    + +++ MEY  GG ++ + H Y  F
Sbjct: 66  IVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYF 101


>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine
          Kinase, REarranged during Transfection protein.
          Protein Tyrosine Kinase (PTK) family; RET (REarranged
          during Transfection) protein; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. RET is a
          receptor tyr kinase (RTK) containing an extracellular
          region with four cadherin-like repeats, a
          calcium-binding site, and a cysteine-rich domain, a
          transmembrane segment, and an intracellular catalytic
          domain. It is part of a multisubunit complex that binds
          glial-derived neurotropic factor (GDNF) family ligands
          (GFLs) including GDNF, neurturin, artemin, and
          persephin. GFLs bind RET along with four GPI-anchored
          coreceptors, bringing two RET molecules together,
          leading to autophosphorylation, activation, and
          intracellular signaling. RET is essential for the
          development of the sympathetic, parasympathetic and
          enteric nervous systems, and the kidney. RET disruption
          by germline mutations causes diseases in humans
          including congenital aganglionosis of the
          gastrointestinal tract (Hirschsprung's disease) and
          three related inherited cancers: multiple endocrine
          neoplasia type 2A (MEN2A), MEN2B, and familial
          medullary thyroid carcinoma (FMTC).
          Length = 290

 Score = 25.3 bits (55), Expect = 1.4
 Identities = 11/36 (30%), Positives = 20/36 (55%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQ 36
          ++K   H ++I  YG+  +   L + +EY   GSL+
Sbjct: 56 LLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLR 91


>gnl|CDD|219383 pfam07348, Syd, Syd protein (SUKH-2).  This family contains a
          number of bacterial Syd proteins approximately 180
          residues long. It has been suggested that Syd is
          loosely associated with the cytoplasmic surface of the
          cytoplasmic membrane, and that interaction with SecY
          may be involved in this membrane association. Operon
          analysis showed that Syd protein may function as
          immunity protein in bacterial toxin systems.
          Length = 176

 Score = 25.2 bits (56), Expect = 1.4
 Identities = 7/11 (63%), Positives = 9/11 (81%)

Query: 7  HHNIIAYYGSY 17
          H +I A+YGSY
Sbjct: 71 HPDIKAFYGSY 81


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
          Protein Serine/Threonine Kinases.  Serine/Threonine
          Kinases (STKs), Microtubule-associated serine/threonine
          (MAST) kinase subfamily, fungal Rim15-like kinases,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAST kinase
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this group
          include Saccharomyces cerevisiae Rim15,
          Schizosaccharomyces pombe cek1, and similar fungal
          proteins. They contain a central catalytic domain,
          which contains an insert relative to MAST kinases. In
          addition, Rim15 contains a C-terminal signal receiver
          (REC) domain while cek1 contains an N-terminal PAS
          domain. Rim15 (or Rim15p) functions as a regulator of
          meiosis. It acts as a downstream effector of PKA and
          regulates entry into stationary phase (G0). Thus, it
          plays a crucial role in regulating yeast proliferation,
          differentiation, and aging. Cek1 may facilitate
          progression of mitotic anaphase.
          Length = 260

 Score = 25.1 bits (55), Expect = 1.6
 Identities = 14/47 (29%), Positives = 20/47 (42%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYKIFPL 47
          MM   +   +   Y S+  KD L++ MEY  GG    +  T    P 
Sbjct: 50 MMIQGESPYVAKLYYSFQSKDYLYLVMEYLNGGDCASLIKTLGGLPE 96


