Query         psy13428
Match_columns 67
No_of_seqs    164 out of 1105
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 19:13:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy13428.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/13428hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1219 ClpX ATP-dependent pro  99.9 4.7E-23   1E-27  159.5   1.4   55    2-60     49-103 (408)
  2 KOG0745|consensus               99.8 4.3E-21 9.3E-26  152.8   2.8   38    2-39    133-170 (564)
  3 COG1220 HslU ATP-dependent pro  99.5 4.2E-14 9.1E-19  110.8   4.0   45    2-46      3-47  (444)
  4 PRK05342 clpX ATP-dependent pr  99.4 2.3E-13 4.9E-18  104.0   4.6   39    2-40     59-97  (412)
  5 TIGR00382 clpX endopeptidase C  99.4 2.5E-13 5.4E-18  104.5   4.0   38    2-39     65-102 (413)
  6 TIGR00390 hslU ATP-dependent p  99.3 7.6E-13 1.6E-17  103.7   4.3   40    3-42      1-40  (441)
  7 PRK05201 hslU ATP-dependent pr  99.0 2.2E-10 4.7E-15   90.1   4.1   39    3-41      4-42  (443)
  8 PRK11034 clpA ATP-dependent Cl  87.7    0.48 1.1E-05   39.5   2.7   30    6-35    450-479 (758)
  9 CHL00095 clpC Clp protease ATP  87.0     0.6 1.3E-05   38.6   2.9   32    6-37    501-532 (821)
 10 PF06309 Torsin:  Torsin;  Inte  86.4     1.4 3.1E-05   29.8   4.0   33    4-36     15-47  (127)
 11 TIGR02880 cbbX_cfxQ probable R  83.9     1.8   4E-05   31.3   3.9   36    5-40     13-49  (284)
 12 PF01078 Mg_chelatase:  Magnesi  80.4       1 2.2E-05   32.5   1.5   18   16-33      5-22  (206)
 13 TIGR02639 ClpA ATP-dependent C  79.0     1.8   4E-05   35.3   2.6   26    6-31    446-471 (731)
 14 CHL00081 chlI Mg-protoporyphyr  69.5       2 4.4E-05   32.9   0.7   18   16-33     19-36  (350)
 15 TIGR03345 VI_ClpV1 type VI sec  68.2     3.9 8.4E-05   34.5   2.1   28    5-32    557-584 (852)
 16 COG0606 Predicted ATPase with   56.2     6.6 0.00014   32.2   1.4   17   15-31    180-196 (490)
 17 COG0542 clpA ATP-binding subun  51.2      14 0.00029   31.9   2.5   26    6-31    483-508 (786)
 18 KOG1051|consensus               49.5      17 0.00038   31.7   3.0   27    6-32    554-580 (898)
 19 COG1223 Predicted ATPase (AAA+  44.5      13 0.00029   29.5   1.4   16   15-30    122-137 (368)
 20 PF08700 Vps51:  Vps51/Vps67;    43.2      52  0.0011   19.2   3.6   36    4-39     20-55  (87)
 21 KOG2170|consensus               43.1      31 0.00067   27.3   3.2   30    7-36     75-104 (344)
 22 cd03734 SOCS_CIS1 SOCS (suppre  40.7      21 0.00046   19.9   1.5   14    2-15     24-37  (41)
 23 cd03738 SOCS_SOCS4 SOCS (suppr  40.3      20 0.00044   21.5   1.5   18    2-19     26-43  (56)
 24 PF13654 AAA_32:  AAA domain; P  40.1     9.5 0.00021   30.6   0.0   17   14-30      8-24  (509)
 25 cd03736 SOCS_SOCS2 SOCS (suppr  40.1      22 0.00048   19.6   1.5   15    2-16     24-38  (41)
 26 COG2255 RuvB Holliday junction  39.1      18  0.0004   28.5   1.4   22   11-33     24-45  (332)
 27 cd03735 SOCS_SOCS1 SOCS (suppr  38.3      24 0.00052   20.0   1.5   14    2-15     26-39  (43)
 28 TIGR02030 BchI-ChlI magnesium   37.7      19  0.0004   27.4   1.2   18   15-32      5-22  (337)
 29 TIGR03346 chaperone_ClpB ATP-d  37.7      34 0.00074   28.7   2.9   27    7-33    558-584 (852)
 30 PF09702 Cas_Csa5:  CRISPR-asso  36.0      47   0.001   22.3   2.8   30    2-31     72-101 (105)
 31 PRK13407 bchI magnesium chelat  32.6      26 0.00057   26.6   1.4   16   15-30      9-24  (334)
 32 cd03740 SOCS_SOCS6 SOCS (suppr  32.0      33 0.00071   18.9   1.4   14    2-15     26-39  (41)
 33 TIGR02442 Cob-chelat-sub cobal  32.0      25 0.00055   28.5   1.2   19   15-33      5-23  (633)
 34 COG1738 yhhQ Uncharacterized m  30.4      69  0.0015   23.6   3.2   34    2-40    122-155 (233)
 35 cd03717 SOCS_SOCS_like SOCS (s  30.1      37 0.00081   18.2   1.4   14    2-15     26-39  (39)
 36 PRK07471 DNA polymerase III su  29.8      30 0.00064   26.4   1.2   25    3-32     13-37  (365)
 37 PF12630 Pox_polyA_pol_N:  Poxv  29.6      45 0.00097   22.6   1.9   23    3-25     60-82  (108)
 38 cd03742 SOCS_Rab40 SOCS (suppr  28.8      43 0.00093   19.0   1.5   17    2-18     26-42  (43)
 39 PRK00665 petG cytochrome b6-f   28.7      42 0.00092   18.9   1.4   11   26-36     21-31  (37)
 40 cd03737 SOCS_SOCS3 SOCS (suppr  28.6      32 0.00069   19.3   0.9   11    5-15     28-38  (42)
 41 CHL00181 cbbX CbbX; Provisiona  27.0 1.5E+02  0.0034   21.6   4.5   21    6-26     15-35  (287)
 42 PF12875 DUF3826:  Protein of u  25.7 1.2E+02  0.0025   22.3   3.6   30    6-40     11-42  (188)
 43 PRK10865 protein disaggregatio  25.4      58  0.0013   27.6   2.3   27    6-32    560-586 (857)
 44 cd03739 SOCS_SOCS5 SOCS (suppr  25.1      52  0.0011   19.8   1.4   18    2-19     26-43  (57)
 45 CHL00008 petG cytochrome b6/f   24.4      59  0.0013   18.3   1.5   12   26-37     21-32  (37)
 46 PF13865 FoP_duplication:  C-te  22.4 1.9E+02  0.0041   17.4   3.9   29    3-34     40-68  (74)
 47 PF10638 Sfi1_C:  Spindle body   21.8      96  0.0021   20.9   2.4   27   14-40     21-47  (108)
 48 PF11823 DUF3343:  Protein of u  21.5      26 0.00057   20.5  -0.3    9    1-9      30-38  (73)
 49 smart00253 SOCS suppressors of  21.2      69  0.0015   17.4   1.4   14    2-15     30-43  (43)
 50 PF10309 DUF2414:  Protein of u  21.1      80  0.0017   19.0   1.8   14    3-16     16-29  (62)
 51 PF13867 SAP30_Sin3_bdg:  Sin3   20.3 1.8E+02   0.004   16.4   3.2   19   20-38     20-38  (53)

