Query         psy13330
Match_columns 289
No_of_seqs    16 out of 18
Neff          2.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:44:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13330.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13330hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05265 DUF723:  Protein of un  44.9      14  0.0003   28.5   1.5   18  174-191    27-44  (60)
  2 PLN00054 photosystem I reactio  41.4      11 0.00023   33.2   0.5   11   83-93     91-101 (139)
  3 cd00191 TY Thyroglobulin type   35.1      29 0.00062   26.0   1.9   29  223-251    23-55  (66)
  4 PF05479 PsaN:  Photosystem I r  30.1      25 0.00054   31.0   1.0   14   80-93     87-101 (138)
  5 PF08119 Toxin_31:  Scorpion ac  30.1      28 0.00061   24.6   1.0   20  213-232    14-33  (37)
  6 PF13501 SoxY:  Sulfur oxidatio  28.5      46 0.00099   27.4   2.2   32  168-203    47-79  (111)
  7 PRK07474 sulfur oxidation prot  24.1      69  0.0015   28.1   2.6   32  168-203    88-120 (154)
  8 smart00815 AMA-1 Apical membra  22.4      58  0.0013   30.9   1.9   31  180-211    39-69  (240)
  9 PF12946 EGF_MSP1_1:  MSP1 EGF   22.2      69  0.0015   22.6   1.8   18    3-20     17-34  (37)
 10 PF06477 DUF1091:  Protein of u  19.5      32 0.00069   25.1  -0.3   25  167-191    36-61  (81)

No 1  
>PF05265 DUF723:  Protein of unknown function (DUF723);  InterPro: IPR007929 This family contains several uncharacterised proteins from Neisseria meningitidis. These proteins may have a role in DNA binding.
Probab=44.93  E-value=14  Score=28.48  Aligned_cols=18  Identities=39%  Similarity=0.942  Sum_probs=14.9

Q ss_pred             ccCCceeecccCceeeeE
Q psy13330        174 AKNPVPVRCPIAGKFNFT  191 (289)
Q Consensus       174 a~~P~pi~CPvaGkf~F~  191 (289)
                      ...|+.|+||+-|-|...
T Consensus        27 ~~~PvtI~CP~HG~~~~s   44 (60)
T PF05265_consen   27 VATPVTIRCPKHGNFTCS   44 (60)
T ss_pred             CCCceEEECCCCCcEEec
Confidence            467999999999987654


No 2  
>PLN00054 photosystem I reaction center subunit N; Provisional
Probab=41.44  E-value=11  Score=33.22  Aligned_cols=11  Identities=45%  Similarity=1.226  Sum_probs=9.7

Q ss_pred             CCCCCCCcCcc
Q psy13330         83 PGCQLPQNFSG   93 (289)
Q Consensus        83 pgC~lP~nFsG   93 (289)
                      --|+||+||+|
T Consensus        91 G~C~FP~Nf~G  101 (139)
T PLN00054         91 GTCKFPENFTG  101 (139)
T ss_pred             ccccCCccccc
Confidence            35999999998


No 3  
>cd00191 TY Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases
Probab=35.13  E-value=29  Score=26.02  Aligned_cols=29  Identities=31%  Similarity=0.593  Sum_probs=21.0

Q ss_pred             ceeecCCC--cEEEEecc--eeeeeecCCCcee
Q psy13330        223 FSVCDTDQ--KEVTIDET--YCLSVDYLGRPVD  251 (289)
Q Consensus       223 ~svCd~dq--K~~~id~~--~ClsvD~~GrPvd  251 (289)
                      +-.|+.|.  +.+|=+..  +||=||..|++|.
T Consensus        23 iP~C~~~G~y~~~QC~~~~g~CwCVd~~G~~i~   55 (66)
T cd00191          23 VPQCDEDGNYEPVQCHGSTGYCWCVDPDGEEIP   55 (66)
T ss_pred             CcccCCCCCEeeeeecCCCCcEEEECCCCcCCC
Confidence            33455544  46666766  9999999999975