>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine
          Kinase, Abelson kinase.  Protein Tyrosine Kinase (PTK)
          family; Abelson (Abl) kinase; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Abl (or
          c-Abl) is a ubiquitously-expressed cytoplasmic (or
          nonreceptor) tyr kinase that contains SH3, SH2, and tyr
          kinase domains in its N-terminal region, as well as
          nuclear localization motifs, a putative DNA-binding
          domain, and F- and G-actin binding domains in its
          C-terminal tail. It also contains a short
          autoinhibitory cap region in its N-terminus. Abl is
          normally inactive and requires phosphorylation and
          myristoylation for activation. Abl function depends on
          its subcellular localization. In the cytoplasm, Abl
          plays a role in cell proliferation and survival. In
          response to DNA damage or oxidative stress, Abl is
          transported to the nucleus where it induces apoptosis.
          In chronic myelogenous leukemia (CML) patients, an
          aberrant translocation results in the replacement of
          the first exon of Abl with the BCR (breakpoint cluster
          region) gene. The resulting BCR-Abl fusion protein is
          constitutively active and associates into tetramers,
          resulting in a hyperactive kinase sending a continuous
          signal. This leads to uncontrolled proliferation,
          morphological transformation and anti-apoptotic
          effects. BCR-Abl is the target of selective inhibitors,
          such as imatinib (Gleevec), used in the treatment of
          CML. Abl2, also known as ARG (Abelson-related gene), is
          thought to play a cooperative role with Abl in the
          proper development of the nervous system. The Tel-ARG
          fusion protein, resulting from reciprocal translocation
          between chromosomes 1 and 12, is associated with acute
          myeloid leukemia (AML). The TEL gene is a frequent
          fusion partner of other tyr kinase oncogenes, including
          Tel/Abl, Tel/PDGFRbeta, and Tel/Jak2, found in patients
          with leukemia and myeloproliferative disorders.
          Length = 263

 Score = 24.8 bits (54), Expect = 1.8
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +MK+ KH N++   G   R+   +I  E+   G+L D
Sbjct: 55 VMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLD 91


>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 4.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR4 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Unlike other FGFRs,
           there is only one splice form of FGFR4. It binds FGF1,
           FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
           ligand for FGFR4. Although disruption of FGFR4 in mice
           causes no obvious phenotype, in vivo inhibition of FGFR4
           in cultured skeletal muscle cells resulted in an arrest
           of muscle progenitor differentiation. FGF6 and FGFR4 are
           uniquely expressed in myofibers and satellite cells.
           FGF6/FGFR4 signaling appears to play a key role in the
           regulation of muscle regeneration. A polymorphism in
           FGFR4 is found in head and neck squamous cell carcinoma.
          Length = 314

 Score = 24.9 bits (54), Expect = 2.1
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 6   KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
           KH NII   G   ++  L++ +EY   G+L++
Sbjct: 76  KHKNIINLLGVCTQEGPLYVIVEYAAKGNLRE 107


>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
          Serine/Threonine Kinase, Protein Kinase B alpha.
          Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
          or Akt subfamily, alpha (or Akt1) isoform, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PKB subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. There are three PKB isoforms
          from different genes, PKB-alpha (or Akt1), PKB-beta (or
          Akt2), and PKB-gamma (or Akt3). PKB contains an
          N-terminal pleckstrin homology (PH) domain and a
          C-terminal catalytic domain. PKB-alpha is predominantly
          expressed in endothelial cells. It is critical for the
          regulation of angiogenesis and the maintenance of
          vascular integrity. It also plays a role in adipocyte
          differentiation. Mice deficient in PKB-alpha exhibit
          perinatal morbidity, growth retardation, reduction in
          body weight accompanied by reduced sizes of multiple
          organs, and enhanced apoptosis in some cell types.
          PKB-alpha activity has been reported to be frequently
          elevated in breast and prostate cancers. In some cancer
          cells, PKB-alpha may act as a suppressor of metastasis.
          Length = 325

 Score = 24.6 bits (53), Expect = 2.1
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++++ +H  + A   S+   D+L   MEY  GG L
Sbjct: 48 VLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGEL 82


>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
          Kinase, Tropomyosin Related Kinase B.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase B
          (TrkB); catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. TrkB is
          a member of the Trk subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          region with arrays of leucine-rich motifs flanked by
          two cysteine-rich clusters followed by two
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. Binding of TrkB
          to its ligands, brain-derived neurotrophic factor
          (BDNF) or neurotrophin 4 (NT4), results in receptor
          oligomerization and activation of the catalytic domain.
          TrkB is broadly expressed in the nervous system and in
          some non-neural tissues. It plays important roles in
          cell proliferation, differentiation, and survival.
          BDNF/Trk signaling plays a key role in regulating
          activity-dependent synaptic plasticity. TrkB also
          contributes to protection against gp120-induced
          neuronal cell death. TrkB overexpression is associated
          with poor prognosis in neuroblastoma (NB) and other
          human cancers. It acts as a suppressor of anoikis
          (detachment-induced apoptosis) and contributes to tumor
          metastasis.
          Length = 288

