Query         psy1340
Match_columns 51
No_of_seqs    9 out of 11
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:29:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1340.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1340hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3514|consensus               91.3    0.28 6.1E-06   42.7   3.9   46    2-49    239-285 (1591)
  2 cd00110 LamG Laminin G domain;  88.9    0.68 1.5E-05   26.2   3.1   31   15-49      2-32  (151)
  3 KOG3516|consensus               85.5    0.97 2.1E-05   39.0   3.4   40    7-49    173-212 (1306)
  4 cd07279 PX_SNX20_21_like The p  80.8     1.8   4E-05   25.6   2.4   24    6-29      2-25  (112)
  5 PF07067 DUF1340:  Protein of u  80.4    0.56 1.2E-05   34.1   0.1   25   25-49    191-215 (236)
  6 KOG3514|consensus               60.7      18 0.00039   32.2   4.7   45    1-49    652-696 (1591)
  7 PF03091 CutA1:  CutA1 divalent  58.0      11 0.00023   23.0   2.2   23   26-49     38-60  (102)
  8 PRK10645 divalent-cation toler  54.9      12 0.00027   23.4   2.2   23   26-49     48-70  (112)
  9 PF13532 2OG-FeII_Oxy_2:  2OG-F  43.8      17 0.00037   22.0   1.6    9   38-46    186-194 (194)
 10 PF14508 GH97_N:  Glycosyl-hydr  38.3      49  0.0011   22.4   3.2   22    8-29     77-102 (259)
 11 TIGR00218 manA mannose-6-phosp  37.3      37 0.00081   23.2   2.5   24   12-35    174-197 (302)
 12 PRK10693 response regulator of  34.6      25 0.00055   23.6   1.4   21   26-46    281-301 (303)
 13 PF03531 SSrecog:  Structure-sp  33.4      77  0.0017   22.1   3.6   29   12-47    157-185 (222)
 14 smart00632 Aamy_C Aamy_C domai  31.7      76  0.0017   17.6   2.9   25    3-27     40-68  (81)
 15 PF12701 LSM14:  Scd6-like Sm d  31.6      23 0.00051   21.7   0.8   17    2-18     21-38  (96)
 16 PF08750 CNP1:  CNP1-like famil  30.9      24 0.00052   23.0   0.8   10    1-10     68-77  (139)
 17 KOG0337|consensus               30.5      15 0.00033   29.4  -0.2   22   21-42    163-193 (529)
 18 PF15106 TMEM156:  TMEM156 prot  30.3      27 0.00059   25.3   1.0   14    8-21    210-223 (226)
 19 PF05641 Agenet:  Agenet domain  30.0   1E+02  0.0022   16.8   3.3   19    3-21     14-32  (68)
 20 cd06898 PX_SNX10 The phosphoin  30.0      47   0.001   20.0   1.9   21    8-28      3-24  (113)
 21 PF06327 DUF1053:  Domain of Un  29.1      28 0.00061   20.1   0.8   12   38-49     77-88  (101)
 22 PF13759 2OG-FeII_Oxy_5:  Putat  28.3      44 0.00095   19.0   1.5   11   35-45     90-100 (101)
 23 cd06872 PX_SNX19_like_plant Th  28.0      82  0.0018   18.9   2.7   25    6-30      2-26  (107)
 24 cd03334 Fab1_TCP TCP-1 like do  27.7      42 0.00091   22.7   1.5   17    6-22    214-230 (261)
 25 cd08686 C2_ABR C2 domain in th  27.6 1.2E+02  0.0026   19.1   3.5   34   13-46     50-91  (118)
 26 PF04265 TPK_B1_binding:  Thiam  27.3      39 0.00084   18.4   1.1   22    2-23     11-35  (68)
 27 PHA00446 hypothetical protein   25.5      33 0.00071   22.0   0.7   11   26-36     32-42  (89)
 28 PF11113 Phage_head_chap:  Head  24.5 1.6E+02  0.0034   17.2   3.6   30   15-49      7-37  (56)
 29 cd01180 IPT_plexin_repeat1 Fir  23.3      50  0.0011   18.9   1.1   12   12-23     16-27  (94)
 30 cd07285 PX_SNX9 The phosphoino  22.8      71  0.0015   20.4   1.8   25    7-31      3-29  (126)
 31 PF13511 DUF4124:  Domain of un  21.2      45 0.00099   17.3   0.6    8   26-33     14-21  (60)
 32 COG5165 POB3 Nucleosome-bindin  21.2      46   0.001   26.6   0.9   28   13-47    232-259 (508)
 33 KOG4116|consensus               20.9      56  0.0012   20.9   1.1   18   23-40     63-80  (90)

No 1  
>KOG3514|consensus
Probab=91.26  E-value=0.28  Score=42.73  Aligned_cols=46  Identities=20%  Similarity=0.468  Sum_probs=39.5