No 4  
>PF05479 PsaN:  Photosystem I reaction centre subunit N (PSAN or PSI-N);  InterPro: IPR008796 This family contains several Photosystem I reaction centre subunit N (PSI-N) proteins. The protein has no known function although it is localised in the thylakoid lumen []. PSI-N is a small extrinsic subunit at the lumen side and is very likely involved in the docking of plastocyanin.; GO: 0005516 calmodulin binding, 0015979 photosynthesis, 0009522 photosystem I, 0042651 thylakoid membrane; PDB: 2WSE_N 2WSC_N 2WSF_N 2O01_N.
Probab=30.13  E-value=25  Score=31.01  Aligned_cols=14  Identities=43%  Similarity=1.032  Sum_probs=8.9

Q ss_pred             ccCC-CCCCCCcCcc
Q psy13330         80 VVEP-GCQLPQNFSG   93 (289)
Q Consensus        80 ~v~p-gC~lP~nFsG   93 (289)
                      .|+- -|+||.||+|
T Consensus        87 tv~fg~c~fP~n~~g  101 (138)
T PF05479_consen   87 TVQFGTCKFPENFTG  101 (138)
T ss_dssp             T--TSTSSSSS-SSS
T ss_pred             eeecccccCCccchh
Confidence            3444 4999999987


No 5  
>PF08119 Toxin_31:  Scorpion acidic alpha-KTx toxin family;  InterPro: IPR012635 This entry represents proteins that are acidic alpha-KTx short chain scorpion toxins. These toxins are named parabutoxins, that binds and inhibit voltage-sensitive potassium channels and inhibit the vertebrate potassium channel Kv1.1 with low affinity. Furthermore, they lack the crucial pore-plugging lysine. In addition, the second important residue of the dyad, the hydrophobic residue (Phe or Tyr) is also missing [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=30.09  E-value=28  Score=24.56  Aligned_cols=20  Identities=40%  Similarity=0.630  Sum_probs=17.3

Q ss_pred             ceeeccccccceeecCCCcE
Q psy13330        213 NLYCKQNISDFSVCDTDQKE  232 (289)
Q Consensus       213 ~i~C~~~iSd~svCd~dqK~  232 (289)
                      -||||...-+-.|||.-||-
T Consensus        14 viyckgeeystgvcdgpqkc   33 (37)
T PF08119_consen   14 VIYCKGEEYSTGVCDGPQKC   33 (37)
T ss_pred             EEEecCceeccccccCCccc
Confidence            48999998888999999983


No 6  
>PF13501 SoxY:  Sulfur oxidation protein SoxY; PDB: 2OXG_B 2OX5_B 2OXH_F 2NNF_A 2NNC_B.
Probab=28.48  E-value=46  Score=27.37  Aligned_cols=32  Identities=44%  Similarity=0.769  Sum_probs=25.1

Q ss_pred             eEEEeeccCCceeecccCceeeeEE-eCCceeeeEee
Q psy13330        168 RYNLFLAKNPVPVRCPIAGKFNFTQ-RGDALFETRIL  203 (289)
Q Consensus       168 ~Yd~fla~~P~pi~CPvaGkf~F~Q-rG~~~f~TrIl  203 (289)
                      +--+|...||.|.    +..|.|+- .|+..|.|||-
T Consensus        47 ~I~l~vd~NP~P~----~a~f~~~p~~~~~~~stRir   79 (111)
T PF13501_consen   47 RIHLFVDKNPSPL----AATFELTPAGGEPYVSTRIR   79 (111)
T ss_dssp             EEEEEETTSSSSE----EEEEEE-TTCCEEEEEEEEE
T ss_pred             EEEEEecCCCCcE----EEEEEEcCCCCCceeEEEEE
Confidence            4568889999964    67899965 77788999986


No 7  
>PRK07474 sulfur oxidation protein SoxY; Provisional
Probab=24.07  E-value=69  Score=28.14  Aligned_cols=32  Identities=34%  Similarity=0.491  Sum_probs=25.1