 Score = 24.6 bits (53), Expect = 2.3
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          ++ + +H +I+ +YG  +  D L +  EY   G L
Sbjct: 60 LLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDL 94


>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
          Kinase, C-ros.  Protein Tyrosine Kinases (PTK) family;
          C-ros and Drosophila Sevenless proteins; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. The
          proto-oncogene c-ros encodes an orphan receptor tyr
          kinase (RTK) with an unknown ligand. RTKs contain an
          extracellular ligand-binding domain, a transmembrane
          region, and an intracellular tyr kinase domain. RTKs
          are usually activated through ligand binding, which
          causes dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. C-ros is
          expressed in embryonic cells of the kidney, intestine
          and lung, but disappears soon after birth. It persists
          only in the adult epididymis. Male mice bearing
          inactive mutations of c-ros lack the initial segment of
          the epididymis and are infertile. The Drosophila
          protein, Sevenless, is required for the specification
          of the R7 photoreceptor cell during eye development.
          Length = 269

 Score = 24.4 bits (53), Expect = 2.4
 Identities = 12/35 (34%), Positives = 17/35 (48%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          +M +  H NI+   G  L  +  +I ME   GG L
Sbjct: 52 LMSNFNHPNIVKLLGVCLLNEPQYIIMELMEGGDL 86


>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; Human Fyn-related kinase (Frk) and
          similar proteins; catalytic (c) domain. The PTKc family
          is part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Frk and
          Srk are members of the Src subfamily of proteins, which
          are cytoplasmic (or non-receptor) tyr kinases. Src
          kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Frk, also known as Rak, is
          specifically expressed in liver, lung, kidney,
          intestine, mammary glands, and the islets of
          Langerhans. Rodent homologs were previously referred to
          as GTK (gastrointestinal tyr kinase), BSK (beta-cell
          Src-like kinase), or IYK (intestinal tyr kinase).
          Studies in mice reveal that Frk is not essential for
          viability. It plays a role in the signaling that leads
          to cytokine-induced beta-cell death in Type I diabetes.
          It also regulates beta-cell number during embryogenesis
          and early in life.
          Length = 261

 Score = 24.3 bits (53), Expect = 2.5
 Identities = 10/37 (27%), Positives = 18/37 (48%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +MK  +H  +I  Y     ++ ++I  E    GSL +
Sbjct: 54 IMKKLRHPKLIQLYAVCTLEEPIYIVTELMKYGSLLE 90


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
           Provisional.
          Length = 329

 Score = 24.4 bits (53), Expect = 2.5
 Identities = 7/35 (20%), Positives = 19/35 (54%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
           ++ +  H  I+    S+  +++++  +E+  GG L
Sbjct: 71  ILMELSHPFIVNMMCSFQDENRVYFLLEFVVGGEL 105


>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase,
           Focal Adhesion Kinase.  Protein Tyrosine Kinase (PTK)
           family; Focal Adhesion Kinase (FAK); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FAK is a
           cytoplasmic (or nonreceptor) tyr kinase that contains an
           autophosphorylation site and a FERM domain at the
           N-terminus, a central tyr kinase domain, proline-rich
           regions, and a C-terminal FAT (focal adhesion targeting)
           domain. FAK activity is dependent on integrin-mediated
           cell adhesion, which facilitates N-terminal
           autophosphorylation. Full activation is achieved by the
           phosphorylation of its two adjacent A-loop tyrosines.
           FAK is important in mediating signaling initiated at
           sites of cell adhesions and at growth factor receptors.
           Through diverse molecular interactions, FAK functions as
           a biosensor or integrator to control cell motility. It
           is a key regulator of cell survival, proliferation,
           migration and invasion, and thus plays an important role
           in the development and progression of cancer. Src binds
           to autophosphorylated FAK forming the FAK-Src dual
           kinase complex, which is activated in a wide variety of
           tumor cells and generates signals promoting growth and
           metastasis. FAK is being developed as a target for
           cancer therapy.
          Length = 270