No 1  
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.86  E-value=4.7e-23  Score=159.47  Aligned_cols=55  Identities=44%  Similarity=0.622  Sum_probs=49.5

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhccCCCCccccccccccccccc
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNNISSSPSQSQASAKTQDISLM   60 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~~~~q~~~~~~~~~~~~~~~~   60 (67)
                      +|||+||+++||+|||||++|||+|||||||||+|++...    ..+.+|+.|||++|-
T Consensus        49 lPtP~eik~~Ld~YVIGQe~AKKvLsVAVYNHYKRl~~~~----~~~dvEL~KSNILLi  103 (408)
T COG1219          49 LPTPKEIKAHLDEYVIGQEQAKKVLSVAVYNHYKRLNNKE----DNDDVELSKSNILLI  103 (408)
T ss_pred             CCChHHHHHHhhhheecchhhhceeeeeehhHHHHHhccC----CCCceeeeeccEEEE
Confidence            7999999999999999999999999999999999999776    222399999998873


No 2  
>KOG0745|consensus
Probab=99.82  E-value=4.3e-21  Score=152.81  Aligned_cols=38  Identities=71%  Similarity=0.992  Sum_probs=37.1

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYN   39 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~   39 (67)
                      +|||+||++|||+|||||++|||+|||||||||+||.+
T Consensus       133 ~P~PkeI~~~Ldk~VVGQe~AKKvLsVAVYnHYkRI~h  170 (564)
T KOG0745|consen  133 PPTPKEICEYLDKFVVGQEKAKKVLSVAVYNHYKRIYH  170 (564)
T ss_pred             CCChHHHHHHhhhheechhhhhheeeehhhHHHHHHhc
Confidence            69999999999999999999999999999999999987


No 3  
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=99.46  E-value=4.2e-14  Score=110.82  Aligned_cols=45  Identities=22%  Similarity=0.385  Sum_probs=41.7

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhccCCCCc
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNNISSSPS   46 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~~~~q~~   46 (67)
                      -+||+||+++||+|||||+.|||++|+|++|+|+|.+.+.+++.+
T Consensus         3 ~~tPreIV~eLd~yIIGQ~~AKkaVAIALRNR~RR~qL~~~lr~E   47 (444)
T COG1220           3 EMTPREIVSELDRYIIGQDEAKKAVAIALRNRWRRMQLEEELRDE   47 (444)
T ss_pred             CCCHHHHHHHHHhHhcCcHHHHHHHHHHHHHHHHHHhcCHHHhhc
Confidence            479999999999999999999999999999999999998877743


No 4  
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=99.40  E-value=2.3e-13  Score=103.98  Aligned_cols=39  Identities=54%  Similarity=0.760  Sum_probs=37.4

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhc
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNN   40 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~   40 (67)
                      +|+|++|+++||+|||||+.||++|+|||||||+|+...
T Consensus        59 ~~~p~~i~~~L~~~ViGq~~ak~~l~~av~~~~~r~~~~   97 (412)
T PRK05342         59 LPTPKEIKAHLDQYVIGQERAKKVLSVAVYNHYKRLRHG   97 (412)
T ss_pred             CCCHHHHHHHHhhHeeChHHHHHHHHHHHHHHHHhhhcc
Confidence            689999999999999999999999999999999999764


No 5  
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=99.39  E-value=2.5e-13  Score=104.46  Aligned_cols=38  Identities=55%  Similarity=0.745  Sum_probs=36.7

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYN   39 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~   39 (67)
                      +|+|++|+++||+|||||++||+++++||||||+|++.
T Consensus        65 ~~~p~~i~~~L~~~ViGQe~A~~~l~~av~~h~~~~~~  102 (413)
T TIGR00382        65 LPTPKEIKAHLDEYVIGQEQAKKVLSVAVYNHYKRLNF  102 (413)
T ss_pred             CCCHHHHHHHhcceecCHHHHHHHHHHHHHHHHhhhcc
Confidence            68999999999999999999999999999999999976


No 6  
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=99.34  E-value=7.6e-13  Score=103.74  Aligned_cols=40  Identities=33%  Similarity=0.497  Sum_probs=37.3

Q ss_pred             CChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhccC
Q psy13428          3 LVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNNIS   42 (67)
Q Consensus         3 ~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~~~   42 (67)
                      +||++|+++||+|||||++||++++||+||||+|.+....
T Consensus         1 ltP~~I~~~Ld~~IiGQ~eAkk~lsvAl~n~~~r~~~~~~   40 (441)
T TIGR00390         1 MTPREIVAELDKYIIGQDNAKKSVAIALRNRYRRSQLNEE   40 (441)
T ss_pred             CCHHHHHHHHhhhccCHHHHHHHHHHHHHhhhhhhccccc
Confidence            5999999999999999999999999999999999986543


No 7  
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=99.03  E-value=2.2e-10  Score=90.10  Aligned_cols=39  Identities=28%  Similarity=0.484  Sum_probs=36.5

