RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy13321
         (144 letters)



>gnl|CDD|133118 cd06908, M14_AGBL4_like, Peptidase M14-like domain of ATP/GTP
           binding protein AGBL-4 and related proteins.  Peptidase
           M14-like domain of ATP/GTP binding protein_like
           (AGBL)-4, and related proteins. The Peptidase M14 family
           of metallocarboxypeptidases are zinc-binding
           carboxypeptidases (CPs) which hydrolyze single,
           C-terminal amino acids from polypeptide chains, and have
           a recognition site for the free C-terminal carboxyl
           group, which is a key determinant of specificity. This
           eukaryotic subgroup includes the human AGBL4 and the
           mouse cytosolic carboxypeptidase (CCP)-6. ATP/GTP
           binding protein (AGTPBP-1/Nna1)-like proteins are active
           metallopeptidases that are thought to act on cytosolic
           proteins such as alpha-tubulin, to remove a C-terminal
           tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell
           degeneration (pcd). AGTPBP-1/Nna1 however does not
           belong to this subgroup. AGTPBP-1/Nna1-like proteins
           from the different phyla are highly diverse, but they
           all contain a unique N-terminal conserved domain right
           before the CP domain. It has been suggested that this
           N-terminal domain might act as a folding domain.
          Length = 261

 Score = 57.4 bits (139), Expect = 8e-11
 Identities = 25/47 (53%), Positives = 31/47 (65%)

Query: 8   PGISTALTLITSLNQDKNLELDFIIDLHAHSSLKGLFIYGNSYDDIY 54
           P +     L+  L+ D   +LDF IDLHAHSSL   FIYGN+YDD+Y
Sbjct: 124 PTLHAVKNLLKELDNDSTTQLDFYIDLHAHSSLMNCFIYGNTYDDVY 170


>gnl|CDD|199860 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP
           binding protein (AGBL)-5 and related proteins.
           Peptidase M14-like domain of ATP/GTP binding
           protein_like (AGBL)-5, and related proteins. The
           Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. This eukaryotic subgroup includes the human
           AGBL5 and the mouse cytosolic carboxypeptidase (CCP)-5.
           ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins
           are active metallopeptidases that are thought to act on
           cytosolic proteins such as alpha-tubulin, to remove a
           C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause
           Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however
           does not belong to this subgroup. AGTPBP-1/Nna1-like
           proteins from the different phyla are highly diverse,
           but they all contain a unique N-terminal conserved
           domain right before the CP domain. It has been suggested
           that this N-terminal domain might act as a folding
           domain.
          Length = 308

 Score = 51.2 bits (123), Expect = 2e-08
 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 2   NPSKGN-PGISTALTLITSLNQDKNLELDFIIDLHAHSSLKGLFIYGNSYDDI 53
           NP     P I  A  L+  L++     L F IDLH H+S +G FIYGNS DD 
Sbjct: 142 NPDPQLHPSIYAAKALLLYLHEHFESGLAFYIDLHGHASKRGCFIYGNSLDDE 194


>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human
           Nna1/AGTPBP-1, AGBL2 -5, and related proteins.  Subgroup
           of the Peptidase M14-like domain of Nna-1 (Nervous
           system Nuclear protein induced by Axotomy), also known
           as ATP/GTP binding protein (AGTPBP-1) and cytosolic
           carboxypeptidase (CCP), and related proteins. The
           Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. This eukaryotic subgroup includes the human
           Nna1/AGTPBP-1 and AGBL -2, -3, -4, and -5, and the mouse
           Nna1/CCP-1 and CCP -2 through -6. Nna1-like proteins are
           active metallopeptidases that are thought to act on
           cytosolic proteins such as alpha-tubulin, to remove a
           C-terminal tyrosine. Nna1 is widely expressed in the
           developing and adult nervous systems, including
           cerebellar Purkinje and granule neurons, miral cells of
           the olfactory bulb and retinal photoreceptors. Nna1 is
           also induced in axotomized motor neurons. Mutations in
           Nna1 cause Purkinje cell degeneration (pcd). The Nna1 CP
           domain is required to prevent the retinal photoreceptor
           loss and cerebellar ataxia phenotypes of pcd mice, and a
           functional zinc-binding domain is needed for Nna-1 to
           support neuron survival in these mice. Nna1-like
           proteins from the different phyla are highly diverse,
           but they all contain a unique N-terminal conserved
           domain right before the CP domain. It has been suggested
           that this N-terminal domain might act as a folding
           domain.
          Length = 258