 Score = 24.3 bits (53), Expect = 2.5
 Identities = 11/43 (25%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 1   MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
           +M+   H +I+   G  + ++ +WI ME    G L+      K
Sbjct: 60  IMRQFDHPHIVKLIG-VITENPVWIVMELAPLGELRSYLQVNK 101


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase Like 5.
          Serine/Threonine Kinases (STKs), Cyclin-dependent
          protein kinase like 5 (CDKL5) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDKL5 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. Mutations in the gene encoding CDKL5,
          previously called STK9, are associated with early onset
          epilepsy and severe mental retardation [X-linked
          infantile spasm syndrome (ISSX) or West syndrome]. In
          addition, CDKL5 mutations also sometimes cause a
          phenotype similar to Rett syndrome (RTT), a progressive
          neurodevelopmental disorder. These pathogenic mutations
          are located in the N-terminal portion of the protein
          within the kinase domain.
          Length = 287

 Score = 24.6 bits (53), Expect = 2.7
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEY 29
          M++  K  NI+    ++ R+ KL++  EY
Sbjct: 53 MLRTLKQENIVELKEAFRRRGKLYLVFEY 81


>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
          Kinases, Receptor tyrosine kinase-like Orphan
          Receptors.  Protein Tyrosine Kinase (PTK) family;
          Receptor tyrosine kinase-like Orphan Receptor (Ror)
          subfamily; catalytic (c) domain. The Ror subfamily
          consists of Ror1, Ror2, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Ror
          proteins are orphan receptor tyr kinases (RTKs)
          containing an extracellular region with
          immunoglobulin-like, cysteine-rich, and kringle
          domains, a transmembrane segment, and an intracellular
          catalytic domain. Ror RTKs are unrelated to the nuclear
          receptor subfamily called retinoid-related orphan
          receptors (RORs). RTKs are usually activated through
          ligand binding, which causes dimerization and
          autophosphorylation of the intracellular tyr kinase
          catalytic domain. Ror kinases are expressed in many
          tissues during development. They play important roles
          in bone and heart formation. Mutations in human Ror2
          result in two different bone development genetic
          disorders, recessive Robinow syndrome and brachydactyly
          type B. Drosophila Ror is expressed only in the
          developing nervous system during neurite outgrowth and
          neuronal differentiation, suggesting a role for
          Drosophila Ror in neural development. More recently,
          mouse Ror1 and Ror2 have also been found to play an
          important role in regulating neurite growth in central
          neurons. Ror1 and Ror2 are believed to have some
          overlapping and redundant functions.
          Length = 283

 Score = 24.3 bits (53), Expect = 2.8
 Identities = 10/37 (27%), Positives = 17/37 (45%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQD 37
          +M D +H NI+   G   ++    +  EY   G L +
Sbjct: 61 LMSDLQHPNIVCLLGVCTKEQPTCMLFEYLAHGDLHE 97


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 24.2 bits (53), Expect = 2.8
 Identities = 10/40 (25%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 1  MMKDCKHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          ++K+  H NII     +  K  L++  E+       D+Y 
Sbjct: 51 LLKELNHPNIIKLLDVFRHKGDLYLVFEFM----DTDLYK 86


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
          Serine/Threonine Kinase, Classical Protein Kinase C.
          Serine/Threonine Kinases (STKs), Classical (or
          Conventional) Protein Kinase C (cPKC) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The cPKC subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PKCs are classified
          into three groups (classical, atypical, and novel)
          depending on their mode of activation and the
          structural characteristics of their regulatory domain.
          PKCs undergo three phosphorylations in order to take
          mature forms. In addition, cPKCs depend on calcium, DAG
          (1,2-diacylglycerol), and in most cases,
          phosphatidylserine (PS) for activation. cPKCs contain a
          calcium-binding C2 region in their regulatory domain.
          There are four cPKC isoforms, named alpha, betaI,
          betaII, and gamma. cPKCs are potent kinases for
          histones, myelin basic protein, and protamine.
          PKC-gamma is mainly expressed in neuronal tissues. It
          plays a role in protection from ischemia.
          Length = 324

 Score = 24.4 bits (53), Expect = 2.8
 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 2/35 (5%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYH 40
          K   +   +  +   D+L+  MEY  GG L  +YH
Sbjct: 59 KPPFLTQLHSCFQTMDRLYFVMEYVNGGDL--MYH 91


