RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy13412
         (137 letters)



>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases
           (retinol-DHs), classical (c) SDRs.  Classical SDR-like
           subgroup containing retinol-DHs and related proteins.
           Retinol is processed by a medium chain alcohol
           dehydrogenase followed by retinol-DHs. Proteins in this
           subfamily share the glycine-rich NAD-binding motif of
           the classical SDRs, have a partial match to the
           canonical active site tetrad, but lack the typical
           active site Ser. This subgroup includes the human
           proteins: retinol dehydrogenase -12, -13 ,and -14. SDRs
           are a functionally diverse family of oxidoreductases
           that have a single domain with a structurally conserved
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 274

 Score = 74.0 bits (182), Expect = 8e-17
 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 10/102 (9%)

Query: 46  DANLQTPTNH---YCK----NVLFHPPGANI---TNVNTYAVHPGVVDTELSRHFDSIIP 95
           D N +   N    YC+    NVLF    A     T V   A+HPGVV TEL RH      
Sbjct: 149 DLNSEKSYNTGFAYCQSKLANVLFTRELARRLQGTGVTVNALHPGVVRTELGRHTGIHHL 208

Query: 96  GTAWLYQRVGGLFIKSPLQGAQTTLYCALDKKCERETGLYYA 137
             + L   +   F+K+P +GAQT++Y AL ++ E  +G Y++
Sbjct: 209 FLSTLLNPLFWPFVKTPREGAQTSIYLALAEELEGVSGKYFS 250


>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase
           (retinol-DH), Light dependent Protochlorophyllide
           (Pchlide) OxidoReductase (LPOR) and related proteins,
           classical (c) SDRs.  Classical SDR subgroup containing
           retinol-DHs, LPORs, and related proteins. Retinol is
           processed by a medium chain alcohol dehydrogenase
           followed by retinol-DHs. Pchlide reductases act in
           chlorophyll biosynthesis. There are distinct enzymes
           that catalyze Pchlide reduction in light or dark
           conditions. Light-dependent reduction is via an
           NADP-dependent SDR, LPOR. Proteins in this subfamily
           share the glycine-rich NAD-binding motif of the
           classical SDRs, have a partial match to the canonical
           active site tetrad, but lack the typical active site
           Ser. This subgroup includes the human proteins: retinol
           dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase
           SDR family member (DHRS)-12 , -13 and -X (a DHRS on
           chromosome X), and WWOX (WW domain-containing
           oxidoreductase), as well as a Neurospora crassa SDR
           encoded by the blue light inducible bli-4 gene. SDRs are
           a functionally diverse family of oxidoreductases that
           have a single domain with a structurally conserved
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 269

 Score = 64.9 bits (159), Expect = 2e-13
 Identities = 29/71 (40%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 68  NITNVNTYAVHPGVVDTELSRHFDSIIPGTAWLYQRVGGLFIK-SPLQGAQTTLYCALDK 126
             T V   A+HPGVV TEL R       G+ +L  ++   F+K SP QGAQT LY A   
Sbjct: 183 EGTGVTVNALHPGVVRTELLRRN-----GSFFLLYKLLRPFLKKSPEQGAQTALYAATSP 237

Query: 127 KCERETGLYYA 137
           + E  +G Y++
Sbjct: 238 ELEGVSGKYFS 248


>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional.
          Length = 306

 Score = 41.2 bits (97), Expect = 4e-05
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 65  PGANITNVNTYAVHPGVVDTELSRHFDSII-PGTAWLYQRVGGLFIKSPLQGAQTTLYCA 123
            GA    V   A HPGV +TEL+R+    + P    L      L  +SP  GA  TL  A
Sbjct: 199 AGATTIAV---AAHPGVSNTELARNLPRALRPVATVL----APLLAQSPEMGALPTLRAA 251

Query: 124 LD 125
            D
Sbjct: 252 TD 253


>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW
           domain-containing oxidoreductase)-like, classical
           (c)-like SDRs.  Classical-like SDR domain of human WWOX
           and related proteins. Proteins in this subfamily share
           the glycine-rich NAD-binding motif of the classical
           SDRs, have a partial match to the canonical active site
           tetrad, but lack the typical active site Ser. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 284