Q ss_pred             CChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhcc
Q psy13428          3 LVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNNI   41 (67)
Q Consensus         3 ~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~~   41 (67)
                      ++|++|+++||+|||||++||+++++|+||||+|.....
T Consensus         4 ~~p~~I~~~Ld~~IiGQe~AkkalavAl~~~~~r~~l~~   42 (443)
T PRK05201          4 LTPREIVSELDKYIIGQDDAKRAVAIALRNRWRRMQLPE   42 (443)
T ss_pred             CCHHHHHHHhccccCCHHHHHHHHHHHHHHHHHHhcCCc
Confidence            699999999999999999999999999999999986553


No 8  
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=87.67  E-value=0.48  Score=39.55  Aligned_cols=30  Identities=23%  Similarity=0.241  Sum_probs=26.1

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHHHHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVYNHYK   35 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVyNHYk   35 (67)
                      ..+.+.|.+.||||+.|++.|+.+|..+..
T Consensus       450 ~~l~~~L~~~ViGQ~~ai~~l~~~i~~~~~  479 (758)
T PRK11034        450 KNLGDRLKMLVFGQDKAIEALTEAIKMSRA  479 (758)
T ss_pred             HHHHHHhcceEeCcHHHHHHHHHHHHHHhc
Confidence            467889999999999999999999987654


No 9  
>CHL00095 clpC Clp protease ATP binding subunit
Probab=87.02  E-value=0.6  Score=38.63  Aligned_cols=32  Identities=25%  Similarity=0.317  Sum_probs=27.7

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHHHHHHHh
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRI   37 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi   37 (67)
                      ..+.+.|.+.|+||+.|.+.++-|++.+...+
T Consensus       501 ~~l~~~L~~~v~GQ~~ai~~l~~~i~~~~~gl  532 (821)
T CHL00095        501 LHMEETLHKRIIGQDEAVVAVSKAIRRARVGL  532 (821)
T ss_pred             HHHHHHhcCcCcChHHHHHHHHHHHHHHhhcc
Confidence            46889999999999999999999998776544


No 10 
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=86.37  E-value=1.4  Score=29.85  Aligned_cols=33  Identities=21%  Similarity=0.248  Sum_probs=29.0

Q ss_pred             ChHHHHHHHhhhhccchhhhHHHHHHHHHHHHH
Q psy13428          4 VNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKR   36 (67)
Q Consensus         4 tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkR   36 (67)
                      ....+...|++.+.||+-|++++.=||..|...
T Consensus        15 ~~~~L~~~L~~~l~GQhla~~~v~~ai~~~l~~   47 (127)
T PF06309_consen   15 NITGLEKDLQRNLFGQHLAVEVVVNAIKGHLAN   47 (127)
T ss_pred             CHHHHHHHHHHHccCcHHHHHHHHHHHHHHHcC
Confidence            456788999999999999999999999999743


No 11 
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=83.91  E-value=1.8  Score=31.34  Aligned_cols=36  Identities=14%  Similarity=0.314  Sum_probs=28.3

Q ss_pred             hHHHHHHHhhhhccchhhhHHH-HHHHHHHHHHhhhc
Q psy13428          5 NPKIYEYLNKHVVGQEHAKKVL-SVAVYNHYKRIYNN   40 (67)
Q Consensus         5 PkeI~~~LD~yVIGQe~AKKvL-aVAVyNHYkRi~~~   40 (67)
                      =+|+.+.||+.+||.+.+|+.+ .+..+-.+.+++..
T Consensus        13 ~~~~~~~l~~~l~Gl~~vk~~i~e~~~~~~~~~~r~~   49 (284)
T TIGR02880        13 ITEVLDQLDRELIGLKPVKTRIREIAALLLVERLRQR   49 (284)
T ss_pred             HHHHHHHHHHhccCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3689999999999999999987 55566666666543


No 12 
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=80.42  E-value=1  Score=32.52  Aligned_cols=18  Identities=44%  Similarity=0.645  Sum_probs=16.0

Q ss_pred             hccchhhhHHHHHHHHHH
Q psy13428         16 VVGQEHAKKVLSVAVYNH   33 (67)
Q Consensus        16 VIGQe~AKKvLaVAVyNH   33 (67)
                      |+||+.||++|-+|.-..
T Consensus         5 I~GQe~aKrAL~iAAaG~   22 (206)
T PF01078_consen    5 IVGQEEAKRALEIAAAGG   22 (206)
T ss_dssp             SSSTHHHHHHHHHHHHCC
T ss_pred             hcCcHHHHHHHHHHHcCC
Confidence            899999999999988764


No 13 
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=79.05  E-value=1.8  Score=35.31  Aligned_cols=26  Identities=19%  Similarity=0.317  Sum_probs=22.6

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVY   31 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVy   31 (67)
                      ..+.+.|++.|+||+.|++.++-++.
T Consensus       446 ~~l~~~l~~~v~GQ~~ai~~l~~~i~  471 (731)
T TIGR02639       446 KNLEKNLKAKIFGQDEAIDSLVSSIK  471 (731)
T ss_pred             HHHHHHHhcceeCcHHHHHHHHHHHH
Confidence            46788999999999999998887765


No 14 
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=69.47  E-value=2  Score=32.92  Aligned_cols=18  Identities=39%  Similarity=0.516  Sum_probs=16.5

Q ss_pred             hccchhhhHHHHHHHHHH
Q psy13428         16 VVGQEHAKKVLSVAVYNH   33 (67)
Q Consensus        16 VIGQe~AKKvLaVAVyNH   33 (67)
                      ||||+.+|++|..++.|+
T Consensus        19 ivGq~~~k~al~~~~~~p   36 (350)
T CHL00081         19 IVGQEEMKLALILNVIDP   36 (350)
T ss_pred             HhChHHHHHHHHHhccCC
Confidence            899999999999998875


No 15 
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=68.25  E-value=3.9  Score=34.53  Aligned_cols=28  Identities=21%  Similarity=0.370  Sum_probs=24.1