Q ss_pred             Cccceecee-eeeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340           2 YEGELCDIY-TATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus         2 YEge~Cd~y-taT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      |.|+.|++- ..-+.|.+|..|++|-+-  .+-+.|+..-|+|.|||.|
T Consensus       239 ~dgq~cekeK~~~eaTF~G~ef~~YDls--~npI~s~~d~itl~FrT~q  285 (1591)
T KOG3514|consen  239 HDGQNCEKEKNDGEATFGGDEFVGYDLS--QNPIRSKKDNITLTFRTVQ  285 (1591)
T ss_pred             cCccccccccCcceEEecCceEEEeecc--CCcccccccceEEEEEEec
Confidence            678889885 457899999999999875  3688999999999999986


No 2  
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules.
Probab=88.95  E-value=0.68  Score=26.17  Aligned_cols=31  Identities=23%  Similarity=0.417  Sum_probs=22.8

Q ss_pred             EEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340          15 LTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus        15 ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      +...|++|+.|...  ...  .....||+.|||.+
T Consensus         2 ~~F~g~~~i~~~~~--~~~--~~~~~i~~~frt~~   32 (151)
T cd00110           2 VSFSGSSYVRLPTL--PAP--RTRLSISFSFRTTS   32 (151)
T ss_pred             eEeCCCceEEecCC--CCC--cceeEEEEEEEeCC
Confidence            45678888887654  222  77888999999975


No 3  
>KOG3516|consensus
Probab=85.52  E-value=0.97  Score=39.05  Aligned_cols=40  Identities=28%  Similarity=0.503  Sum_probs=32.8

Q ss_pred             eceeeeeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340           7 CDIYTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus         7 Cd~ytaT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      |+ |.+-++-++|.|++.||.-.|.  +.+.-++|||-|||-+
T Consensus       173 c~-y~s~vi~fdg~s~~~yr~~~~~--m~s~~d~is~~Fkt~~  212 (1306)
T KOG3516|consen  173 CS-YKSPVIYFDGSSSLLYRFHRKL--MSSLKDVISLKFKTMQ  212 (1306)
T ss_pred             cc-ccCceeEECCccceeeeccccc--cccccceeEEEEEeec
Confidence            44 4566889999999999988665  6677899999999965


No 4  
>cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. This subfamily consists of SNX20, SNX21, and similar proteins. SNX20 interacts with P-Selectin glycoprotein ligand-1 (PSGL-1), a surface-expressed mucin that acts as a ligand for the selectin family of adhesion proteins. It may function in the sorting and cycling of PSGL-1 into endosomes. SNX21, also cal
Probab=80.80  E-value=1.8  Score=25.60  Aligned_cols=24  Identities=21%  Similarity=0.265  Sum_probs=22.0

Q ss_pred             eeceeeeeEEEEecceeeEEEEee
Q psy1340           6 LCDIYTATILTLRGASYVSYRVYD   29 (51)
Q Consensus         6 ~Cd~ytaT~ltLRG~sYVsyrvyd   29 (51)
                      .|||-+++++.=.|.+||.|.|.-
T Consensus         2 ~~~i~~~~~~~~~~~~yv~Y~I~v   25 (112)
T cd07279           2 KFEIVSARTVKEGEKKYVVYQLAV   25 (112)
T ss_pred             eEEeccCeEEcCCCeeEEEEEEEE
Confidence            499999999999999999999873


No 5  
>PF07067 DUF1340:  Protein of unknown function (DUF1340);  InterPro: IPR009774 This family consists of several hypothetical Streptococcus thermophilus bacteriophage proteins of around 235 residues in length. The function of this family is unknown.
Probab=80.43  E-value=0.56  Score=34.14  Aligned_cols=25  Identities=20%  Similarity=0.724  Sum_probs=22.6

Q ss_pred             EEEeecccccccccceeEEEEEecc
Q psy1340          25 YRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus        25 yrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      |.-|.|-++++|+|+||-|.++|+.
T Consensus       191 fNkYEWpesLD~EVdRI~LEYRTKG  215 (236)
T PF07067_consen  191 FNKYEWPESLDSEVDRIYLEYRTKG  215 (236)
T ss_pred             hccccCchhhHhhhhhheeeeeccc
Confidence            5679999999999999999999963


No 6  
>KOG3514|consensus
Probab=60.67  E-value=18  Score=32.24  Aligned_cols=45  Identities=24%  Similarity=0.488  Sum_probs=38.7

Q ss_pred             CCccceeceeeeeEEEEecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340           1 MYEGELCDIYTATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus         1 ~YEge~Cd~ytaT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      .|||..|+- ++|+|..-|+-|.--..=   .-.|+.+.-||+.|||+.
T Consensus       652 ~~~G~~Cer-E~t~ls~nGs~~m~i~L~---~~~~tq~E~v~iRF~t~r  696 (1591)
T KOG3514|consen  652 GFEGRTCER-EATALSYNGSMSMKIVLP---HTMHTQAEDVSIRFRTQR  696 (1591)
T ss_pred             cccCccccc-eeeeEEEcCeeeEEEEec---ccceeecceEEEEEEecc
Confidence            489999985 789999999998876655   778999999999999975