 Score = 40.3 bits (94), Expect = 1e-04
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 72  VNTYAVHPG-VVDTELSRHFDSIIPGTAWLYQRVGGL---FIKSPLQGAQTTLYCALDKK 127
           + + ++HPG ++ + + R++        W+Y  +  L   F KS  QGA TT+YCA   +
Sbjct: 193 ITSNSLHPGNMMYSSIHRNW--------WVYTLLFTLARPFTKSMQQGAATTVYCATAPE 244

Query: 128 CERETGLYY 136
            E   G+Y+
Sbjct: 245 LEGLGGMYF 253


>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional.
          Length = 315

 Score = 37.7 bits (88), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 7/69 (10%)

Query: 72  VNTYAVHPGVVDTELSRHF---DSIIPGTAWLYQ--RVGGLFIKSPLQGAQTTLYCALDK 126
           V  ++VHPG + T L RH    + +  G  W+ +         K+P QGA T ++ A   
Sbjct: 204 VRAFSVHPGGILTPLQRHLPREEQVALG--WVDEHGNPIDPGFKTPAQGAATQVWAATSP 261

Query: 127 KCERETGLY 135
           +     GLY
Sbjct: 262 QLAGMGGLY 270


>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl
           reductase (PTCR)-like, classical (c) SDRs.  PTCR is a
           classical SDR which catalyzes the NADPH-dependent
           reduction of ketones on steroids and prostaglandins.
           Unlike most SDRs, PTCR functions as a monomer. This
           subgroup also includes human carbonyl reductase 1 (CBR1)
           and CBR3. CBR1 is an NADPH-dependent SDR with broad
           substrate specificity and may be responsible for the in
           vivo reduction of quinones, prostaglandins, and other
           carbonyl-containing compounds. In addition it includes
           poppy NADPH-dependent salutaridine reductase which
           catalyzes the stereospecific reduction of salutaridine
           to 7(S)-salutaridinol in the biosynthesis of morphine,
           and Arabidopsis SDR1,a menthone reductase, which
           catalyzes the reduction of menthone to neomenthol, a
           compound with antimicrobial activity; SDR1  can also
           carry out neomenthol oxidation. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase
           (15-PGDH) numbering). In addition to the Tyr and Lys,
           there is often an upstream Ser (Ser-138, 15-PGDH
           numbering) and/or an Asn (Asn-107, 15-PGDH numbering)
           contributing to the active site; while substrate binding
           is in the C-terminal region, which determines
           specificity. The standard reaction mechanism is a
           4-pro-S hydride transfer and proton relay involving the
           conserved Tyr and Lys, a water molecule stabilized by
           Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
           Some atypical SDRs have lost catalytic activity and/or
           have an unusual NAD(P)-binding motif and missing or
           unusual active site residues. Reactions catalyzed within
           the SDR family include isomerization, decarboxylation,
           epimerization, C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 225

 Score = 31.8 bits (73), Expect = 0.063
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 17/56 (30%)

Query: 70  TNVNTYAVHPGVVDTELSRHFDSIIPGTAWLYQRVGGLFIKSPLQGAQTTLYCALD 125
           T +   A  PG V T++         G A           K+P +GA+T +Y AL 
Sbjct: 168 TGIKVNACCPGWVKTDMG-------GGKAP----------KTPEEGAETPVYLALL 206


>gnl|CDD|163175 TIGR03178, allantoinase, allantoinase.  This enzyme carries out
          the first step in the degradation of allantoin, a
          ring-opening hydrolysis. The seed members of this model
          are all in the vicinity of other genes involved in the
          processes of xanthine/urate/allantoin catabolism.
          Although not included in the seed, many eukaryotic
          homologs of this family are included above the trusted
          cutoff. Below the noise cutoff are related
          hydantoinases.
          Length = 443

 Score = 30.8 bits (70), Expect = 0.19
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 5/37 (13%)

Query: 64 PPGANITNVNTYAVHPGVVDTELSRHFDSIIPG-TAW 99
           P A I +     V PGVVDT +  H +   PG T W
Sbjct: 36 GPAAKIIDAGGLVVFPGVVDTHV--HINE--PGRTEW 68


>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
           Provisional.
          Length = 251

 Score = 29.8 bits (68), Expect = 0.37
 Identities = 10/19 (52%), Positives = 11/19 (57%), Gaps = 2/19 (10%)

Query: 72  VNTYAVHPGVVDTELSRHF 90
           VN  AV P VV+T L   F
Sbjct: 179 VN--AVAPVVVETGLLEAF 195


>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated.
          Length = 238