Q ss_pred             hHHHHHHHhhhhccchhhhHHHHHHHHH
Q psy13428          5 NPKIYEYLNKHVVGQEHAKKVLSVAVYN   32 (67)
Q Consensus         5 PkeI~~~LD~yVIGQe~AKKvLaVAVyN   32 (67)
                      ...+.+.|.+.|+||+.|.+.++-++..
T Consensus       557 l~~l~~~L~~~v~GQ~~Av~~v~~~i~~  584 (852)
T TIGR03345       557 VLSLPDRLAERVIGQDHALEAIAERIRT  584 (852)
T ss_pred             HHHHHHHhcCeEcChHHHHHHHHHHHHH
Confidence            4567899999999999999998888864


No 16 
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=56.19  E-value=6.6  Score=32.19  Aligned_cols=17  Identities=47%  Similarity=0.632  Sum_probs=14.5

Q ss_pred             hhccchhhhHHHHHHHH
Q psy13428         15 HVVGQEHAKKVLSVAVY   31 (67)
Q Consensus        15 yVIGQe~AKKvLaVAVy   31 (67)
                      =|+||+.||++|=+|.-
T Consensus       180 DV~GQ~~AKrAleiAAA  196 (490)
T COG0606         180 DVKGQEQAKRALEIAAA  196 (490)
T ss_pred             hhcCcHHHHHHHHHHHh
Confidence            38999999999988753


No 17 
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]
Probab=51.21  E-value=14  Score=31.87  Aligned_cols=26  Identities=31%  Similarity=0.405  Sum_probs=21.1

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVY   31 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVy   31 (67)
                      ..+.+.|.+.||||+.|=+++|=||.
T Consensus       483 l~le~~L~~rViGQd~AV~avs~aIr  508 (786)
T COG0542         483 LNLERRLKKRVIGQDEAVEAVSDAIR  508 (786)
T ss_pred             HHHHHHHhcceeChHHHHHHHHHHHH
Confidence            35678899999999999887776664


No 18 
>KOG1051|consensus
Probab=49.54  E-value=17  Score=31.67  Aligned_cols=27  Identities=30%  Similarity=0.480  Sum_probs=23.8

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVYN   32 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVyN   32 (67)
                      +.+.+.|-+.|+||+.|=+++|-||+.
T Consensus       554 ~~L~~~L~~~V~gQ~eAv~aIa~AI~~  580 (898)
T KOG1051|consen  554 KKLEERLHERVIGQDEAVAAIAAAIRR  580 (898)
T ss_pred             HHHHHHHHhhccchHHHHHHHHHHHHh
Confidence            357788999999999999999999975


No 19 
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=44.50  E-value=13  Score=29.48  Aligned_cols=16  Identities=38%  Similarity=0.578  Sum_probs=13.2

Q ss_pred             hhccchhhhHHHHHHH
Q psy13428         15 HVVGQEHAKKVLSVAV   30 (67)
Q Consensus        15 yVIGQe~AKKvLaVAV   30 (67)
                      =||||+.||+...+-+
T Consensus       122 dViGqEeAK~kcrli~  137 (368)
T COG1223         122 DVIGQEEAKRKCRLIM  137 (368)
T ss_pred             hhhchHHHHHHHHHHH
Confidence            3899999999887654


No 20 
>PF08700 Vps51:  Vps51/Vps67;  InterPro: IPR014812 The VFT tethering complex (also known as GARP complex, Golgi associated retrograde protein complex, Vps53 tethering complex) is a conserved eukaryotic docking complex which is involved in recycling of proteins from endosomes to the late Golgi. Vps51 (also known as Vps67) is a subunit of VFT and interacts with the SNARE Tlg1 []. 
Probab=43.17  E-value=52  Score=19.20  Aligned_cols=36  Identities=22%  Similarity=0.241  Sum_probs=28.0

Q ss_pred             ChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhh
Q psy13428          4 VNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYN   39 (67)
Q Consensus         4 tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~   39 (67)
                      +..+|.....+..-.-+....-|---||+||+.+-.
T Consensus        20 s~~~i~~~~~~L~~~i~~~~~eLr~~V~~nY~~fI~   55 (87)
T PF08700_consen   20 SIKEIRQLENKLRQEIEEKDEELRKLVYENYRDFIE   55 (87)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHH
Confidence            456777777777777777778888899999998753


No 21 
>KOG2170|consensus
Probab=43.13  E-value=31  Score=27.35  Aligned_cols=30  Identities=23%  Similarity=0.370  Sum_probs=26.4

Q ss_pred             HHHHHHhhhhccchhhhHHHHHHHHHHHHH
Q psy13428          7 KIYEYLNKHVVGQEHAKKVLSVAVYNHYKR   36 (67)
Q Consensus         7 eI~~~LD~yVIGQe~AKKvLaVAVyNHYkR   36 (67)
                      .+..-|++.+.||+-||..+--|+..|+.-
T Consensus        75 ~Le~dL~~~lfGQHla~~~Vv~alk~~~~n  104 (344)
T KOG2170|consen   75 GLEKDLARALFGQHLAKQLVVNALKSHWAN  104 (344)
T ss_pred             HHHHHHHHHhhchHHHHHHHHHHHHHHhcC
Confidence            577889999999999999998899998853


No 22 
>cd03734 SOCS_CIS1 SOCS (suppressors of cytokine signaling) box of CIS (cytokine-inducible SH2 protein) 1-like proteins. Together with the SOCS proteins, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. CIS1, like SOCS1 and SOCS3, is involved in the down-regulation of the JAK/STAT pathway. CIS1 binds to cytokine receptors at STAT5-docking sites, which prohibits recruitment of STAT5 to the receptor signaling complex and results in the down-regulation of activation by STAT5.
Probab=40.68  E-value=21  Score=19.92  Aligned_cols=14  Identities=14%  Similarity=0.420  Sum_probs=12.6

Q ss_pred             CCChHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKH   15 (67)
Q Consensus         2 l~tPkeI~~~LD~y   15 (67)
                      +|-|+-+++||.+|
T Consensus        24 LpLP~~L~~yL~~y   37 (41)
T cd03734          24 LPLPRRMADYLRQY   37 (41)
T ss_pred             CCCCHHHHHHHHHC
Confidence            67899999999988


No 23 
>cd03738 SOCS_SOCS4 SOCS (suppressors of cytokine signaling) box of SOCS4-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=40.32  E-value=20  Score=21.50  Aligned_cols=18  Identities=11%  Similarity=0.157  Sum_probs=15.0