>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Ephrin Receptor (EphR) subfamily; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). They can be classified into two classes (EphA
          and EphB), according to their extracellular sequences,
          which largely correspond to binding preferences for
          either GPI-anchored ephrin-A ligands or transmembrane
          ephrin-B ligands. Vertebrates have ten EphA and six
          EhpB receptors, which display promiscuous ligand
          interactions within each class. EphRs contain an ephrin
          binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. This allows
          ephrin/EphR dimers to form, leading to the activation
          of the intracellular tyr kinase domain. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). The main
          effect of ephrin/EphR interaction is cell-cell
          repulsion or adhesion. Ephrin/EphR signaling is
          important in neural development and plasticity, cell
          morphogenesis and proliferation, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 24.2 bits (53), Expect = 2.8
 Identities = 11/29 (37%), Positives = 13/29 (44%)

Query: 7  HHNIIAYYGSYLRKDKLWICMEYCGGGSL 35
          H NII   G   +   + I  EY   GSL
Sbjct: 64 HPNIIRLEGVVTKSRPVMIITEYMENGSL 92


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
          Phototropin-like Protein Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Phototropin-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          phototropin-like subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Included in this
          subfamily are plant phototropins and predominantly
          uncharacterized fungal STKs whose catalytic domains
          resemble the phototropin kinase domain. One protein
          from Neurospora crassa is called nrc-2. Phototropins
          are blue-light receptors that control responses such as
          phototropism, stromatal opening, and chloroplast
          movement in order to optimize the photosynthetic
          efficiency of plants. They are light-activated STKs
          that contain an N-terminal photosensory domain and a
          C-terminal catalytic domain. The N-terminal domain
          contains two LOV (Light, Oxygen or Voltage) domains
          that binds FMN. Photoexcitation of the LOV domains
          results in autophosphorylation at multiple sites and
          activation of the catalytic domain. Neurospora crassa
          nrc-2 plays a role in growth and development by
          controlling entry into the conidiation program.
          Length = 316

 Score = 24.2 bits (53), Expect = 3.3
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 14 YGSYLRKDKLWICMEYCGGGSL 35
          Y S+  +  L + M+YC GG L
Sbjct: 67 YASFQTETYLCLVMDYCPGGEL 88


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
          Serine/Threonine Kinase, Classical Protein Kinase C
          alpha.  Serine/Threonine Kinases (STKs), Classical
          Protein Kinase C (cPKC) subfamily, alpha isoform,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The cPKC subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. PKCs are classified into
          three groups (classical, atypical, and novel) depending
          on their mode of activation and the structural
          characteristics of their regulatory domain. PKCs
          undergo three phosphorylations in order to take mature
          forms. In addition, cPKCs depend on calcium, DAG
          (1,2-diacylglycerol), and in most cases,
          phosphatidylserine (PS) for activation. There are four
          cPKC isoforms, named alpha, betaI, betaII, and gamma.
          PKC-alpha is expressed in many tissues and is
          associated with cell proliferation, apoptosis, and cell
          motility. It plays a role in the signaling of the
          growth factors PDGF, VEGF, EGF, and FGF. Abnormal
          levels of PKC-alpha have been detected in many
          transformed cell lines and several human tumors. In
          addition, PKC-alpha is required for HER2 dependent
          breast cancer invasion.
          Length = 323

 Score = 24.2 bits (52), Expect = 3.6
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 2/24 (8%)

Query: 21 DKLWICMEYCGGGSLQDIYHTYKI 44
          D+L+  MEY  GG L  +YH  ++
Sbjct: 74 DRLYFVMEYVNGGDL--MYHIQQV 95


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
          cell-Associated Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Male germ
          cell-Associated Kinase (MAK)-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of human MAK and MAK-related kinase (MRK),
          Saccharomyces cerevisiae Ime2p, Schizosaccharomyces
          pombe Mei4-dependent protein 3 (Mde3) and Pit1,
          Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK,
          and similar proteins. These proteins play important
          roles during meiosis. MAK is highly expressed in
          testicular cells specifically in the meiotic phase, but
          is not essential for spermatogenesis and fertility. It
          functions as a coactivator of the androgen receptor in
          prostate cells. MRK, also called Intestinal Cell Kinase
          (ICK), is expressed ubiquitously, with highest
          expression in the ovary and uterus. A missense mutation
          in MRK causes endocrine-cerebro-osteodysplasia (ECO),
          suggesting that this protein plays an important role in
          the development of many organs. MAK and MRK may be
          involved in regulating cell cycle and cell fate. Ime2p
          is a meiosis-specific kinase that is important during
          meiotic initiation and during the later stages of
          meiosis. Mde3 functions downstream of the transcription
          factor Mei-4 which is essential for meiotic prophase I.
          Length = 283