 Score = 29.5 bits (67), Expect = 0.52
 Identities = 7/16 (43%), Positives = 11/16 (68%)

Query: 76  AVHPGVVDTELSRHFD 91
            VHPG +DT+++   D
Sbjct: 173 GVHPGPIDTDMAAGLD 188


>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7.  These proteins are
           members of the classical SDR family, with a canonical
           active site triad (and also an active site Asn) and a
           typical Gly-rich NAD-binding motif. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRS are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes have a
           3-glycine N-terminal NAD(P)(H)-binding pattern
           (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
           extended SDRs), while substrate binding is in the
           C-terminal region. A critical catalytic Tyr residue
           (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
           (15-PGDH) numbering), is often found in a conserved
           YXXXK pattern. In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) or additional
           Ser, contributing to the active site. Substrates for
           these enzymes include sugars, steroids, alcohols, and
           aromatic compounds. The standard reaction mechanism is a
           proton relay involving the conserved Tyr and Lys, as
           well as Asn (or Ser). Some SDR family members, including
           17 beta-hydroxysteroid dehydrogenase contain an
           additional helix-turn-helix motif that is not generally
           found among SDRs.
          Length = 235

 Score = 28.9 bits (65), Expect = 0.63
 Identities = 6/21 (28%), Positives = 10/21 (47%)

Query: 71  NVNTYAVHPGVVDTELSRHFD 91
                +VHPG +DT ++    
Sbjct: 169 GTLVLSVHPGPIDTRMAAGAG 189


>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs.  SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 234

 Score = 28.8 bits (65), Expect = 0.78
 Identities = 15/68 (22%), Positives = 25/68 (36%), Gaps = 5/68 (7%)

Query: 66  GANITNVNTYAVHPGVVDTELSRHFDSIIPGTAWLYQRVGGLFIKSPLQGAQTTLYCALD 125
              I  VN  AV PG+VDT +             L   +    + +P + A+  ++    
Sbjct: 166 PYGIR-VN--AVAPGLVDTPMLAKLGP-EEAEKELAAAIPLGRLGTPEEVAEAVVF-LAS 220

Query: 126 KKCERETG 133
            +    TG
Sbjct: 221 DEASYITG 228


>gnl|CDD|181609 PRK09009, PRK09009, C factor cell-cell signaling protein;
           Provisional.
          Length = 235

 Score = 28.5 bits (64), Expect = 1.0
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 68  NITNVNTYAVHPGVVDTELSRHFDSIIPG 96
           ++ +    A+HPG  DT LS+ F   +P 
Sbjct: 169 SLKHGVVLALHPGTTDTALSKPFQQNVPK 197


>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional.
          Length = 257

 Score = 28.5 bits (64), Expect = 1.1
 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 2/22 (9%)

Query: 71  NVNTYAVHPGVVDTELSRHFDS 92
           NVN  A+ PGVVDT +    D+
Sbjct: 177 NVN--AIAPGVVDTPMWDQVDA 196


>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR
           family member (DHRS)-12/FLJ13639-like, classical
           (c)-like SDRs.  Classical SDR-like subgroup containing
           human DHRS-12/FLJ13639, the 36K protein of zebrafish CNS
           myelin, and related proteins. DHRS-12/FLJ13639 is
           expressed in neurons and oligodendrocytes in the human
           cerebral cortex. Proteins in this subgroup share the
           glycine-rich NAD-binding motif of the classical SDRs,
           have a partial match to the canonical active site
           tetrad, but lack the typical active site Ser. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRs are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes catalyze a
           wide range of activities including the metabolism of
           steroids, cofactors, carbohydrates, lipids, aromatic
           compounds, and amino acids, and act in redox sensing.
           Classical SDRs have an TGXXX[AG]XG cofactor binding
           motif and a YXXXK active site motif, with the Tyr
           residue of the active site motif serving as a critical
           catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 255

 Score = 28.3 bits (63), Expect = 1.2
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 71  NVNTYAVHPGVVDTELSRHFDSIIPGTAWLYQRVGGLFIKSPLQGAQTTLYCALDKKC-E 129
            ++   +HPG  DT   R   + +P     + R     ++S  QGA T ++ AL     +
Sbjct: 183 EIHFSVMHPGWADTPAVR---NSMPD---FHARFKDR-LRSEEQGADTVVWLALSSAAAK 235