No 7  
>PF03091 CutA1:  CutA1 divalent ion tolerance protein;  InterPro: IPR004323  The CutA family of proteins which exhibit ion tolerance are found in a large variety of species []. In E.Coli, two operons on the cutA locus contain genes that encode three proteins, CutA1, CutA2 and CutA3. CutA1 proteins are found in the cytoplasm while CutA2 (50kDa) and CutA3 (24kDa) are located in the inner membrane. Although the role of E. Coli CutA1 is not clear, studies on E. coli cutA locus describe some mutations that lead to an increase in copper sensitivity, thus suggesting a role in ion tolerance []. To date, the structure of CutA proteins from several species have been solved [, ]. The crystal structures of the E.Coli and rat CutA1 proteins show both these proteins to be trimeric in the crystal as well as in solution[].Trimerisation seems to supported by the formation of beta sheets between the subunit. This trimeric structure suggests the protein may be involved in signal transduction due to architectural similarities with PII signal transducer proteins []. Recent studies propose that mammalian CutA1 in the neuronal cell membrane acts as an anchor for acetylcholinesterase (AChE)1 [].; GO: 0010038 response to metal ion; PDB: 1O5J_A 1KR4_A 1VHF_A 3GSD_H 1OSC_A 3OPK_A 4E98_C 1V9B_F 1UKU_A 2E66_C ....
Probab=58.00  E-value=11  Score=23.03  Aligned_cols=23  Identities=13%  Similarity=0.557  Sum_probs=18.3

Q ss_pred             EEeecccccccccceeEEEEEecc
Q psy1340          26 RVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus        26 rvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      .+|-|++++++.. -+-|.|||..
T Consensus        38 S~Y~W~g~i~~~~-E~~l~~KT~~   60 (102)
T PF03091_consen   38 SIYRWEGKIEEEE-EVLLLIKTTA   60 (102)
T ss_dssp             EEEEETTEEEEEE-EEEEEEEEEG
T ss_pred             eEEEECCccccce-EeeEEEEecH
Confidence            4799999999764 4778899864


No 8  
>PRK10645 divalent-cation tolerance protein CutA; Provisional
Probab=54.91  E-value=12  Score=23.35  Aligned_cols=23  Identities=13%  Similarity=0.456  Sum_probs=18.3

Q ss_pred             EEeecccccccccceeEEEEEecc
Q psy1340          26 RVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus        26 rvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      .+|-|++.++.. +-+.|.|||..
T Consensus        48 S~Y~W~G~i~~~-~E~~l~iKT~~   70 (112)
T PRK10645         48 SLYYWEGKLEQE-YEVQMLLKTTV   70 (112)
T ss_pred             EEEEECCEEeee-eEEEEEEEeCH
Confidence            479999999765 45789999964


No 9  
>PF13532 2OG-FeII_Oxy_2:  2OG-Fe(II) oxygenase superfamily; PDB: 2IUW_A 3BTZ_A 3RZL_A 3RZH_A 3S5A_A 3RZG_A 3RZJ_A 3BUC_A 3H8X_A 3H8R_A ....
Probab=43.82  E-value=17  Score=21.99  Aligned_cols=9  Identities=44%  Similarity=0.803  Sum_probs=6.9

Q ss_pred             cceeEEEEE
Q psy1340          38 QNRISVQFK   46 (51)
Q Consensus        38 ~nRiSl~Fk   46 (51)
                      .+||||.||
T Consensus       186 ~~RislTfR  194 (194)
T PF13532_consen  186 GRRISLTFR  194 (194)
T ss_dssp             S-EEEEEEE
T ss_pred             CCEEEEEeC
Confidence            379999997


No 10 
>PF14508 GH97_N:  Glycosyl-hydrolase 97 N-terminal; PDB: 3A24_A 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A.
Probab=38.26  E-value=49  Score=22.38  Aligned_cols=22  Identities=23%  Similarity=0.532  Sum_probs=17.8

Q ss_pred             ceeeeeEEEEeccee----eEEEEee
Q psy1340           8 DIYTATILTLRGASY----VSYRVYD   29 (51)
Q Consensus         8 d~ytaT~ltLRG~sY----Vsyrvyd   29 (51)
                      |.|...+|+|++..=    |.||+||
T Consensus        77 ~~yne~~l~~~~~~~~~l~l~fRayd  102 (259)
T PF14508_consen   77 NHYNELTLSFKNKYGRRLNLEFRAYD  102 (259)
T ss_dssp             EEEEEEEEEECCCCCEEEEEEEEEET
T ss_pred             eeEEEEEEEEecCCCceeEEEEEEEc
Confidence            457778899999766    9999995


