Diaphorina citri psyllid: psy1332


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MYYYSQVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNLKEVTEGEEVLE
cccHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHcccEEEEECccCEEEEEEEcccccccHHHHHHHHccccCEEEEEEEcEECccccccc
MYYYSQVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNLKEVT*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYYSQVIPTLKQCMSIERAQMRVRVEVSAGVKDVKKLKEKLVKCATSVENEEWSGGGLLLICLIDPGKYREIDELVRTETRGQGTLELLNLKEVTEGEEVLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ5RK30
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ5ZIY4
Ribosome maturation protein SBDS Required for the assembly of mature ribosomes and ribosome biogenesis. Together with EFTUD1, triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rRNA processing and nuclear export. Required for normal levels of protein synthesis. May play a role in cellular stress resistance. May play a role in cellular response to DNA damage. May play a role in cell proliferation.confidentQ9Y3A5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KDO, chain A
Confidence level:very confident
Coverage over the Query: 2-103
View the alignment between query and template
View the model in PyMOL