BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13330
         (289 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NAZ|A Chain A, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|B Chain B, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|C Chain C, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|D Chain D, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NCH|A Chain A, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|B Chain B, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|C Chain C, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|D Chain D, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3O3C|A Chain A, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|B Chain B, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|C Chain C, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|D Chain D, Glycogen Synthase Basal State Udp Complex
 pdb|3RSZ|A Chain A, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|B Chain B, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|C Chain C, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|D Chain D, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
          Length = 725

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 100 NIDADVFIKRVKYMMARLTVDGCQKDYVCFDFVPRHHN-----VIRYRKGIAVIKDNFHT 154
           N  AD+FI+ +  +  RL V G +K  V F  +P  +N      ++ +  +  +++  H 
Sbjct: 345 NKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVEALKGQAEVRALENTVHE 404

Query: 155 VCSYV 159
           V + +
Sbjct: 405 VTTSI 409


>pdb|3NB0|A Chain A, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|B Chain B, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|C Chain C, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|D Chain D, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3RT1|A Chain A, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|B Chain B, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|C Chain C, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|D Chain D, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
          Length = 725

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 100 NIDADVFIKRVKYMMARLTVDGCQKDYVCFDFVPRHHN-----VIRYRKGIAVIKDNFHT 154
           N  AD+FI+ +  +  RL V G +K  V F  +P  +N      ++ +  +  +++  H 
Sbjct: 345 NKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVEALKGQAEVRALENTVHE 404

Query: 155 VCSYV 159
           V + +
Sbjct: 405 VTTSI 409


>pdb|2ICI|A Chain A, Crystal Structure Of Streptococcal Pyrogenic Exotoxin I
          Length = 227

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 16/69 (23%)

Query: 204 GGVTLSPRPNLYCKQNI---------------SDFSVCDTDQKEVTIDETYCLSVDYLGR 248
           GG+TLS   N   K+NI               +D S   TD+KEVTI E    S  YL +
Sbjct: 90  GGITLSD-GNRIDKKNIPVNIFIDGVQQKYSYTDISTVSTDKKEVTIQELDVKSRYYLQK 148

Query: 249 PVDIYSDPD 257
             +IY   D
Sbjct: 149 HFNIYGFGD 157


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.445 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,290,229
Number of Sequences: 62578
Number of extensions: 397387
Number of successful extensions: 883
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 880
Number of HSP's gapped (non-prelim): 5
length of query: 289
length of database: 14,973,337
effective HSP length: 98
effective length of query: 191
effective length of database: 8,840,693
effective search space: 1688572363
effective search space used: 1688572363
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 51 (24.3 bits)