No 11 
>TIGR00218 manA mannose-6-phosphate isomerase, class I. The names phosphomannose isomerase and mannose-6-phosphate isomerase are synonomous. This family contains two rather deeply branched groups. One group contains an experimentally determined phosphomannose isomerase of Streptococcus mutans as well as three uncharacterized paralogous proteins of Bacillus subtilis, all at more than 50 % identity to each other, plus a more distant homolog from Archaeoglobus fulgidus. The other group contains members from E. coli, budding yeast, Borrelia burgdorferi, etc.
Probab=37.28  E-value=37  Score=23.18  Aligned_cols=24  Identities=21%  Similarity=0.174  Sum_probs=18.8

Q ss_pred             eeEEEEecceeeEEEEeecccccc
Q psy1340          12 ATILTLRGASYVSYRVYDWKDRVH   35 (51)
Q Consensus        12 aT~ltLRG~sYVsyrvydwkdrvh   35 (51)
                      ..++-+--+|-+.||+|||...+|
T Consensus       174 ~~~~Eiq~~SD~t~R~~d~~r~l~  197 (302)
T TIGR00218       174 GLVLEVMQNSDNVYRAGDTDKYLD  197 (302)
T ss_pred             ceEEEEEcCCCcEEEeeccCcccC
Confidence            456777788999999999975555


No 12 
>PRK10693 response regulator of RpoS; Provisional
Probab=34.60  E-value=25  Score=23.56  Aligned_cols=21  Identities=14%  Similarity=0.461  Sum_probs=18.6

Q ss_pred             EEeecccccccccceeEEEEE
Q psy1340          26 RVYDWKDRVHSSQNRISVQFK   46 (51)
Q Consensus        26 rvydwkdrvhs~~nRiSl~Fk   46 (51)
                      +=-+|+=+++...++|.|||.
T Consensus       281 ~~~~~~~~~~~~~~~~~~~~~  301 (303)
T PRK10693        281 RCDAWQCQIWGAGGRLRLMLS  301 (303)
T ss_pred             cccceeEEEecCCceeEEEec
Confidence            455899999999999999995


No 13 
>PF03531 SSrecog:  Structure-specific recognition protein (SSRP1);  InterPro: IPR000969 Human structure-specific recognition protein, SSRP1, [] binds specifically to DNA modified with the anti-cancer drug cisplatin. An 81kDa protein is predicted, containing several highly-charged domains and a stretch of 75 residues that share 47% identity with a portion of the high mobility group (HMG) protein HMG1. This HMG box probably constitutes the structure recognition element for cisplatin-modified DNA, the probable recognition motif being the local duplex unwinding and bending that occurs on formation of intra-strand cross-links []. SSRP1 is the human homologue of a recently identified mouse protein that binds to recombination signal sequences []. These sequences have been postulated to form stem-loop structures, further implicating local bends and unwinding in DNA as a recognition target for HMG-box proteins. A Drosophila melanogaster cDNA encoding an HMG-box-containing protein has also been isolated [, ]. This protein shares 50% sequence identity with human SSRP1. In vitro binding studies using Drosophila SSRP showed that the protein binds to single-stranded DNA and RNA, with highest affinity for nucleotides G and U. Comparison of the predicted amino acid sequences among SSRP family members reveals 48% identity, with structural conservation in the C terminus of the HMG box, as well as domains of highly charged residues. The most highly conserved regions lie in the poorly understood N terminus, suggesting that this portion of the protein is critical for its function []. This entry contains Pob3 Q04636 from SWISSPROT, which is a subunit of the heterodimeric yeast FACT complex (Spt16p (IPR013953 from INTERPRO)-Pob3p) []. The FACT complex facilitates RNA Polymerase II transcription elongation through nucleosomes by destabilising and then reassembling nucleosome structure [, ].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 3F5R_A 2GCL_B 2GCJ_D.
Probab=33.36  E-value=77  Score=22.11  Aligned_cols=29  Identities=34%  Similarity=0.498  Sum_probs=21.0

Q ss_pred             eeEEEEecceeeEEEEeecccccccccceeEEEEEe
Q psy1340          12 ATILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKL   47 (51)
Q Consensus        12 aT~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt   47 (51)
                      ++-+.|||.+| .|.|+      .+++.|+=|+=|.
T Consensus       157 ~~~lrl~Gkty-DykI~------y~~I~rlflLpk~  185 (222)
T PF03531_consen  157 PTFLRLHGKTY-DYKIQ------YSSISRLFLLPKP  185 (222)
T ss_dssp             SSEEEEEESSB-EEEEE------GGGEEEEEEEE-T
T ss_pred             ccccccccccc-ccccc------ccccccccccccc
Confidence            56788999998 46665      5788888776654


No 14 
>smart00632 Aamy_C Aamy_C domain.
Probab=31.68  E-value=76  Score=17.65  Aligned_cols=25  Identities=16%  Similarity=0.515  Sum_probs=15.1