Query: 130 RETGLYY 136
             +G +Y
Sbjct: 236 APSGRFY 242


>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein.  This entry is a highly
           conserved protein present in eukaryotes.
          Length = 680

 Score = 28.0 bits (62), Expect = 2.2
 Identities = 10/48 (20%), Positives = 24/48 (50%)

Query: 28  KEILGRTKRFSNPTILLCDANLQTPTNHYCKNVLFHPPGANITNVNTY 75
            EI+    + ++   ++ ++ +++ T HY  N L  PP   ++  + Y
Sbjct: 630 AEIVDLKSKIADILAVMPESRIRSVTPHYSANFLEKPPLVRLSPTSEY 677


>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
           Provisional.
          Length = 249

 Score = 27.1 bits (61), Expect = 2.7
 Identities = 9/25 (36%), Positives = 12/25 (48%), Gaps = 4/25 (16%)

Query: 68  NITNVNTYAVHPGVVDTE-LSRHFD 91
            IT VN   V PG +DT+      +
Sbjct: 178 GIT-VN--MVAPGDIDTDMKEATIE 199


>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related
           to short-chain alcohol dehydrogenases) [Secondary
           metabolites biosynthesis, transport, and catabolism /
           General function prediction only].
          Length = 251

 Score = 27.1 bits (60), Expect = 2.7
 Identities = 7/23 (30%), Positives = 12/23 (52%)

Query: 70  TNVNTYAVHPGVVDTELSRHFDS 92
             +   AV PG +DT ++   +S
Sbjct: 177 RGIRVNAVAPGYIDTPMTAALES 199


>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase;
           Reviewed.
          Length = 251

 Score = 27.2 bits (61), Expect = 2.9
 Identities = 12/18 (66%), Positives = 13/18 (72%), Gaps = 3/18 (16%)

Query: 68  NITNVNTYAVHPGVVDTE 85
           NIT VN  +VHPG VDT 
Sbjct: 178 NIT-VN--SVHPGGVDTP 192


>gnl|CDD|219780 pfam08286, Spc24, Spc24 subunit of Ndc80.  Spc24 is a component of
           the evolutionarily conserved kinetochore-associated
           Ndc80 complex and is involved in chromosome segregation.
          Length = 117

 Score = 26.5 bits (59), Expect = 3.0
 Identities = 8/22 (36%), Positives = 10/22 (45%)

Query: 69  ITNVNTYAVHPGVVDTELSRHF 90
           I N N   V    +D +LS  F
Sbjct: 87  IRNDNKGDVQVLNLDNKLSPFF 108


>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein;
           Provisional.
          Length = 530

 Score = 27.2 bits (61), Expect = 3.1
 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 4/19 (21%)

Query: 37  FSNPTILLCDANLQTPTNH 55
           FSNP ILL D     PTN+
Sbjct: 171 FSNPDILLLD----EPTNN 185


>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase;
           Validated.
          Length = 246

 Score = 26.7 bits (60), Expect = 3.7
 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 3/21 (14%)

Query: 68  NITNVNTYAVHPGVVDTELSR 88
            IT VN  AV PG +DT+++ 
Sbjct: 176 GIT-VN--AVAPGFIDTDMTE 193


>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme
           A_reductase (ChcA)_like, classical (c) SDRs.  This
           subgroup contains classical SDR proteins, including
           members identified as 1-cyclohexenylcarbonyl coenzyme A
           reductase. ChcA of Streptomyces collinus is implicated
           in the final reduction step of shikimic acid to
           ansatrienin. ChcA shows sequence similarity to the SDR
           family of NAD-binding proteins, but it lacks the
           conserved Tyr of the characteristic catalytic site. This
           subgroup also contains the NADH-dependent
           enoyl-[acyl-carrier-protein(ACP)] reductase FabL from
           Bacillus subtilis. This enzyme participates in bacterial
           fatty acid synthesis, in type II fatty-acid synthases
           and catalyzes the last step in each elongation cycle.
           SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRS are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes have a 3-glycine N-terminal NAD(P)(H)-binding
           pattern (typically, TGxxxGxG in classical SDRs and
           TGxxGxxG in extended SDRs), while substrate binding is
           in the C-terminal region. A critical catalytic Tyr
           residue (Tyr-151, human 15-hydroxyprostaglandin
           dehydrogenase (15-PGDH) numbering), is often found in a
           conserved YXXXK pattern. In addition to the Tyr and Lys,
           there is often an upstream Ser (Ser-138, 15-PGDH
           numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or
           additional Ser, contributing to the active site.
           Substrates for these enzymes include sugars, steroids,
           alcohols, and aromatic compounds. The standard reaction
           mechanism is a proton relay involving the conserved Tyr
           and Lys, as well as Asn (or Ser). Some SDR family
           members, including 17 beta-hydroxysteroid dehydrogenase
           contain an additional helix-turn-helix motif that is not
           generally found among SDRs.
          Length = 242