Q ss_pred             CCChHHHHHHHhhhhccc
Q psy13428          2 ILVNPKIYEYLNKHVVGQ   19 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQ   19 (67)
                      +|-|..|++||.+|=-.|
T Consensus        26 LPLP~~LK~YLkeY~y~~   43 (56)
T cd03738          26 LPIPSSMKLYLKEYHYKS   43 (56)
T ss_pred             CCCCHHHHHHHHhCCCcc
Confidence            688999999999995544


No 24 
>PF13654 AAA_32:  AAA domain; PDB: 3K1J_B.
Probab=40.10  E-value=9.5  Score=30.64  Aligned_cols=17  Identities=29%  Similarity=0.552  Sum_probs=0.0

Q ss_pred             hhhccchhhhHHHHHHH
Q psy13428         14 KHVVGQEHAKKVLSVAV   30 (67)
Q Consensus        14 ~yVIGQe~AKKvLaVAV   30 (67)
                      ..+|||++|.+++-.|+
T Consensus         8 ~~~iGQ~RA~~Al~~gl   24 (509)
T PF13654_consen    8 EGIIGQERAVEALEFGL   24 (509)
T ss_dssp             -----------------
T ss_pred             ccccccccccccccccc
Confidence            56899999999999888


No 25 
>cd03736 SOCS_SOCS2 SOCS (suppressors of cytokine signaling) box of SOCS2-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS2 has recently been shown to regulate neuronal differentiation by controlling expression of a neurogenic transcription factor, Neurogenin-1. SOCS2 binds to GH receptors and inhibits the activation of STAT5b induced by GH. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=40.09  E-value=22  Score=19.64  Aligned_cols=15  Identities=13%  Similarity=0.421  Sum_probs=13.0

Q ss_pred             CCChHHHHHHHhhhh
Q psy13428          2 ILVNPKIYEYLNKHV   16 (67)
Q Consensus         2 l~tPkeI~~~LD~yV   16 (67)
                      +|-|.-+++||.+|-
T Consensus        24 LpLP~~Lk~yL~~y~   38 (41)
T cd03736          24 LPLPTRLKDYLTEYT   38 (41)
T ss_pred             CCCCHHHHHHHHHCC
Confidence            578999999999884


No 26 
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=39.06  E-value=18  Score=28.47  Aligned_cols=22  Identities=27%  Similarity=0.454  Sum_probs=17.3

Q ss_pred             HHhhhhccchhhhHHHHHHHHHH
Q psy13428         11 YLNKHVVGQEHAKKVLSVAVYNH   33 (67)
Q Consensus        11 ~LD~yVIGQe~AKKvLaVAVyNH   33 (67)
                      .|++| |||++.|.-|.|.+.--
T Consensus        24 ~l~ef-iGQ~~vk~~L~ifI~AA   45 (332)
T COG2255          24 TLDEF-IGQEKVKEQLQIFIKAA   45 (332)
T ss_pred             cHHHh-cChHHHHHHHHHHHHHH
Confidence            45666 49999999999987653


No 27 
>cd03735 SOCS_SOCS1 SOCS (suppressors of cytokine signaling) box of SOCS1-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS1, like CIS1 and SOCS3, is involved in the down-regulation of the JAK/STAT pathway. SOCS1 has a dual function as a direct potent JAK kinase inhibitor and as a component of an E3 ubiquitin-ligase complex recruiting substrates to the protein degradation machinery.
Probab=38.33  E-value=24  Score=19.97  Aligned_cols=14  Identities=36%  Similarity=0.695  Sum_probs=12.3

Q ss_pred             CCChHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKH   15 (67)
Q Consensus         2 l~tPkeI~~~LD~y   15 (67)
                      +|-|.-+++||.+|
T Consensus        26 lpLP~~LKdyL~~y   39 (43)
T cd03735          26 IPLNPVLKDYLKSF   39 (43)
T ss_pred             CcCCHHHHHHHHhC
Confidence            57799999999987


No 28 
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=37.69  E-value=19  Score=27.36  Aligned_cols=18  Identities=33%  Similarity=0.499  Sum_probs=14.5

Q ss_pred             hhccchhhhHHHHHHHHH
Q psy13428         15 HVVGQEHAKKVLSVAVYN   32 (67)
Q Consensus        15 yVIGQe~AKKvLaVAVyN   32 (67)
                      -||||+.+|++|-+++-+
T Consensus         5 ~ivgq~~~~~al~~~~~~   22 (337)
T TIGR02030         5 AIVGQDEMKLALLLNVID   22 (337)
T ss_pred             ccccHHHHHHHHHHHhcC
Confidence            379999999998776655


No 29 
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=37.68  E-value=34  Score=28.74  Aligned_cols=27  Identities=33%  Similarity=0.445  Sum_probs=22.9

Q ss_pred             HHHHHHhhhhccchhhhHHHHHHHHHH
Q psy13428          7 KIYEYLNKHVVGQEHAKKVLSVAVYNH   33 (67)
Q Consensus         7 eI~~~LD~yVIGQe~AKKvLaVAVyNH   33 (67)
                      .+.+.|.+.|+||+.|-+.++-++...
T Consensus       558 ~l~~~l~~~v~GQ~~av~~v~~~i~~~  584 (852)
T TIGR03346       558 HMEEVLHERVVGQDEAVEAVSDAIRRS  584 (852)
T ss_pred             HHHHHhhcccCCChHHHHHHHHHHHHH
Confidence            466789999999999999988888764


No 30 
>PF09702 Cas_Csa5:  CRISPR-associated protein (Cas_Csa5);  InterPro: IPR010157 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a minor family of Cas protein found in various species of Sulfolobus and Pyrococcus (all archaeal). It is found with two different CRISPR loci in Sulfolobus solfataricus.
Probab=36.03  E-value=47  Score=22.33  Aligned_cols=30  Identities=17%  Similarity=0.199  Sum_probs=22.9

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHH
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVY   31 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVy   31 (67)
                      |||+.|+..+|+.=-=.=--|||+=++|+.
T Consensus        72 lPt~~eVe~Fl~~v~~di~~ArkvgalAma  101 (105)
T PF09702_consen   72 LPTDEEVEDFLDDVERDIYYARKVGALAMA  101 (105)
T ss_pred             CCChHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            799999999998754444568888777763