Q ss_pred             eEEEeeccCCceeecccCceeeeE-EeCCceeeeEee
Q psy13330        168 RYNLFLAKNPVPVRCPIAGKFNFT-QRGDALFETRIL  203 (289)
Q Consensus       168 ~Yd~fla~~P~pi~CPvaGkf~F~-QrG~~~f~TrIl  203 (289)
                      +--+|...||.|.    +..|.|+ ..|..-|.|||-
T Consensus        88 ~I~l~vd~NP~Pl----~a~f~l~p~~~~~~vstRIR  120 (154)
T PRK07474         88 AIHVFADGNPQPG----VATFHFGPAAGRAEASTRIR  120 (154)
T ss_pred             EEEEEECCCCCCE----EEEEEecCCCCCceEEEEEE
Confidence            4568889999975    5789994 466678999986


No 8  
>smart00815 AMA-1 Apical membrane antigen 1. Apical membrane antigen 1 (AMA-1) is a Plasmodium asexual blood-stage antigen. It has been suggested that positive selection operates on the AMA-1 gene in regions coding for antigenic sites.
Probab=22.41  E-value=58  Score=30.93  Aligned_cols=31  Identities=35%  Similarity=0.458  Sum_probs=25.1

Q ss_pred             eecccCceeeeEEeCCceeeeEeeCccccCCC
Q psy13330        180 VRCPIAGKFNFTQRGDALFETRILGGVTLSPR  211 (289)
Q Consensus       180 i~CPvaGkf~F~QrG~~~f~TrIlGGvT~sPr  211 (289)
                      =+|||=||.-=+|.+++.|-|.|.=|- ++||
T Consensus        39 GkCPV~GK~I~~~n~~~~fl~pv~~~d-~~~~   69 (240)
T smart00815       39 GKCPVVGKGIILENSDADFLTPVATGD-QSVR   69 (240)
T ss_pred             CcCCcccceEEeccCCCccccccccCC-cCcC
Confidence            379999999999999999999987443 3455


No 9  
>PF12946 EGF_MSP1_1:  MSP1 EGF domain 1;  InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein. MSP1 is the merozoite surface protein 1. This domain is part of the C-terminal fragment that is proteolytically processed from the the rest of the protein and is left attached to the surface of the invading parasite [].; PDB: 1N1I_C 2FLG_A 1CEJ_A 2NPR_A 1B9W_A 1OB1_F.
Probab=22.16  E-value=69  Score=22.62  Aligned_cols=18  Identities=17%  Similarity=0.062  Sum_probs=13.6

Q ss_pred             cCceEEEEEeeeeeecCC
Q psy13330          3 VKKVVEYSCLGDWFVDKN   20 (289)
Q Consensus         3 ~~~vve~sCLg~Wf~gkn   20 (289)
                      .+|.+||+||.-|+...+
T Consensus        17 ~dG~eecrCllgyk~~~~   34 (37)
T PF12946_consen   17 DDGSEECRCLLGYKKVGG   34 (37)
T ss_dssp             TTSEEEEEE-TTEEEETT
T ss_pred             CCCCEEEEeeCCccccCC
Confidence            359999999999887554


No 10 
>PF06477 DUF1091:  Protein of unknown function (DUF1091);  InterPro: IPR010512 This entry contains a number of proteins from Drosophila melanogaster and other insects. Their function is unknown.
Probab=19.45  E-value=32  Score=25.07  Aligned_cols=25  Identities=20%  Similarity=0.533  Sum_probs=16.4

Q ss_pred             eeEEEeeccCCceeeccc-CceeeeE
Q psy13330        167 WRYNLFLAKNPVPVRCPI-AGKFNFT  191 (289)
Q Consensus       167 w~Yd~fla~~P~pi~CPv-aGkf~F~  191 (289)
                      .-|+.+.+....|..||+ +|.|-+.
T Consensus        36 ~~~~~~~~~sN~~~~CP~~~g~Y~~~   61 (81)
T PF06477_consen   36 IVYKSLKKYSNLPHTCPFKKGNYYLR   61 (81)
T ss_pred             HHHHHHhhccCCCCCCCCCCCEEEEE
Confidence            334555555566778999 7777554


Done!