 Score = 46.0 bits (110), Expect = 1e-06
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 16  LITSLNQDKNLELDFIIDLHAHSSLKGLFIYGNSYDDIYSSR 57
           LI  L+Q++N+     IDLH HS  K  F+YG    D   + 
Sbjct: 134 LIKKLSQERNII--LFIDLHGHSRKKNSFMYGCENSDDPLNY 173


>gnl|CDD|112235 pfam03410, Peptidase_M44, Protein G1.  Protein G1, named after the
           vaccinia virus protein, is a glycoprotein expressed by
           many Poxviridae.
          Length = 590

 Score = 29.4 bits (66), Expect = 0.58
 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 44  FIYGNSYDDIYSSRASLVSLALPCK-RWVAGNLGRVDFTS 82
           F  GNS  DI   R SLVS A  CK + V G   R D  +
Sbjct: 456 FASGNSIADILERRESLVSFARRCKNKIVFGKRARYDVVT 495


>gnl|CDD|199876 cd06909, M14_ASPA, Peptidase M14 Aspartoacylase (ASPA) subfamily.
           Aspartoacylase (ASPA) belongs to the Succinylglutamate
           desuccinylase/aspartoacylase subfamily of the M14 family
           of metallocarboxypeptidases. ASPA (also known as
           aminoacylase 2; EC:3.5.1.15) cleaves N-acetyl L-aspartic
           acid (NAA) into aspartate and acetate. NAA is abundant
           in the brain, and hydrolysis of NAA by ASPA may help
           maintain white matter. ASPA is an NAA scavenger in other
           tissues. Mutations in the gene encoding ASPA cause
           Canavan disease (CD), a fatal progressive
           neurodegenerative disorder involving dysmyelination and
           spongiform degeneration of white matter in children.
           This enzyme binds zinc which is necessary for activity.
           Measurement of elevated NAA levels in urine is used in
           the diagnosis of CD.
          Length = 282

 Score = 27.2 bits (61), Expect = 2.8
 Identities = 12/42 (28%), Positives = 18/42 (42%)

Query: 29  DFIIDLHAHSSLKGLFIYGNSYDDIYSSRASLVSLALPCKRW 70
           DFIIDLH  ++  GL +            A+ +   L C  +
Sbjct: 96  DFIIDLHNTTANMGLTLILYGRRPFDLHLAAYLQSKLGCPIY 137


>gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP
           binding proteins, cytosolic carboxypeptidases and
           related proteins.  Peptidase M14-like domain of Nna-1
           (Nervous system Nuclear protein induced by Axotomy),
           also known as ATP/GTP binding protein (AGTPBP-1) and
           cytosolic carboxypeptidase (CCP), and related proteins.
           The Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. This subfamily includes the human AGTPBP-1
           and AGBL -2, -3, -4, and -5, and the mouse Nna1/CCP-1
           and CCP -2 through -6. Nna1-like proteins are active
           metallopeptidases that are thought to act on cytosolic
           proteins such as alpha-tubulin, to remove a C-terminal
           tyrosine. Nna1 is widely expressed in the developing and
           adult nervous systems, including cerebellar Purkinje and
           granule neurons, miral cells of the olfactory bulb and
           retinal photoreceptors. Nna1 is also induced in
           axotomized motor neurons. Mutations in Nna1 cause
           Purkinje cell degeneration (pcd). The Nna1 CP domain is
           required to prevent the retinal photoreceptor loss and
           cerebellar ataxia phenotypes of pcd mice, and a
           functional zinc-binding domain is needed for Nna-1 to
           support neuron survival in these mice. Nna1-like
           proteins from the different phyla are highly diverse,
           but they all contain a characteristic N-terminal
           conserved domain right before the CP domain. It has been
           suggested that this N-terminal domain might act as a
           folding domain.
          Length = 258

 Score = 27.3 bits (60), Expect = 3.5
 Identities = 11/47 (23%), Positives = 17/47 (36%), Gaps = 2/47 (4%)

Query: 2   NPS-KGNPGISTALTLITSLNQDKNLELDFIIDLHAHSSLKGLFIYG 47
           NP+    P        +TS+ Q     + F +D H       +F  G
Sbjct: 127 NPNPFAQPETYLVRDKMTSIVQGGGK-IVFAVDFHGTFRKHDVFYTG 172


>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase. 
          Length = 277