No 31 
>PRK13407 bchI magnesium chelatase subunit I; Provisional
Probab=32.56  E-value=26  Score=26.55  Aligned_cols=16  Identities=31%  Similarity=0.571  Sum_probs=13.7

Q ss_pred             hhccchhhhHHHHHHH
Q psy13428         15 HVVGQEHAKKVLSVAV   30 (67)
Q Consensus        15 yVIGQe~AKKvLaVAV   30 (67)
                      .|+||+.+|+.|.++.
T Consensus         9 ~i~Gq~~~~~~l~~~~   24 (334)
T PRK13407          9 AIVGQEEMKQAMVLTA   24 (334)
T ss_pred             HhCCHHHHHHHHHHHH
Confidence            3789999999988866


No 32 
>cd03740 SOCS_SOCS6 SOCS (suppressors of cytokine signaling) box of SOCS6-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=32.05  E-value=33  Score=18.93  Aligned_cols=14  Identities=21%  Similarity=0.332  Sum_probs=12.1

Q ss_pred             CCChHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKH   15 (67)
Q Consensus         2 l~tPkeI~~~LD~y   15 (67)
                      +|-|.-|++||-+|
T Consensus        26 LpLP~~Lk~yL~~~   39 (41)
T cd03740          26 LPLPNKMKGYLLEK   39 (41)
T ss_pred             CCCCHHHHHHHHcC
Confidence            67899999999876


No 33 
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit. A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.
Probab=31.97  E-value=25  Score=28.51  Aligned_cols=19  Identities=32%  Similarity=0.396  Sum_probs=16.3

Q ss_pred             hhccchhhhHHHHHHHHHH
Q psy13428         15 HVVGQEHAKKVLSVAVYNH   33 (67)
Q Consensus        15 yVIGQe~AKKvLaVAVyNH   33 (67)
                      -||||+.+|++|.++.-+.
T Consensus         5 ~ivGq~~~~~al~~~av~~   23 (633)
T TIGR02442         5 AIVGQEDLKLALLLNAVDP   23 (633)
T ss_pred             hhcChHHHHHHHHHHhhCC
Confidence            4899999999999988764


No 34 
>COG1738 yhhQ Uncharacterized member of the PurR regulon [General function prediction only]
Probab=30.38  E-value=69  Score=23.62  Aligned_cols=34  Identities=29%  Similarity=0.235  Sum_probs=28.5

Q ss_pred             CCChHHHHHHHhhhhccchhhhHHHHHHHHHHHHHhhhc
Q psy13428          2 ILVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHYKRIYNN   40 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHYkRi~~~   40 (67)
                      .+.||-+.+-+=.|+|||-     +=|-+||..||...+
T Consensus       122 ~~~~RI~lASl~AyivsQ~-----~Dv~vf~~lkr~~~~  155 (233)
T COG1738         122 SFVPRIALASLLAYIVSQL-----LDVWVFNRLKRRTGG  155 (233)
T ss_pred             cchHHHHHHHHHHHHHHHH-----HHHHHHHHHHHhcCC
Confidence            3689999999999999984     567899999997543


No 35 
>cd03717 SOCS_SOCS_like SOCS (suppressors of cytokine signaling) box of SOCS-like proteins. The CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. These intracellular proteins regulate the responses of immune cells to cytokines. Identified as negative regulators of the cytokine-JAK-STAT pathway, they seem to play a role in many immunological and pathological processes. The function of the SOCS box is the recruitment of the ubiquitin-transferase system. Related SOCS boxes are also present in Rab40-like proteins and insect proteins of unknown function that also contain a NEUZ (domain in neuralized proteins) domain.
Probab=30.08  E-value=37  Score=18.18  Aligned_cols=14  Identities=14%  Similarity=0.434  Sum_probs=11.8

Q ss_pred             CCChHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKH   15 (67)
Q Consensus         2 l~tPkeI~~~LD~y   15 (67)
                      +|-|.-|++||..|
T Consensus        26 LpLP~~Lk~yL~~y   39 (39)
T cd03717          26 LPLPRRLKDYLKEY   39 (39)
T ss_pred             CCCCHHHHHHHHcC
Confidence            67899999999765


No 36 
>PRK07471 DNA polymerase III subunit delta'; Validated
Probab=29.78  E-value=30  Score=26.39  Aligned_cols=25  Identities=16%  Similarity=0.048  Sum_probs=19.0

Q ss_pred             CChHHHHHHHhhhhccchhhhHHHHHHHHH
Q psy13428          3 LVNPKIYEYLNKHVVGQEHAKKVLSVAVYN   32 (67)
Q Consensus         3 ~tPkeI~~~LD~yVIGQe~AKKvLaVAVyN   32 (67)
                      |.|+...     -||||+.|++.|.=++.+
T Consensus        13 ~~P~~~~-----~iiGq~~~~~~L~~~~~~   37 (365)
T PRK07471         13 PHPRETT-----ALFGHAAAEAALLDAYRS   37 (365)
T ss_pred             CCCCchh-----hccChHHHHHHHHHHHHc
Confidence            5666653     378999999999877765


No 37 
>PF12630 Pox_polyA_pol_N:  Poxvirus poly(A) polymerase N-terminal domain;  InterPro: IPR024398 This domain is found at the N terminus of the pox virus Poly(A) polymerase protein [].  Poly(A) polymerase (2.7.7.19 from EC) catalyses template-independent extension of the 3'-end of a DNA or RNA strand by one nucleotide at a time. The Poxvirus enzyme creates the 3'(poly)A tail of mRNAs, and is a heterodimer of a catalytic and a regulatory subunit. This is the catalytic subunit.; PDB: 3ERC_C 3ER8_D 3OWG_A 2GA9_D 2GAF_D 3ER9_B.
Probab=29.64  E-value=45  Score=22.55  Aligned_cols=23  Identities=13%  Similarity=0.096  Sum_probs=17.5