Q ss_pred             ccceeceee----eeEEEEecceeeEEEE
Q psy1340           3 EGELCDIYT----ATILTLRGASYVSYRV   27 (51)
Q Consensus         3 Ege~Cd~yt----aT~ltLRG~sYVsyrv   27 (51)
                      .|+.||+-+    ...++..++..++..+
T Consensus        40 ~G~Y~d~l~g~~~g~~v~V~~~G~~~~~l   68 (81)
T smart00632       40 AGTYCDVISGLCTGKSVTVGSNGIATFTL   68 (81)
T ss_pred             CcceEEEecCcccCCEEEECCCCEEEEEE
Confidence            378888876    3456666444554443


No 15 
>PF12701 LSM14:  Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A.
Probab=31.56  E-value=23  Score=21.74  Aligned_cols=17  Identities=47%  Similarity=0.698  Sum_probs=13.9

Q ss_pred             Cccceeceee-eeEEEEe
Q psy1340           2 YEGELCDIYT-ATILTLR   18 (51)
Q Consensus         2 YEge~Cd~yt-aT~ltLR   18 (51)
                      |||..|.+.+ ..+|+|+
T Consensus        21 YeG~L~~Id~~~sTItL~   38 (96)
T PF12701_consen   21 YEGILYSIDTEDSTITLK   38 (96)
T ss_dssp             EEEEEEEEETTTTEEEEE
T ss_pred             EEEEEEEEcCCCCEEEee
Confidence            8999999997 5667775


No 16 
>PF08750 CNP1:  CNP1-like family;  InterPro: IPR014861 This group of proteins are likely to be lipoproteins. CNP1 (cryptic neisserial protein) has been expressed in Escherichia coli and shown to be localised periplasmicly []. 
Probab=30.87  E-value=24  Score=22.96  Aligned_cols=10  Identities=40%  Similarity=0.610  Sum_probs=7.9

Q ss_pred             CCccceecee
Q psy1340           1 MYEGELCDIY   10 (51)
Q Consensus         1 ~YEge~Cd~y   10 (51)
                      .|||=.|+-+
T Consensus        68 syEGirC~t~   77 (139)
T PF08750_consen   68 SYEGIRCATG   77 (139)
T ss_pred             eEEeEeecCC
Confidence            3899999844


No 17 
>KOG0337|consensus
Probab=30.46  E-value=15  Score=29.44  Aligned_cols=22  Identities=32%  Similarity=0.691  Sum_probs=16.1

Q ss_pred             eeeEEEEee---------cccccccccceeE
Q psy1340          21 SYVSYRVYD---------WKDRVHSSQNRIS   42 (51)
Q Consensus        21 sYVsyrvyd---------wkdrvhs~~nRiS   42 (51)
                      ++|+|+|+|         |.++.|+...|++
T Consensus       163 ~sveyVVfdEadrlfemgfqeql~e~l~rl~  193 (529)
T KOG0337|consen  163 SSVEYVVFDEADRLFEMGFQEQLHEILSRLP  193 (529)
T ss_pred             cceeeeeehhhhHHHhhhhHHHHHHHHHhCC
Confidence            689999998         5556677666664


No 18 
>PF15106 TMEM156:  TMEM156 protein family
Probab=30.25  E-value=27  Score=25.35  Aligned_cols=14  Identities=36%  Similarity=0.586  Sum_probs=12.0

Q ss_pred             ceeeeeEEEEecce
Q psy1340           8 DIYTATILTLRGAS   21 (51)
Q Consensus         8 d~ytaT~ltLRG~s   21 (51)
                      -.|.||.++|||++
T Consensus       210 hky~~ts~llrg~d  223 (226)
T PF15106_consen  210 HKYKPTSVLLRGSD  223 (226)
T ss_pred             cCCCcceEEEccCC
Confidence            36899999999984


No 19 
>PF05641 Agenet:  Agenet domain;  InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO []. The function of the agenet domain is unknown. This signature matches one of the two Agenet domains in the FMR proteins [].; GO: 0003723 RNA binding; PDB: 2BKD_N 3O8V_A 3KUF_A 3H8Z_A.
Probab=29.99  E-value=1e+02  Score=16.84  Aligned_cols=19  Identities=26%  Similarity=0.365  Sum_probs=14.1

Q ss_pred             ccceeceeeeeEEEEecce
Q psy1340           3 EGELCDIYTATILTLRGAS   21 (51)
Q Consensus         3 Ege~Cd~ytaT~ltLRG~s   21 (51)
                      +|-.|--+.||++...+.+
T Consensus        14 ~g~~gaWf~a~V~~~~~~~   32 (68)
T PF05641_consen   14 DGFRGAWFPATVLKENGDD   32 (68)
T ss_dssp             BTT--EEEEEEEEEEETT-
T ss_pred             CCCCcEEEEEEEEEeCCCc
Confidence            4667888999999999996


