Query         psy13331
Match_columns 143
No_of_seqs    13 out of 15
Neff          2.1 
Searched_HMMs 29240
Date          Fri Aug 16 16:45:52 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13331.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/13331hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3lw5_N Photosystem I-N subunit  66.6     1.9 6.4E-05   31.0   1.0   18   84-101    32-50  (85)
  2 2wsc_N PSAN, PSI-N, photosyste  55.9     3.6 0.00012   32.6   1.0   17   84-100   117-134 (170)
  3 1m1s_A WR4; structural genomic  46.3      18 0.00062   26.0   3.3   20   72-92     46-65  (116)
  4 1z9l_A Vesicle-associated memb  39.5      16 0.00055   25.2   2.1   20   72-92     50-69  (128)
  5 3lag_A Uncharacterized protein  35.6      12  0.0004   24.7   0.9   34   57-97      1-34  (98)
  6 1row_A SSP-19, MSP-domain prot  35.1      20 0.00069   25.0   2.1   20   72-92     38-57  (109)
  7 1xed_A Polymeric-immunoglobuli  32.5      48  0.0016   21.5   3.5   23   39-61     86-108 (117)
  8 1msp_A MSP, major sperm protei  32.1      22 0.00075   24.9   1.9   19   72-91     48-66  (126)
  9 1ywl_A Hypothetical UPF0213 pr  30.5      23 0.00077   24.7   1.7   20   43-62      8-27  (96)
 10 2cri_A Vesicle-associated memb  29.0      27 0.00093   24.9   1.9   20   72-92     54-73  (147)
 11 1zg2_A Hypothetical UPF0213 pr  24.7      37  0.0013   24.1   2.0   20   43-62      9-28  (107)
 12 1wic_A Hypothetical protein ri  22.1      44  0.0015   24.2   2.0   20   72-92     58-77  (152)
 13 3kxt_A Chromatin protein CREN7  20.7      60  0.0021   21.7   2.2   22   67-90      6-27  (56)

No 1  
>3lw5_N Photosystem I-N subunit, photosystem I reaction center subunit IX; photosynthesis, electron transfer, membrane proteins, large, complexes, chromophore; HET: CLA PQN BCR LMU LMG; 3.30A {Pisum sativum} PDB: 2o01_N*
Probab=66.58  E-value=1.9  Score=31.04  Aligned_cols=18  Identities=50%  Similarity=0.866  Sum_probs=13.6

Q ss_pred             eeeeCCC-CCCCCccccce
Q psy13331         84 AEVVEPG-CQLPQNFSGDW  101 (143)
Q Consensus        84 ~e~v~PG-C~lP~nFsG~W  101 (143)
                      +-.|+-| |++|+||.|-=
T Consensus        32 s~TV~~G~C~FP~Nf~GCq   50 (85)
T 3lw5_N           32 AYTVEFGSCKFPENFTGCQ   50 (85)
T ss_dssp             TSSCCCSCSSCCSCCSCSS
T ss_pred             eeEeecccccCCccccchH
Confidence            3456655 99999999953


No 2  
>2wsc_N PSAN, PSI-N, photosystem I-N subunit; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Phaseolus vulgaris} PDB: 2wse_N* 2wsf_N*
Probab=55.89  E-value=3.6  Score=32.55  Aligned_cols=17  Identities=53%  Similarity=0.970  Sum_probs=13.6

Q ss_pred             eeeeCCC-CCCCCccccc
Q psy13331         84 AEVVEPG-CQLPQNFSGD  100 (143)
Q Consensus        84 ~e~v~PG-C~lP~nFsG~  100 (143)
                      +-.|+-| |++|+||+|-
T Consensus       117 a~TV~~GtCkFP~Nf~GC  134 (170)
T 2wsc_N          117 AYTVEFGSCKFPENFTGC  134 (170)
T ss_dssp             CTTCCCSCSSCCSCCSCS
T ss_pred             eeeeecccccCCccccch
Confidence            4466666 9999999995


No 3  
>1m1s_A WR4; structural genomics, major sperm protein, bioinformatics, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: b.1.11.2
Probab=46.27  E-value=18  Score=25.98  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=15.7

Q ss_pred             CCceeEEeecceeeeeCCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGCQ   92 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC~   92 (143)
                      ++|+.|+++|+ ...|+||..
T Consensus        46 T~p~~YrVrP~-~G~I~Pg~~   65 (116)
T 1m1s_A           46 SNNEHYRVRPV-YGFVDAKGK   65 (116)
T ss_dssp             SCTTTEEEECS-EEEECTTCE
T ss_pred             cCCCceEEcCC-ceEECCCCe
Confidence            57999999998 457788764