Q ss_pred             CChHHHHHHHhhhhccchhhhHH
Q psy13428          3 LVNPKIYEYLNKHVVGQEHAKKV   25 (67)
Q Consensus         3 ~tPkeI~~~LD~yVIGQe~AKKv   25 (67)
                      -+|.||++.+++|.--|+++.++
T Consensus        60 ~s~~eIk~rI~~YFsKQ~~~~ki   82 (108)
T PF12630_consen   60 SSDSEIKRRILEYFSKQRRTYKI   82 (108)
T ss_dssp             S-THHHHHHHHHHTTGGGC---H
T ss_pred             CCHHHHHHHHHHHHHhcccHHHH
Confidence            36899999999999999999864


No 38 
>cd03742 SOCS_Rab40 SOCS (suppressors of cytokine signaling) box of Rab40-like proteins. Rab40 is part of the Rab family of small GTP-binding proteins that form the largest family within the Ras superfamily. Rab proteins regulate vesicular trafficking pathways, behaving as membrane-associated molecular switches. Rab40 is characterized by a SOCS box c-terminal to the GTPase domain. The SOCS boxes interact with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=28.81  E-value=43  Score=19.01  Aligned_cols=17  Identities=12%  Similarity=0.131  Sum_probs=14.0

Q ss_pred             CCChHHHHHHHhhhhcc
Q psy13428          2 ILVNPKIYEYLNKHVVG   18 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIG   18 (67)
                      +|-|.-+++||-+|-.+
T Consensus        26 LPLP~~Lk~yLkey~~~   42 (43)
T cd03742          26 LPLPVSIKSHLKSFAMA   42 (43)
T ss_pred             CCCCHHHHHHHHhcccc
Confidence            67899999999998543


No 39 
>PRK00665 petG cytochrome b6-f complex subunit PetG; Reviewed
Probab=28.69  E-value=42  Score=18.87  Aligned_cols=11  Identities=64%  Similarity=0.966  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHH
Q psy13428         26 LSVAVYNHYKR   36 (67)
Q Consensus        26 LaVAVyNHYkR   36 (67)
                      |-||-|+.|||
T Consensus        21 lfvaAylQYrR   31 (37)
T PRK00665         21 LFVAAWNQYKR   31 (37)
T ss_pred             HHHHHHHHHhc
Confidence            56899999998


No 40 
>cd03737 SOCS_SOCS3 SOCS (suppressors of cytokine signaling) box of SOCS3-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS3, like CIS1 and SOCS1, is involved in the down-regulation of the JAK/STAT pathway.  SOCS3 inhibits JAK activity indirectly through recruitment to the cytokine receptors. SOCS3 has been shown to play an essential role in placental development and a non-essential role in embryo development. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=28.56  E-value=32  Score=19.31  Aligned_cols=11  Identities=27%  Similarity=0.374  Sum_probs=8.5

Q ss_pred             hHHHHHHHhhh
Q psy13428          5 NPKIYEYLNKH   15 (67)
Q Consensus         5 PkeI~~~LD~y   15 (67)
                      |.-|++||.+|
T Consensus        28 P~~Lk~yL~~Y   38 (42)
T cd03737          28 PLPIKEFLDQY   38 (42)
T ss_pred             cHHHHHHHHhC
Confidence            44499999877


No 41 
>CHL00181 cbbX CbbX; Provisional
Probab=27.04  E-value=1.5e+02  Score=21.58  Aligned_cols=21  Identities=19%  Similarity=0.433  Sum_probs=18.7

Q ss_pred             HHHHHHHhhhhccchhhhHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVL   26 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvL   26 (67)
                      .++.+.||.-++|++..|+.+
T Consensus        15 ~~~~~~l~~~l~Gl~~vK~~i   35 (287)
T CHL00181         15 QEVLDILDEELVGLAPVKTRI   35 (287)
T ss_pred             HHHHHHHHHhcCCcHHHHHHH
Confidence            578899999999999999966


No 42 
>PF12875 DUF3826:  Protein of unknown function (DUF3826);  InterPro: IPR024284 This is a putative sugar-binding family.; PDB: 3KDW_A 3G6I_A.
Probab=25.68  E-value=1.2e+02  Score=22.30  Aligned_cols=30  Identities=30%  Similarity=0.392  Sum_probs=18.1

Q ss_pred             HHHHHHHhhhhccchhhhHHHHH--HHHHHHHHhhhc
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSV--AVYNHYKRIYNN   40 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaV--AVyNHYkRi~~~   40 (67)
                      .+|++.|     |...++|.-.|  .|.|||+-++.-
T Consensus        11 ~KIVa~L-----~L~Da~K~~~V~~VIan~y~~L~Di   42 (188)
T PF12875_consen   11 QKIVAKL-----GLTDAAKEKRVRNVIANQYRELNDI   42 (188)
T ss_dssp             HHHHHHH-------S-HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHc-----CCCcHHHHHHHHHHHHHHHHHHHHH
Confidence            4566666     55665554444  799999988643


No 43 
>PRK10865 protein disaggregation chaperone; Provisional
Probab=25.38  E-value=58  Score=27.64  Aligned_cols=27  Identities=26%  Similarity=0.378  Sum_probs=22.4

Q ss_pred             HHHHHHHhhhhccchhhhHHHHHHHHH
Q psy13428          6 PKIYEYLNKHVVGQEHAKKVLSVAVYN   32 (67)
Q Consensus         6 keI~~~LD~yVIGQe~AKKvLaVAVyN   32 (67)
                      ..+.+.|.+.||||+.|-+.++-+|..
T Consensus       560 ~~l~~~l~~~viGQ~~ai~~l~~~i~~  586 (857)
T PRK10865        560 LRMEQELHHRVIGQNEAVEAVSNAIRR  586 (857)
T ss_pred             HHHHHHhCCeEeCCHHHHHHHHHHHHH
Confidence            357788999999999999988877754


No 44 
>cd03739 SOCS_SOCS5 SOCS (suppressors of cytokine signaling) box of SOCS5-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS5 inhibits Th2 differentiation by inhibiting IL-4 signaling. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system.   The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=25.06  E-value=52  Score=19.84  Aligned_cols=18  Identities=11%  Similarity=0.216  Sum_probs=15.3