No 20 
>cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX10 may be involved in the regulation of endosome homeostasis. Its expression induces the formation of giant vacuoles in mammalian cells.
Probab=29.98  E-value=47  Score=19.96  Aligned_cols=21  Identities=14%  Similarity=0.350  Sum_probs=14.1

Q ss_pred             ceeeeeEEEE-ecceeeEEEEe
Q psy1340           8 DIYTATILTL-RGASYVSYRVY   28 (51)
Q Consensus         8 d~ytaT~ltL-RG~sYVsyrvy   28 (51)
                      ++..+++.+= .|++|++|.|-
T Consensus         3 ~V~dP~~~~~~~~~~y~~Y~I~   24 (113)
T cd06898           3 EVRDPRTHKEDDWGSYTDYEIF   24 (113)
T ss_pred             EEeCCcEecCCCCCCeEEEEEE
Confidence            4444555443 67899999886


No 21 
>PF06327 DUF1053:  Domain of Unknown Function (DUF1053);  InterPro: IPR009398 Cyclic AMP (cAMP) is a ubiquitous signalling molecule which mediates many cellular processes by activating cAMP-dependent kinases and also inducing protein-protein interactions. This molecule is produced by the adenylate cyclase (AC) enzyme, using ATP as its substrate. Mammalian adenylate cyclase has nine closely related membrane-bound isoforms (AC1-9) showing significant sequence homology and sharing the same overall structure: two hydrophobic transmembrane domains, and two cytoplasmic domains that are responsible for the catalytic activity. These isoforms differ in both their tissue specificity and their regulation. Regulatory factors known to influence one or more of these isoforms include G proteins, protein kinases, calcium and calmodulin. For more information see [, ]. This entry represents a region of unknown function found in many of these isoforms. It is part of the N-terminal cytoplasmic domain but its presence is not necessary for catalytic activity []. ; GO: 0004016 adenylate cyclase activity, 0009190 cyclic nucleotide biosynthetic process, 0016021 integral to membrane
Probab=29.15  E-value=28  Score=20.06  Aligned_cols=12  Identities=33%  Similarity=0.584  Sum_probs=9.8

Q ss_pred             cceeEEEEEecc
Q psy1340          38 QNRISVQFKLQN   49 (51)
Q Consensus        38 ~nRiSl~Fkt~~   49 (51)
                      ++|++|.|+...
T Consensus        77 ~~~~tL~F~d~~   88 (101)
T PF06327_consen   77 INRFTLRFKDKS   88 (101)
T ss_pred             cceeeEEECChH
Confidence            689999998754


No 22 
>PF13759 2OG-FeII_Oxy_5:  Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A.
Probab=28.25  E-value=44  Score=18.97  Aligned_cols=11  Identities=45%  Similarity=0.839  Sum_probs=7.3

Q ss_pred             ccccceeEEEE
Q psy1340          35 HSSQNRISVQF   45 (51)
Q Consensus        35 hs~~nRiSl~F   45 (51)
                      .+...||||.|
T Consensus        90 ~~~~~Risisf  100 (101)
T PF13759_consen   90 NSDEERISISF  100 (101)
T ss_dssp             -SSS-EEEEEE
T ss_pred             CCCCCEEEEEc
Confidence            35568999988


No 23 
>cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins. The PX domain is a phosphoinositide (PI) binding module involved in targeting proteins to PI-enriched membranes. Members in this subfamily are uncharacterized plant proteins containing an N-terminal PXA domain, a central PX domain, and a C-terminal domain that is conserved in some sorting nexins (SNXs). This is the same domain architecture found in SNX19. SNX13 and SNX14 also contain these three domains but also contain a regulator of G protein signaling (RGS) domain in between the PXA and PX domains. SNXs make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction dom
Probab=27.95  E-value=82  Score=18.86  Aligned_cols=25  Identities=24%  Similarity=0.335  Sum_probs=20.0

Q ss_pred             eeceeeeeEEEEecceeeEEEEeec
Q psy1340           6 LCDIYTATILTLRGASYVSYRVYDW   30 (51)
Q Consensus         6 ~Cd~ytaT~ltLRG~sYVsyrvydw   30 (51)
                      +|.|..|-++---+.+|+.|.|.-.
T Consensus         2 ~~~v~~~~~~~~~~~~y~vY~I~v~   26 (107)
T cd06872           2 SCRVLGAEIVKSGSKSFAVYSVAVT   26 (107)
T ss_pred             eeEEeeeEEEecCCccEEEEEEEEE
Confidence            5788888888777888999988743


No 24 
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1.  Fab1p is important for vacuole size regulation, presumably by modulating PtdIns(3,5)P2 effector activity. In the human homolog p235/PIKfyve deletion of this domain leads to loss of catalytic activity. However no exact function this domain has been defined. In general, chaperonins are involved in productive folding of proteins.
Probab=27.65  E-value=42  Score=22.66  Aligned_cols=17  Identities=24%  Similarity=0.344  Sum_probs=12.2