 Score = 24.0 bits (53), Expect = 3.8
 Identities = 10/38 (26%), Positives = 17/38 (44%), Gaps = 4/38 (10%)

Query: 6  KHHNIIAYYGSYLRKDKLWICMEYCGGGSLQDIYHTYK 43
          +H NI+     +   D+L+   EY  G    ++Y   K
Sbjct: 56 EHPNIVKLKEVFRENDELYFVFEYMEG----NLYQLMK 89


>gnl|CDD|212041 cd10333, LeuT-like_sbd, Aquifex aeolicus LeuT and related proteins;
           solute binding domain.  LeuT is a bacterial amino acid
           transporter with specificity for the hydrophobic amino
           acids glycine, alanine, methionine, and leucine. This
           subgroup belongs to the solute carrier 6 (SLC6)
           transporter family; LeuT has been used as a structural
           template for understanding fundamental aspects of SLC6
           function. It has an arrangement of 12 transmembrane
           helices (TMs), which appears to be a common motif for
           eukaryotic and some prokaryotic and archaeal SLC6s: an
           inverted topology repeat: TMs1-5 and TMs6-10, and
           TMs11-12.
          Length = 500

 Score = 23.8 bits (52), Expect = 4.0
 Identities = 9/12 (75%), Positives = 9/12 (75%)

Query: 10  IIAYYGSYLRKD 21
           II  Y SYLRKD
Sbjct: 243 IIINYASYLRKD 254


>gnl|CDD|223072 PHA03393, odv-e66, occlusion-derived virus envelope protein E66;
           Provisional.
          Length = 682

 Score = 23.7 bits (52), Expect = 4.8
 Identities = 6/11 (54%), Positives = 6/11 (54%)

Query: 5   CKHHNIIAYYG 15
            KHHNI  Y  
Sbjct: 526 AKHHNITNYKN 536


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the
          Protein Tyrosine Kinases, Janus kinases.  Protein
          Tyrosine Kinase (PTK) family; Janus kinase (Jak)
          subfamily; catalytic (c) domain (repeat 2). The Jak
          subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Jak subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal FERM
          domain, followed by a Src homology 2 (SH2) domain, a
          pseudokinase domain, and a C-terminal tyr kinase
          catalytic domain. Most Jaks are expressed in a wide
          variety of tissues, except for Jak3, which is expressed
          only in hematopoietic cells. Jaks are crucial for
          cytokine receptor signaling. They are activated by
          autophosphorylation upon cytokine-induced receptor
          aggregation, and subsequently trigger downstream
          signaling events such as the phosphorylation of signal
          transducers and activators of transcription (STATs).
          Jaks are also involved in regulating the surface
          expression of some cytokine receptors. The Jak-STAT
          pathway is involved in many biological processes
          including hematopoiesis, immunoregulation, host
          defense, fertility, lactation, growth, and
          embryogenesis.
          Length = 284

 Score = 23.1 bits (50), Expect = 8.7
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 2  MKDCKHHNIIAYYG-SYLRKDK-LWICMEYCGGGSLQD 37
          ++   H NI+ Y G       + L + MEY   GSL+D
Sbjct: 60 LRTLDHENIVKYKGVCEKPGGRSLRLIMEYLPSGSLRD 97


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.329    0.146    0.501 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,567,723
Number of extensions: 156062
Number of successful extensions: 363
Number of sequences better than 10.0: 1
Number of HSP's gapped: 353
Number of HSP's successfully gapped: 146
Length of query: 50
Length of database: 10,937,602
Length adjustment: 23
Effective length of query: 27
Effective length of database: 9,917,460
Effective search space: 267771420
Effective search space used: 267771420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.0 bits)