Q ss_pred             CCChHHHHHHHhhhhccc
Q psy13428          2 ILVNPKIYEYLNKHVVGQ   19 (67)
Q Consensus         2 l~tPkeI~~~LD~yVIGQ   19 (67)
                      +|-|+-+++||.+|=--|
T Consensus        26 LPLP~~LKdyLkeY~y~~   43 (57)
T cd03739          26 LPLPSMLQDFLKEYHYKQ   43 (57)
T ss_pred             CcCCHHHHHHHHhCCCCc
Confidence            578999999999996655


No 45 
>CHL00008 petG cytochrome b6/f complex subunit V
Probab=24.39  E-value=59  Score=18.29  Aligned_cols=12  Identities=42%  Similarity=0.611  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHh
Q psy13428         26 LSVAVYNHYKRI   37 (67)
Q Consensus        26 LaVAVyNHYkRi   37 (67)
                      |-||-|..|||=
T Consensus        21 lfvaAylQYrRg   32 (37)
T CHL00008         21 LFVTAYLQYRRG   32 (37)
T ss_pred             HHHHHHHHHhhc
Confidence            568999999984


No 46 
>PF13865 FoP_duplication:  C-terminal duplication domain of Friend of PRMT1
Probab=22.44  E-value=1.9e+02  Score=17.41  Aligned_cols=29  Identities=10%  Similarity=0.070  Sum_probs=20.1

Q ss_pred             CChHHHHHHHhhhhccchhhhHHHHHHHHHHH
Q psy13428          3 LVNPKIYEYLNKHVVGQEHAKKVLSVAVYNHY   34 (67)
Q Consensus         3 ~tPkeI~~~LD~yVIGQe~AKKvLaVAVyNHY   34 (67)
                      +|-.||-++||.|.   ..+|.-|=--+=+++
T Consensus        40 kT~EeLDaELD~Ym---~~~~~~LD~~Ld~Y~   68 (74)
T PF13865_consen   40 KTAEELDAELDAYM---SKTKSKLDAELDSYM   68 (74)
T ss_pred             CCHHHHHHHHHHHH---HHHHHHHHHHHHHHH
Confidence            57789999999999   555555544444443


No 47 
>PF10638 Sfi1_C:  Spindle body associated protein C-terminus  ;  InterPro: IPR018907  This C-terminal domain of spindle-body-associated protein Sfi1 has an important role to play in the bridge-splitting during bi-polar spindle assembly, and this separation event possibly requires interaction with integral components of the nuclear envelope, such as the Mps2-Bbp1 complex []. Centrally to this domain is a region carrying centrin-binding repeats with repeating units containing tryptophan, IPR013665 from INTERPRO. 
Probab=21.83  E-value=96  Score=20.93  Aligned_cols=27  Identities=30%  Similarity=0.420  Sum_probs=22.2

Q ss_pred             hhhccchhhhHHHHHHHHHHHHHhhhc
Q psy13428         14 KHVVGQEHAKKVLSVAVYNHYKRIYNN   40 (67)
Q Consensus        14 ~yVIGQe~AKKvLaVAVyNHYkRi~~~   40 (67)
                      .-|=|-|+-|+-=-=|+-|||.|.+..
T Consensus        21 ~TIPGSE~vK~~rmeamk~~YsrARRa   47 (108)
T PF10638_consen   21 NTIPGSERVKRYRMEAMKNHYSRARRA   47 (108)
T ss_pred             cccCchHHHHHHHHHHHHHHHHHHHhh
Confidence            346688889888888999999999755


No 48 
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=21.48  E-value=26  Score=20.47  Aligned_cols=9  Identities=22%  Similarity=0.224  Sum_probs=6.3

Q ss_pred             CCCChHHHH
Q psy13428          1 MILVNPKIY    9 (67)
Q Consensus         1 ~l~tPkeI~    9 (67)
                      ++|+|++|.
T Consensus        30 liP~P~~i~   38 (73)
T PF11823_consen   30 LIPTPREIS   38 (73)
T ss_pred             EeCCChhcc
Confidence            367888874


No 49 
>smart00253 SOCS suppressors of cytokine signalling. suppressors of cytokine signalling
Probab=21.23  E-value=69  Score=17.41  Aligned_cols=14  Identities=29%  Similarity=0.572  Sum_probs=11.4

Q ss_pred             CCChHHHHHHHhhh
Q psy13428          2 ILVNPKIYEYLNKH   15 (67)
Q Consensus         2 l~tPkeI~~~LD~y   15 (67)
                      +|-|.-|++||..|
T Consensus        30 LpLP~~lk~yL~~y   43 (43)
T smart00253       30 LPLPPKLKDYLSYY   43 (43)
T ss_pred             CCCCHHHHHHHHhC
Confidence            57789999998765


No 50 
>PF10309 DUF2414:  Protein of unknown function (DUF2414);  InterPro: IPR019416  This entry contains proteins that have no known function. 
Probab=21.14  E-value=80  Score=18.96  Aligned_cols=14  Identities=21%  Similarity=0.358  Sum_probs=12.4

Q ss_pred             CChHHHHHHHhhhh
Q psy13428          3 LVNPKIYEYLNKHV   16 (67)
Q Consensus         3 ~tPkeI~~~LD~yV   16 (67)
                      +++.+|++|++.|.
T Consensus        16 lsT~dI~~y~~~y~   29 (62)
T PF10309_consen   16 LSTDDIKAYFSEYF   29 (62)
T ss_pred             CCHHHHHHHHHHhc
Confidence            57899999999993


No 51 
>PF13867 SAP30_Sin3_bdg:  Sin3 binding region of histone deacetylase complex subunit SAP30; PDB: 2LD7_A.
Probab=20.31  E-value=1.8e+02  Score=16.42  Aligned_cols=19  Identities=26%  Similarity=0.328  Sum_probs=13.6

Q ss_pred             hhhhHHHHHHHHHHHHHhh
Q psy13428         20 EHAKKVLSVAVYNHYKRIY   38 (67)
Q Consensus        20 e~AKKvLaVAVyNHYkRi~   38 (67)
                      .-.|.-|+.||..||....
T Consensus        20 ~~sK~qLa~~V~kHF~s~~   38 (53)
T PF13867_consen   20 RSSKEQLANAVRKHFNSQP   38 (53)
T ss_dssp             S--HHHHHHHHHHHHTT--
T ss_pred             CCCHHHHHHHHHHHHhcCC
Confidence            6778899999999997655


Done!