Q ss_pred             eeceeeeeEEEEeccee
Q psy1340           6 LCDIYTATILTLRGASY   22 (51)
Q Consensus         6 ~Cd~ytaT~ltLRG~sY   22 (51)
                      -|+...+.+|.|||++-
T Consensus       214 ~~~~~~~~TIlLRG~t~  230 (261)
T cd03334         214 GCPKELGCTILLRGGDL  230 (261)
T ss_pred             cCCCCceeEEEEECCCH
Confidence            35555567889999873


No 25 
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein. The ABR protein is similar to the breakpoint cluster region protein.  It has homology to guanine nucleotide exchange proteins and GTPase-activating proteins (GAPs).  ABR is expressed primarily in the brain, but also includes non-neuronal tissues such as the heart.  It has been associated with human diseases such as Miller-Dieker syndrome in which mental retardation and malformations of the heart are present.  ABR contains a RhoGEF domain and a PH-like domain upstream of its C2 domain and a RhoGAP domain downstream of this domain.  A few members also contain a Bcr-Abl oncoprotein oligomerization domain at the very N-terminal end. Splice variants of ABR have been identified. ABR is found in a wide variety of organisms including chimpanzee, dog, mouse, rat, fruit fly, and mosquito. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arr
Probab=27.65  E-value=1.2e+02  Score=19.08  Aligned_cols=34  Identities=15%  Similarity=0.204  Sum_probs=23.1

Q ss_pred             eEEEEecceeeEEEEeecc------c--ccccccceeEEEEE
Q psy1340          13 TILTLRGASYVSYRVYDWK------D--RVHSSQNRISVQFK   46 (51)
Q Consensus        13 T~ltLRG~sYVsyrvydwk------d--rvhs~~nRiSl~Fk   46 (51)
                      -.+.+.++..+++-+|||.      |  ..|...-|-++++.
T Consensus        50 F~i~l~~s~~L~~~v~d~~~~~~~~d~~~~d~~~G~g~i~Ld   91 (118)
T cd08686          50 FEIELEGSQTLRILCYEKCYSKVKLDGEGTDAIMGKGQIQLD   91 (118)
T ss_pred             EEEEeCCCCEEEEEEEEcccccccccccCcccEEEEEEEEEC
Confidence            3566779999999999994      1  34555555555553


No 26 
>PF04265 TPK_B1_binding:  Thiamin pyrophosphokinase, vitamin B1 binding domain;  InterPro: IPR007373 Thiamin pyrophosphokinase (TPK, 2.7.6.2 from EC) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis [].; GO: 0004788 thiamine diphosphokinase activity, 0009229 thiamine diphosphate biosynthetic process; PDB: 3LM8_B 1IG0_A 3CQ9_A 3L8M_B 3IHK_B 3MEL_B 2HH9_A 2F17_B 1IG3_B 2G9Z_A ....
Probab=27.31  E-value=39  Score=18.36  Aligned_cols=22  Identities=27%  Similarity=0.738  Sum_probs=14.6

Q ss_pred             Cccceeceee---eeEEEEecceee
Q psy1340           2 YEGELCDIYT---ATILTLRGASYV   23 (51)
Q Consensus         2 YEge~Cd~yt---aT~ltLRG~sYV   23 (51)
                      |||..|.+-.   .+.|+++|.-|=
T Consensus        11 ~~g~~~Sl~pl~~~~~vt~~Glky~   35 (68)
T PF04265_consen   11 YEGKYVSLFPLGEPVTVTIKGLKYP   35 (68)
T ss_dssp             CCEEEEEEEESSSEEEEEEESBSSE
T ss_pred             ccCCEEEEEECcCCeEEEEeCCEEE
Confidence            4566776543   244999998773


No 27 
>PHA00446 hypothetical protein
Probab=25.55  E-value=33  Score=22.00  Aligned_cols=11  Identities=55%  Similarity=0.975  Sum_probs=7.9

Q ss_pred             EEeeccccccc
Q psy1340          26 RVYDWKDRVHS   36 (51)
Q Consensus        26 rvydwkdrvhs   36 (51)
                      -||.|||+-.+
T Consensus        32 mVyRWKd~ks~   42 (89)
T PHA00446         32 MVYRWKDHKSS   42 (89)
T ss_pred             EEEEecccCCc
Confidence            37999997543


No 28 
>PF11113 Phage_head_chap:  Head assembly gene product;  InterPro: IPR021049  This head assembly protein is also refereed to as gene product 40 (Gp40). A specific gp20-gp40 membrane insertion structure constitutes the T4 prohead assembly initiation complex [].
Probab=24.55  E-value=1.6e+02  Score=17.24  Aligned_cols=30  Identities=27%  Similarity=0.530  Sum_probs=20.1