 Score = 26.9 bits (60), Expect = 3.7
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 2/20 (10%)

Query: 71  NVNTYAVHPGVVDTELSRHF 90
            VN   V PGV+DT+   HF
Sbjct: 172 RVNA--VSPGVIDTDALAHF 189


>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein;
           Provisional.
          Length = 265

 Score = 26.5 bits (58), Expect = 4.6
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 52  PTNHYCKNVLFHPPGANITNVNTYAVHPGVVDTELSRHFDSIIPGTAWLYQRVG-GLFIK 110
           P NHY   ++ HP   NI    +  V P  V   +S  F    P    +++ V  GL I+
Sbjct: 70  PGNHYEGEIILHPDNVNIL---SPEVDPIEVRMRISMVFQKPNPFPKSIFENVAYGLRIR 126


>gnl|CDD|224640 COG1726, NqrA, Na+-transporting NADH:ubiquinone oxidoreductase,
           subunit NqrA [Energy production and conversion].
          Length = 447

 Score = 26.6 bits (59), Expect = 4.8
 Identities = 22/78 (28%), Positives = 29/78 (37%), Gaps = 17/78 (21%)

Query: 55  HYCKNVLFHPPGANITNVNTYAV---HP-GVVDTELSRHFDSIIPGTA----WL--YQRV 104
           H CK     PP   ++N + +     HP G+  T    H   I P  A    W   YQ V
Sbjct: 190 HVCKAAGTLPPQELLSNAHLHEFSGPHPAGLPGT----HIHFIAPVGATKVVWTINYQDV 245

Query: 105 ---GGLFIKSPLQGAQTT 119
              G LF+   L   +  
Sbjct: 246 IAIGKLFLTGELLTERVV 263


>gnl|CDD|185752 cd08961, GH64-TLP-SF, glycoside hydrolase family 64
          (beta-1,3-glucanases which produce specific
          pentasaccharide oligomers) and thaumatin-like proteins.
           This superfamily includes glycoside hydrolases of
          family 64 (GH64), these are mostly bacterial
          beta-1,3-glucanases which cleave long-chain
          polysaccharide beta-1,3-glucans, into specific
          pentasaccharide oligomers  and are implicated in fungal
          cell wall degradation. Also included in this
          superfamily are thaumatin, the sweet-tasting protein
          from the African berry Thaumatococcus daniellii, and
          thaumatin-like proteins (TLPs) which are involved in
          host defense and a wide range of developmental
          processes in fungi, plants, and animals. Like GH64s,
          some TLPs also hydrolyze the beta-1,3-glucans of the
          type commonly found in fungal walls. Plant TLPs are
          classified as pathogenesis-related (PR) protein family
          5 (PR5), their expression is induced by environmental
          stresses such as pathogen/pest attack, drought and
          cold. Several members of the plant TLP family have been
          reported as food allergens from fruits, and pollen
          allergens from conifers. Streptomyces matensis
          laminaripentaose-producing, beta-1,3-glucanase
          (GH64-LPHase), and TLPs have in common, a core
          N-terminal barrel domain (domain I) composed of 10
          beta-strands, two coming from the C-terminal region of
          the protein. In TLPs, this core domain is flanked by
          two shorter domains (domains II and III). Small TLPs,
          such as Triticum aestivum thaumatin-like xylanase
          inhibitor, have a deletion in the third domain (domain
          II). GH64-LPHase has a second C-terminal domain which
          corresponds positional to, but is much larger than,
          domain III of TLP. GH64-LPHase and TLPs are described
          as crescent-fold structures. Critical functional
          residues, common to GH64-LPHase and TLPs are a Glu and
          an Asp residue. LPHase has an electronegative,
          substrate-binding cleft and the afore mentioned
          conserved Glu and Asp residues are the catalytic
          residues essential for beta-1,3-glucan cleavage. In
          TLPs, these residues are two of the four conserved
          residues which contribute to the strong electronegative
          character of the cleft which is associated with the
          antifungal activity of TLPs.
          Length = 153