No 4  
>1z9l_A Vesicle-associated membrane protein-associated protein A; VAP-A, cytoplasmic domain, protein binding; HET: MSE; 1.70A {Rattus norvegicus} PDB: 1z9o_A 2rr3_A 3ikk_A
Probab=39.47  E-value=16  Score=25.25  Aligned_cols=20  Identities=30%  Similarity=0.697  Sum_probs=16.4

Q ss_pred             CCceeEEeecceeeeeCCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGCQ   92 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC~   92 (143)
                      ++|.||.++|.. ..|+||..
T Consensus        50 T~p~~y~VrP~~-G~i~P~~s   69 (128)
T 1z9l_A           50 TAPRRYCVRPNS-GVIDPGSI   69 (128)
T ss_dssp             SCGGGEEEESCE-EEECTTCE
T ss_pred             CCCCceEEeCCC-cEECCCCe
Confidence            689999999995 57888764


No 5  
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris}
Probab=35.61  E-value=12  Score=24.65  Aligned_cols=34  Identities=15%  Similarity=0.320  Sum_probs=24.4

Q ss_pred             EeeecccccccccccCCceeEEeecceeeeeCCCCCCCCcc
Q psy13331         57 GVSITAECSTLKTVEKSPERLHITPVKAEVVEPGCQLPQNF   97 (143)
Q Consensus        57 G~SitaeC~tLkt~e~sPeRl~l~Pvk~e~v~PGC~lP~nF   97 (143)
                      ||++.|.+.+|-.  +  +|++++=+   .|+||..+|--.
T Consensus         1 ~~~~~a~~~V~ie--n--~~~rV~r~---~i~PG~~~~~H~   34 (98)
T 3lag_A            1 GMTVAAKSEIQID--N--DEVRVTEW---RLPPGSATGHHT   34 (98)
T ss_dssp             CCCEECEEEEEEE--S--SSEEEEEE---EECTTEECCSEE
T ss_pred             CCCccceeeEEEc--C--CeEEEEEE---EECCCCccCcEE
Confidence            7888888877643  3  46776555   899999998643


No 6  
>1row_A SSP-19, MSP-domain protein like family member; beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Caenorhabditis elegans} SCOP: b.1.11.2
Probab=35.11  E-value=20  Score=25.01  Aligned_cols=20  Identities=25%  Similarity=0.449  Sum_probs=15.8

Q ss_pred             CCceeEEeecceeeeeCCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGCQ   92 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC~   92 (143)
                      +||+.|+++|+ ...|+||..
T Consensus        38 T~p~~y~VrP~-~G~I~P~~~   57 (109)
T 1row_A           38 SNNNEYRIAPV-FGFVDPSGS   57 (109)
T ss_dssp             SCSSSEEEECS-EEEECTTEE
T ss_pred             CCCCceEEcCC-ceEECCCCe
Confidence            58999999998 457788753


No 7  
>1xed_A Polymeric-immunoglobulin receptor; IG-like fold, immune system; 1.90A {Homo sapiens} SCOP: b.1.1.1
Probab=32.48  E-value=48  Score=21.53  Aligned_cols=23  Identities=22%  Similarity=0.424  Sum_probs=18.3

Q ss_pred             ccceeeeecccCCCceEEEeeec
Q psy13331         39 KDEKFRCFLKNRDDDLYIGVSIT   61 (143)
Q Consensus        39 ~dekyRCflkNrdDd~y~G~Sit   61 (143)
                      ..-.|.|...+...++|.|+.++
T Consensus        86 DsG~Y~C~v~~~~~~l~f~~~~~  108 (117)
T 1xed_A           86 DSGRYKCGLGINSRGLSFDVSLE  108 (117)
T ss_dssp             GCEEEEEEESCGGGCCEEEEEEE
T ss_pred             HCEEEEEEEEeCCCCeeEEEEEE
Confidence            34478999988888899998765


No 8  
>1msp_A MSP, major sperm protein; cytoskeletal protein, cell motility protein; 2.50A {Ascaris suum} SCOP: b.1.11.2 PDB: 3msp_A 2bvu_A 2msp_A 1grw_A
Probab=32.11  E-value=22  Score=24.93  Aligned_cols=19  Identities=26%  Similarity=0.483  Sum_probs=14.1

Q ss_pred             CCceeEEeecceeeeeCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGC   91 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC   91 (143)
                      +||.||+++|. ..+|+||-
T Consensus        48 T~p~~y~VrP~-~Gii~P~~   66 (126)
T 1msp_A           48 TNMRRLSVDPP-CGVLDPKE   66 (126)
T ss_dssp             SCTTTEEEESC-EEEECTTC
T ss_pred             CCCCcEEEECC-CeEECCCC
Confidence            68999999998 34555554


