BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13321
         (144 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KQX|A Chain A, Structure Of A Protease 1
 pdb|3KQX|B Chain B, Structure Of A Protease 1
 pdb|3KQX|C Chain C, Structure Of A Protease 1
 pdb|3KQX|D Chain D, Structure Of A Protease 1
 pdb|3KQX|E Chain E, Structure Of A Protease 1
 pdb|3KQX|F Chain F, Structure Of A Protease 1
 pdb|3KQX|G Chain G, Structure Of A Protease 1
 pdb|3KQX|H Chain H, Structure Of A Protease 1
 pdb|3KQX|I Chain I, Structure Of A Protease 1
 pdb|3KQX|J Chain J, Structure Of A Protease 1
 pdb|3KQX|K Chain K, Structure Of A Protease 1
 pdb|3KQX|L Chain L, Structure Of A Protease 1
 pdb|3KQZ|A Chain A, Structure Of A Protease 2
 pdb|3KQZ|B Chain B, Structure Of A Protease 2
 pdb|3KQZ|C Chain C, Structure Of A Protease 2
 pdb|3KQZ|D Chain D, Structure Of A Protease 2
 pdb|3KQZ|E Chain E, Structure Of A Protease 2
 pdb|3KQZ|F Chain F, Structure Of A Protease 2
 pdb|3KQZ|G Chain G, Structure Of A Protease 2
 pdb|3KQZ|H Chain H, Structure Of A Protease 2
 pdb|3KQZ|I Chain I, Structure Of A Protease 2
 pdb|3KQZ|J Chain J, Structure Of A Protease 2
 pdb|3KQZ|K Chain K, Structure Of A Protease 2
 pdb|3KQZ|L Chain L, Structure Of A Protease 2
 pdb|3KR4|A Chain A, Structure Of A Protease 3
 pdb|3KR4|B Chain B, Structure Of A Protease 3
 pdb|3KR4|C Chain C, Structure Of A Protease 3
 pdb|3KR4|D Chain D, Structure Of A Protease 3
 pdb|3KR4|E Chain E, Structure Of A Protease 3
 pdb|3KR4|F Chain F, Structure Of A Protease 3
 pdb|3KR4|G Chain G, Structure Of A Protease 3
 pdb|3KR4|H Chain H, Structure Of A Protease 3
 pdb|3KR4|I Chain I, Structure Of A Protease 3
 pdb|3KR4|J Chain J, Structure Of A Protease 3
 pdb|3KR4|K Chain K, Structure Of A Protease 3
 pdb|3KR4|L Chain L, Structure Of A Protease 3
 pdb|3KR5|A Chain A, Structure Of A Protease 4
 pdb|3KR5|B Chain B, Structure Of A Protease 4
 pdb|3KR5|C Chain C, Structure Of A Protease 4
 pdb|3KR5|D Chain D, Structure Of A Protease 4
 pdb|3KR5|E Chain E, Structure Of A Protease 4
 pdb|3KR5|F Chain F, Structure Of A Protease 4
 pdb|3KR5|G Chain G, Structure Of A Protease 4
 pdb|3KR5|H Chain H, Structure Of A Protease 4
 pdb|3KR5|I Chain I, Structure Of A Protease 4
 pdb|3KR5|J Chain J, Structure Of A Protease 4
 pdb|3KR5|K Chain K, Structure Of A Protease 4
 pdb|3KR5|L Chain L, Structure Of A Protease 4
 pdb|3T8W|A Chain A, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|B Chain B, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|C Chain C, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|D Chain D, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|E Chain E, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|F Chain F, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|G Chain G, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|H Chain H, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|I Chain I, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|J Chain J, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|K Chain K, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
 pdb|3T8W|L Chain L, A Bestatin-Based Chemical Biology Strategy Reveals
           Distinct Roles For Malaria M1- And M17-Family
           Aminopeptidases
          Length = 528

 Score = 27.7 bits (60), Expect = 2.2,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 6   GNPGISTALTLITSLNQDKNLELDFIIDLHAHSSLKGLFIY--GNSYDDIYSSRASLVSL 63
           GN      LTL  +L   + L +D+I+D+   ++L G  +Y  G SY  ++ +   L++ 
Sbjct: 373 GNTDAEGRLTLADALVYAEKLGVDYIVDI---ATLTGAMLYSLGTSYAGVFGNNEELINK 429

Query: 64  AL 65
            L
Sbjct: 430 IL 431


>pdb|1CYG|A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
          Length = 680

 Score = 25.8 bits (55), Expect = 9.0,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 72  AGNLGRVDFTSEFEY----DLFIRPDTCNPRHRLWFNFVIDNTRL----DQRVILNIVNM 123
           AGNL +V+FTS+  Y    D F+  +T N      F+    N R     D + I+N +N 
Sbjct: 1   AGNLNKVNFTSDVVYQIVVDRFVDGNTSNNPSGALFSSGCTNLRKYCGGDWQGIINKIND 60

Query: 124 G 124
           G
Sbjct: 61  G 61


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.140    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,380,077
Number of Sequences: 62578
Number of extensions: 163271
Number of successful extensions: 281
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 281
Number of HSP's gapped (non-prelim): 2
length of query: 144
length of database: 14,973,337
effective HSP length: 89
effective length of query: 55
effective length of database: 9,403,895
effective search space: 517214225
effective search space used: 517214225
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)