 Score = 26.0 bits (57), Expect = 5.4
 Identities = 13/30 (43%), Positives = 15/30 (50%)

Query: 69 ITNVNTYAVHPGVVDTELSRHFDSIIPGTA 98
          ITN   Y V    + TELS   D+  PG A
Sbjct: 3  ITNNCGYQVWIYNLGTELSSAPDASGPGLA 32


>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid
           dehydrogenase XI-like, classical (c) SDRs.
           17-beta-hydroxysteroid dehydrogenases (17betaHSD) are a
           group of isozymes that catalyze activation and
           inactivation of estrogen and androgens. 17betaHSD type
           XI, a classical SDR, preferentially converts
           3alpha-adiol to androsterone but not numerous other
           tested steroids. This subgroup of classical SDRs also
           includes members identified as retinol dehydrogenases,
           which convert retinol to retinal, a property that
           overlaps with 17betaHSD activity. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold (alpha/beta folding pattern with a central
           beta-sheet), an NAD(P)(H)-binding region, and a
           structurally diverse C-terminal region. Classical SDRs
           are typically about 250 residues long, while extended
           SDRS are approximately 350 residues. Sequence identity
           between different SDR enzymes are typically in the
           15-30% range, but the enzymes share the Rossmann fold
           NAD-binding motif and characteristic NAD-binding and
           catalytic sequence patterns. These enzymes have a
           3-glycine N-terminal NAD(P)(H)-binding pattern
           (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
           extended SDRs), while substrate binding is in the
           C-terminal region. A critical catalytic Tyr residue
           (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
           (15-PGDH) numbering), is often found in a conserved
           YXXXK pattern. In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) or additional
           Ser, contributing to the active site. Substrates for
           these enzymes include sugars, steroids, alcohols, and
           aromatic compounds. The standard reaction mechanism is a
           proton relay involving the conserved Tyr and Lys, as
           well as Asn (or Ser). Some SDR family members, including
           17 beta-hydroxysteroid dehydrogenase contain an
           additional helix-turn-helix motif that is not generally
           found among SDRs.
          Length = 243

 Score = 26.1 bits (58), Expect = 7.4
 Identities = 4/26 (15%), Positives = 10/26 (38%)

Query: 67  ANITNVNTYAVHPGVVDTELSRHFDS 92
                + T  V P  ++T + +   +
Sbjct: 169 YGKPGIKTTLVCPYFINTGMFQGVKT 194


>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase
           sniffer-like, classical (c) SDRs.  Sniffer is an
           NADPH-dependent carbonyl reductase of the classical SDR
           family. Studies in Drosophila melanogaster implicate
           Sniffer in the prevention of neurodegeneration due to
           aging and oxidative-stress. This subgroup also includes
           Rhodococcus sp. AD45 IsoH, which is an NAD-dependent
           1-hydroxy-2-glutathionyl-2-methyl-3-butene dehydrogenase
           involved in isoprene metabolism, Aspergillus nidulans
           StcE encoded by a gene which is part of a proposed
           sterigmatocystin biosynthesis gene cluster, Bacillus
           circulans SANK 72073 BtrF encoded by a gene found in the
           butirosin biosynthesis gene cluster, and Aspergillus
           parasiticus nor-1 involved in the biosynthesis of
           aflatoxins. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase (15-PGDH)
           numbering). In addition to the Tyr and Lys, there is
           often an upstream Ser (Ser-138, 15-PGDH numbering)
           and/or an Asn (Asn-107, 15-PGDH numbering) contributing
           to the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type ketoacyl reductases have a
           TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 233

 Score = 25.7 bits (57), Expect = 8.5
 Identities = 5/14 (35%), Positives = 9/14 (64%)

Query: 75  YAVHPGVVDTELSR 88
            ++HPG V T++  
Sbjct: 177 VSLHPGWVRTDMGG 190


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.139    0.459 

Gapped
Lambda     K      H
   0.267   0.0762    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,922,065
Number of extensions: 583594
Number of successful extensions: 471
Number of sequences better than 10.0: 1
Number of HSP's gapped: 467
Number of HSP's successfully gapped: 31
Length of query: 137
Length of database: 10,937,602
Length adjustment: 87
Effective length of query: 50
Effective length of database: 7,078,804
Effective search space: 353940200
Effective search space used: 353940200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (24.5 bits)