Diaphorina citri psyllid: psy13343

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MLTMETDLKGGHIPPHHHLSSYGSMVHSNMMSLSQSPSSVVHHQNIGPHVTHNPMSNPLHPSHNTNNNNNSTNSKNQNAIDRVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLNEQAKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLLKKDKYPLGSGNLIQNTSSSNDVTRNSSSVTTSAQQNSAARESMYQMPNGYMPNGYMMDPATYQQHSAYTTHMSSGYPRYDMTGMHPSSTSLNSYMNGSSYGMYTTATTLPGAGSPYHSMQPSSHSPSGSSVKSEPVSPSSGGGILTPTPGSGPPTGLHLVKREYGSPNGLPPNSTDLHLVKREYSSPNGAPPNAGDLRHMISMYLPEQQEQARLQAMYQQQAGHPPEGMPLTHM
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHcccccccccccccccc
**************************************************************************************MNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLNEQAKRPFIDEAKRLRAVHMKEHPDYKY****************************************************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTMETDLKGGHIPPHHHLSSYGSMVHSNMMSLSQSPSSVVHHQNIGPHVTHNPMSNPLHPSHNTNNNNNSTNSKNQNAIDRVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKLLNEQAKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLLKKDKYPLGSGNLIQNTSSSNDVTRNSSSVTTSAQQNSAARESMYQMPNGYMPNGYMMDPATYQQHSAYTTHMSSGYPRYDMTGMHPSSTSLNSYMNGSSYGMYTTATTLPGAGSPYHSMQPSSHSPSGSSVKSEPVSPSSGGGILTPTPGSGPPTGLHLVKREYGSPNGLPPNSTDLHLVKREYSSPNGAPPNAGDLRHMISMYLPEQQEQARLQAMYQQQAGHPPEGMPLTHM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor Sox-2 Transcriptional activator. Functions as a switch in neuronal development, participating in the differentiation of embryonic neuroectodermal cells into neural tissues by making the ectodermal cells responsive to FGF-neuralizing signals (By similarity). Downstream SRRT target that mediates the promotion of neural stem cell self-renewal.confidentQ6NVN0
Transcription factor Sox-3 Transcriptional activator.confidentQ6EJB7
Transcription factor SOX-2 Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation.confidentP48432

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TMM, chain A
Confidence level:very confident
Coverage over the Query: 77-177
View the alignment between query and template
View the model in PyMOL