BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy13404
         (167 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3I57|A Chain A, Type 2 Repeat Of The Mucus Binding Protein Mub From
           Lactobacillus Reuteri
 pdb|3I57|B Chain B, Type 2 Repeat Of The Mucus Binding Protein Mub From
           Lactobacillus Reuteri
          Length = 185

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 7/38 (18%)

Query: 67  EGSGEELFGDNLENDYRPMPALDRYDHDQLDDSDYSVI 104
           EG G ELF DN        PA +++D+D  +D  Y+VI
Sbjct: 42  EGDGYELFKDNF-------PAGEKFDNDDTNDQFYTVI 72


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.308    0.135    0.396 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,303,623
Number of Sequences: 62578
Number of extensions: 170747
Number of successful extensions: 217
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 214
Number of HSP's gapped (non-prelim): 7
length of query: 167
length of database: 14,973,337
effective HSP length: 92
effective length of query: 75
effective length of database: 9,216,161
effective search space: 691212075
effective search space used: 691212075
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 48 (23.1 bits)