 Score = 26.9 bits (60), Expect = 3.6
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 28  LDFIIDLHAHSSLKGLFIYGNSYDDIYSSRASLVSLALP 66
               IDLH +S L  L+ YG +Y  +      L SLA  
Sbjct: 166 FKLYIDLHGYSQLI-LYPYGYTYSSLPPDDEELKSLAKR 203


>gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding
           proteins and cytosolic carboxypeptidases.  Peptidase
           M14-like domain of Nna-1 (Nervous system Nuclear protein
           induced by Axotomy), also known as ATP/GTP binding
           protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),
           and related proteins. The Peptidase M14 family of
           metallocarboxypeptidases are zinc-binding
           carboxypeptidases (CPs) which hydrolyze single,
           C-terminal amino acids from polypeptide chains, and have
           a recognition site for the free C-terminal carboxyl
           group, which is a key determinant of specificity. This
           eukaryotic subgroup includes the mouse Nna1/CCP-1, and
           -4 proteins, and the human Nna1/AGTPBP-1 protein.
           Nna1-like proteins are active metallopeptidases that are
           thought to act on cytosolic proteins such as
           alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is
           widely expressed in the developing and adult nervous
           systems, including cerebellar Purkinje and granule
           neurons, miral cells of the olfactory bulb and retinal
           photoreceptors. Nna1 is also induced in axotomized motor
           neurons. Mutations in Nna1 cause Purkinje cell
           degeneration (pcd). The Nna1 CP domain is required to
           prevent the retinal photoreceptor loss and cerebellar
           ataxia phenotypes of pcd mice, and a functional
           zinc-binding domain is needed for Nna-1 to support
           neuron survival in these mice. Nna1-like proteins from
           the different phyla are highly diverse, but they all
           contain a unique N-terminal conserved domain right
           before the CP domain. It has been suggested that this
           N-terminal domain might act as a folding domain.
          Length = 278

 Score = 27.1 bits (60), Expect = 3.7
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 8   PGISTALTLITSLNQDKNLELDFIIDLHAHSSLKGLFIYGNS 49
           P I     L+  L   K   L +  D H HS  K +F+YG S
Sbjct: 133 PTIYHTKGLLQYLAAIKRSPLVYC-DYHGHSRKKNVFMYGCS 173


>gnl|CDD|185753 cd09214, GH64-like, glycosyl hydrolase 64 family.  This family is
           represented by the laminaripentaose-producing,
           beta-1,3-glucanase (LPHase) of Streptomyces matensis and
           related bacterial and ascomycete proteins. LPHase is a
           member of glycoside hydrolase family 64 (GH64), it is an
           inverting enzyme involved in the cleavage of long-chain
           polysaccharide beta-1,3-glucans, into specific
           pentasaccharide oligomers. LPHase is a two-domain
           crescent fold structure: one domain is composed of 10
           beta-strands, eight coming from the N-terminus of the
           protein and two from the C-terminal region, and the
           protein has a second inserted domain; this cd includes
           both domains. This protein has an electronegative,
           substrate-binding cleft, and conserved Glu and Asp
           residues involved in the cleavage of the
           beta-1,3-glucan, laminarin, a plant and fungal cell wall
           component. Among bacteria, many beta-1,3-glucanases are
           implicated in fungal cell wall degradation. Also
           included in this family is GluB , the beta-1,3-glucanase
           B from Lysobacter enzymogenes Strain N4-7. Recombinant
           GluB demonstrated higher relative activity toward the
           branched-chain beta-1,3 glucan substrate zymosan A than
           toward linear beta-1,3 glucan substrates. Sometimes
           these two domains are found associated with other
           domains such as in the Catenulispora acidiphila DSM
           44928 carbohydrate binding family 6 protein in which
           they are positioned N-terminal of a carbohydrate binding
           module, family 6 (CBM_6) domain. In the
           Cellulosimicrobium cellulans, glucan
           endo-1,3-beta-glucosidase, they are positioned
           N-terminal of a RICIN, carbohydrate-binding domain, and
           in the Salinispora tropica CNB-440, coagulation factor
           5/8 C-terminal domain (FA58C) protein, they are
           positioned C-terminal of two FA58C domains which are
           proposed to function as cell surface-attached,
           carbohydrate-binding domain. This FA58C-containing
           protein has an internal peptide deletion (of approx. 44
           residues) in the LPHase domain II.
          Length = 319

 Score = 26.9 bits (60), Expect = 3.7
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 5/42 (11%)