No 9  
>1ywl_A Hypothetical UPF0213 protein EF2693; alpha and beta, structural genomics, northeast structural genomics consortium (NESG); NMR {Enterococcus faecalis}
Probab=30.51  E-value=23  Score=24.75  Aligned_cols=20  Identities=20%  Similarity=0.340  Sum_probs=15.5

Q ss_pred             eeeecccCCCceEEEeeecc
Q psy13331         43 FRCFLKNRDDDLYIGVSITA   62 (143)
Q Consensus        43 yRCflkNrdDd~y~G~Sita   62 (143)
                      |--+|.++|+-||+|++.+.
T Consensus         8 ~vYIL~~~~g~lY~G~T~dl   27 (96)
T 1ywl_A            8 YFYVLLCQDGSFYGGYTTEP   27 (96)
T ss_dssp             EEEEEECTTCCCEEEEESCH
T ss_pred             EEEEEEcCCCCEEEEEeCCH
Confidence            44566889999999988653


No 10 
>2cri_A Vesicle-associated membrane protein-associated protein A; VAP-A, VAP-33, beta sandwitch fold, structural genomics, NPPSFA; NMR {Mus musculus}
Probab=28.99  E-value=27  Score=24.92  Aligned_cols=20  Identities=25%  Similarity=0.692  Sum_probs=15.6

Q ss_pred             CCceeEEeecceeeeeCCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGCQ   92 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC~   92 (143)
                      ++|.||.++|.. ..|+||..
T Consensus        54 T~p~~y~VrP~~-GiI~P~~s   73 (147)
T 2cri_A           54 TAPRRYCVRPNS-GIIDPGSI   73 (147)
T ss_dssp             SCTTSEEEESSE-EECCTTCE
T ss_pred             CCCccEEEcCCC-cEECCCCe
Confidence            689999999985 46777663


No 11 
>1zg2_A Hypothetical UPF0213 protein BH0048; BHR2, structure, autostructure, northeast structural genomics consortium, PSI; NMR {Bacillus halodurans}
Probab=24.69  E-value=37  Score=24.06  Aligned_cols=20  Identities=20%  Similarity=0.468  Sum_probs=15.6

Q ss_pred             eeeecccCCCceEEEeeecc
Q psy13331         43 FRCFLKNRDDDLYIGVSITA   62 (143)
Q Consensus        43 yRCflkNrdDd~y~G~Sita   62 (143)
                      |--+|.++++-||+|++.+.
T Consensus         9 ~VYIL~~~~g~lY~G~T~dl   28 (107)
T 1zg2_A            9 YVYILECKDGSWYTGYTTDV   28 (107)
T ss_dssp             EEEEEECTTSCEEEEEECCH
T ss_pred             EEEEEEcCCCCEEEEEECCH
Confidence            45567889999999988653


No 12 
>1wic_A Hypothetical protein riken cDNA 6030424E15; beta sandwich fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.11.2
Probab=22.06  E-value=44  Score=24.21  Aligned_cols=20  Identities=25%  Similarity=0.718  Sum_probs=16.2

Q ss_pred             CCceeEEeecceeeeeCCCCC
Q psy13331         72 KSPERLHITPVKAEVVEPGCQ   92 (143)
Q Consensus        72 ~sPeRl~l~Pvk~e~v~PGC~   92 (143)
                      ++|.+|.++|.. -.|+||..
T Consensus        58 T~p~~y~VrP~~-GiI~P~~s   77 (152)
T 1wic_A           58 TAPEKYRVKPSN-SSCDPGAS   77 (152)
T ss_dssp             SCTTTEEEESSE-EEECTTCE
T ss_pred             CCCCceeecCCC-cEECCCCe
Confidence            689999999984 47788764


No 13 
>3kxt_A Chromatin protein CREN7; protein-DNA complex, crenarchaea chromatin protein, minor-GR binding, methylation; 1.60A {Sulfolobus solfataricus} PDB: 2jtm_A 3lwh_A* 3lwi_A*
Probab=20.66  E-value=60  Score=21.66  Aligned_cols=22  Identities=23%  Similarity=0.317  Sum_probs=17.2

Q ss_pred             cccccCCceeEEeecceeeeeCCC
Q psy13331         67 LKTVEKSPERLHITPVKAEVVEPG   90 (143)
Q Consensus        67 Lkt~e~sPeRl~l~Pvk~e~v~PG   90 (143)
                      +|++.  =.+++|.|+|+=+|+|-
T Consensus         6 vk~p~--G~e~~L~P~KvWvL~P~   27 (56)
T 3kxt_A            6 VKTPA--GKEAELVPEKVWALAPK   27 (56)
T ss_dssp             EECTT--SCEEEECCSEEEEECCT
T ss_pred             eeCCC--CCEEEEeeeEEEEEcCC
Confidence            34553  56899999999999984


Done!