Q ss_pred             EEE-ecceeeEEEEeecccccccccceeEEEEEecc
Q psy1340          15 LTL-RGASYVSYRVYDWKDRVHSSQNRISVQFKLQN   49 (51)
Q Consensus        15 ltL-RG~sYVsyrvydwkdrvhs~~nRiSl~Fkt~~   49 (51)
                      |+| -|++++.|.-     .++=..-.+++.|.|..
T Consensus         7 I~l~dG~~hiVYi~-----~~~~~~G~l~vdfsT~~   37 (56)
T PF11113_consen    7 ITLEDGESHIVYIT-----ELHYDDGKLKVDFSTPS   37 (56)
T ss_pred             EEcCCCCEEEEEEE-----EEEEcCCeEEEEEeCCC
Confidence            445 8999998853     12223567889998853


No 29 
>cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) . Plexins are involved in the regulation of cell proliferation and of cellular adhesion and repulsion receptors. In general, there are three copies of the IPT domain present preceeded by SEMA (semaphorin) and PSI (plexin, semaphorin, integrin) domains.
Probab=23.32  E-value=50  Score=18.91  Aligned_cols=12  Identities=33%  Similarity=0.362  Sum_probs=9.8

Q ss_pred             eeEEEEecceee
Q psy1340          12 ATILTLRGASYV   23 (51)
Q Consensus        12 aT~ltLRG~sYV   23 (51)
                      -|.||++|.++-
T Consensus        16 GT~vTI~G~nl~   27 (94)
T cd01180          16 GTRLTICGSNLG   27 (94)
T ss_pred             CEEEEEEEEcCC
Confidence            589999997764


No 30 
>cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX9, also known as SH3PX1, is a cytosolic protein that interacts with proteins associated with clathrin-coated pits such as Cdc-42-associated tyrosine kinase 2 (ACK2). It contains an N-terminal Src Homology 3 (SH3) domain, a PX domain, and a C-terminal Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature. T
Probab=22.83  E-value=71  Score=20.37  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=15.1

Q ss_pred             eceeeeeEEE-Ee-cceeeEEEEeecc
Q psy1340           7 CDIYTATILT-LR-GASYVSYRVYDWK   31 (51)
Q Consensus         7 Cd~ytaT~lt-LR-G~sYVsyrvydwk   31 (51)
                      |-+..+..-. +- +++||+|.|-.+-
T Consensus         3 ~~V~dp~k~~~~~g~~~Yv~Y~I~~~~   29 (126)
T cd07285           3 CVVADPRKGSKMYGLKSYIEYQLTPTN   29 (126)
T ss_pred             EEEcCcccccCCCCCcCeEEEEEEecc
Confidence            4444444433 12 4899999998663


No 31 
>PF13511 DUF4124:  Domain of unknown function (DUF4124)
Probab=21.23  E-value=45  Score=17.31  Aligned_cols=8  Identities=50%  Similarity=1.236  Sum_probs=6.3

Q ss_pred             EEeecccc
Q psy1340          26 RVYDWKDR   33 (51)
Q Consensus        26 rvydwkdr   33 (51)
                      .||-|+|.
T Consensus        14 ~vYk~~D~   21 (60)
T PF13511_consen   14 EVYKWVDE   21 (60)
T ss_pred             cEEEEECC
Confidence            68999874


No 32 
>COG5165 POB3 Nucleosome-binding factor SPN, POB3 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics]
Probab=21.22  E-value=46  Score=26.62  Aligned_cols=28  Identities=36%  Similarity=0.612  Sum_probs=21.9

Q ss_pred             eEEEEecceeeEEEEeecccccccccceeEEEEEe
Q psy1340          13 TILTLRGASYVSYRVYDWKDRVHSSQNRISVQFKL   47 (51)
Q Consensus        13 T~ltLRG~sYVsyrvydwkdrvhs~~nRiSl~Fkt   47 (51)
                      +-+.|||.+| .|.||      |++++++-++=|.
T Consensus       232 ~~lRLrGktY-dyKi~------y~sI~~l~~LpK~  259 (508)
T COG5165         232 DYLRLRGKTY-DYKIY------YKSIKMLYVLPKI  259 (508)
T ss_pred             hhhhhccccc-ceeee------eeeeeEEEEeccC
Confidence            4578999998 57777      8888888776554


No 33 
>KOG4116|consensus
Probab=20.89  E-value=56  Score=20.89  Aligned_cols=18  Identities=39%  Similarity=0.909  Sum_probs=14.3

Q ss_pred             eEEEEeecccccccccce
Q psy1340          23 VSYRVYDWKDRVHSSQNR   40 (51)
Q Consensus        23 Vsyrvydwkdrvhs~~nR   40 (51)
                      |-|-+|||-.+-+.-.||
T Consensus        63 v~yliy~wg~e~ne~l~r   80 (90)
T KOG4116|consen   63 VAYLIYDWGKETNEALNR   80 (90)
T ss_pred             EEEEEEecchhHhHHHhc
Confidence            479999999887766655


Done!