Query: 35  HAHSSLKGLFIYGNSYDDIYSSRASLVSLALPCKRWVAGNLG 76
           HAHS       YG  YDD+   ++S +S   P        LG
Sbjct: 283 HAHS--INGLAYGFPYDDVN-GQSSTLSTTDP--THATITLG 319


>gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP
           binding protein AGBL-2 and AGBL-3, and related proteins.
            Peptidase M14-like domain of ATP/GTP binding
           protein_like (AGBL)-2, and related proteins. The
           Peptidase M14 family of metallocarboxypeptidases are
           zinc-binding carboxypeptidases (CPs) which hydrolyze
           single, C-terminal amino acids from polypeptide chains,
           and have a recognition site for the free C-terminal
           carboxyl group, which is a key determinant of
           specificity. This subgroup includes the human AGBL-2,
           and -3, and the mouse cytosolic carboxypeptidase
           (CCPs)-2, and -3. ATP/GTP binding protein
           (AGTPBP-1/Nna1)-like proteins are active
           metallopeptidases that are thought to act on cytosolic
           proteins such as alpha-tubulin, to remove a C-terminal
           tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell
           degeneration (pcd). AGTPBP-1/Nna1 however does not
           belong to this subgroup. AGTPBP-1/Nna1-like proteins
           from the different phyla are highly diverse, but they
           all contain a unique N-terminal conserved domain right
           before the CP domain. It has been suggested that this
           N-terminal domain might act as a folding domain.
          Length = 261

 Score = 26.9 bits (60), Expect = 3.7
 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%)

Query: 16  LITSLNQDKNLELDFIIDLHAHSSLKGLFIYG 47
           ++  L +++  E+    DLH HS    +F+YG
Sbjct: 135 MVKRLLEER--EVILYCDLHGHSRKNNVFMYG 164


>gnl|CDD|187697 cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase HI in long-term
           repeat retroelements.  Ribonuclease H (RNase H) enzymes
           are divided into two major families, Type 1 and Type 2,
           based on amino acid sequence similarities and
           biochemical properties. RNase H is an endonuclease that
           cleaves the RNA strand of an RNA/DNA hybrid in a
           sequence non-specific manner in the presence of divalent
           cations. RNase H is widely present in various organisms,
           including bacteria, archaea and eukaryote.  RNase HI has
           also been observed as adjunct domains to the reverse
           transcriptase gene in retroviruses, in long-term repeat
           (LTR)-bearing retrotransposons and non-LTR
           retrotransposons. RNase HI in LTR retrotransposons
           perform degradation of the original RNA template,
           generation of a polypurine tract (the primer for
           plus-strand DNA synthesis), and final removal of RNA
           primers from newly synthesized minus and plus strands.
           The catalytic residues for RNase H enzymatic activity,
           three aspartatic acids and one glutamatic acid residue
           (DEDD),  are unvaried across all RNase H domains.
           Phylogenetic patterns of RNase HI of LTR retroelements
           is classified into five major families, Ty3/Gypsy,
           Ty1/Copia, Bel/Pao, DIRS1 and the vertebrate
           retroviruses.  Bel/Pao family has been described only in
           metazoan genomes.  RNase H inhibitors have been explored
           as an anti-HIV drug target because RNase H inactivation
           inhibits reverse transcription.
          Length = 135

 Score = 26.5 bits (59), Expect = 4.0
 Identities = 10/29 (34%), Positives = 15/29 (51%)

Query: 30  FIIDLHAHSSLKGLFIYGNSYDDIYSSRA 58
            +I + AHS L G    GN+  D  + +A
Sbjct: 106 AVIHIRAHSGLPGPLALGNARADQAARQA 134


>gnl|CDD|182445 PRK10420, PRK10420, L-lactate permease; Provisional.
          Length = 551

 Score = 26.7 bits (59), Expect = 4.9
 Identities = 12/19 (63%), Positives = 12/19 (63%)

Query: 52  DIYSSRASLVSLALPCKRW 70
           DI SS  SLV L L  KRW
Sbjct: 251 DIISSLVSLVCLTLFLKRW 269


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.140    0.426 

Gapped
Lambda     K      H
   0.267   0.0770    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,323,074
Number of extensions: 645347
Number of successful extensions: 455
Number of sequences better than 10.0: 1
Number of HSP's gapped: 455
Number of HSP's successfully gapped: 16
Length of query: 144
Length of database: 10,937,602
Length adjustment: 88
Effective length of query: 56
Effective length of database: 7,034,450
Effective search space: 393929200
Effective search space used: 393929200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (24.5 bits)